7@<Y>,]d<|D$D$$YB$sD$D$ $D$0D$YnD$ |[L$ $ntD$$D$ и$Q$;$;D$D$p; $Wu ;$L$@ $L$DL$ <ÃT$J J J ȃË\$T$%%B%BفJà L$T$ 0|9~Qa|f~7A|F~W$,$D$O 1 Ƀ  Ѓ Ã$L$$L$u1ÉD$$<D$1;T$$}RL$ $BT$L$(D$ L$ $L$D$L$ T$D$  ȋL$D$;T$$|D$ÃLL$T $M$L$\4L$L$HL$ \4L$L$DL$L$@L$L$0L$e u1LËt$@t$8D$4L$@T$0 9=D$(D$$ut$4FΉt$< u|$4uW$c$D$ 댋L$8 $L$4+L$8L$qt$4\$(T$$ŃD$,ujuGu(JME;,$E@+ uω$C@Ћl$, u$B@Ћl$,\$(뛋D$<)HA $(D$ 8(L$t$ l$,T$$ÃD$(S(~XL$4) $؉L$l$,\$(ƒ#L$D $l$D$$D$hQl$,\$(T$$L$H $l$\$?Qt$M\$PQL$L trD$$D$@ tTL$H t21ۉ\$H\$L\$PD$<9D$@+D$XD$TD$TD$H$D$H@@빉$C@럋D$L$D$L@@Ћ\$Pr$L$$L$ÃL$` $\$P\$L$HL$_L\$P.mW$$D$s \$PML$T$P B@T%tRD$1ËB@T%t*$EƒD$uZ T$tøË^$$D$ ÃxD$t$ $$L$\4L$L$pL$ \4L$L$lL$L$hL$L$@L$讇 u1xËL$h $NL$h $9D$d(D$`L$p $L$`L$L$XL$L$TL$ 9ND$X@@T%uF^$$$D$ |$tu1xËL$t uD$t$D$t@@؋D$X@D$dL$l $L$XL$HL@@T%u^$8$D$k xA@D$d$L$dL$D$t|$tHD$tD$LL$h $D$D$h@@4@ Љ$L$HL$L$\L$k|$\D$L$D$HD$D$\D$bD$LL$h $L$D$h@@4@ Љ$L$HL$L$\L$+|$\ D$L$D$HD$D$\D$bD$LD$`L$p $L$`L$L$XL$L$TL$ ?L}D$T@@T%ID$T@9D$T@ $L$$L$L$,L$N|$,D$LD$LL$$ L$T $L$L$ K^$L$D$" /^$$D$ 1xËT$BuBËBJIÃ\$T$ BDtTËJȃËBu=J $T$ BBu ` É$BD$p&\$T$ BÃ`L$d $WWl$h\$d}̓ 9H9uЃ`ËCH9ʼnl$h|C)ȋKI @`ËC C tC C `É$l$u1`ÉD$8 $D$XD$\|$h 1!D$X!L$\L$8 $cD$TL$8 $PD$PL$8 $=D$LL$8 $*D$HL$8 $D$DL$8 $ËD$8 8[ $L$XL$L$\L$L$TL$ L$PL$L$LL$L$HL$L$DL$\$ D$$L$( Ãt\$0$r\$0D$d@ L$h؃`ËL$8 $i1ɉ1 D$X L$\K $L$cFl$h\$dC C k `Ë^$$D$ 1`ÃL$ $\$T$ H9tltd9|1ËCH9|6C)ȋKI @$L$t1$T$t 1<à L$ $L$L$L$L$u ËD$u1 ËW$$D$' Ã(L$0 $$L$L$L$L$$L$ ~ u1(ËD$$@@T%JD$$@:L$$I( $L$ L$L$L$(u1(ËL$, $T$,|$}L$H9D$t^$ $D$\ 1(Á|$~W$/$D$5 1(ËBu!$蟴T$,BBu1(ËJ $L$$L$L$,u1(ËA$t $D$ D$D$D$ L$,A tQ A t--(É$B@^$$D$r 1(à \$C t[1C9}|$4D$ |$ 1ۋG9}f<$\$,\$D$ $D$L$ $l$|$4\$,ƒ| D$ |D$ CG9|OG@19}`G@ Q I$B@T%A@T%jQ| D$ |D$ C9|1;T$(D$ <tBT$,$Ãt%L$ $\$\$|$4\$T$,uŃ $C@^$$D$袷 1\$ T$ ؃uȃÃ0L$<|$@iD$,uD$8CD$4@$u 0Ã|$@ ((D$$1l$ ;l$$L$8 $l$(l$D$,Ћt$4l$(‹D$ N$ȋ )ȉ4$D$D$D$|$u 0ËT$(;T$$}GL$ $T$ T$D$L$8 $L$ L$D$,ЋT$ ;D$t 0B;T$$|D$0Ãu 0ÉL$ E;l$$(0É~(D$$L$8 $<L$L$^QL$<0øz,f T$B(J,9uub,J$ $J,L$hT$B$B$u x_$ $D$k ËB(J$ȉ$D$B,J()D$OT$B(B( Ã(1D$ (*L$0 $\$$\$j|$,\$$ƋD$ O$ȉʼnt$D$u+D$41(Ã<$)D$L$D$$L$0L$L$PL$, $l$,Ãu (ËL$ T$ M$؉\$ M$ȉD$L$ $D$$L$$L$l$,\$$T$L$E09~]0E4((ø+D$4L$T$1(CD$ T$B$JB,J, $@L$8T$B$B$uA B($VT$HB8B<B@$<L$L$u 1 ËB=gT$B<$L$ L$L$$L$D$ k|ËL$ $\$u ËC@C@S8J|w$T$T$x\$$u ËL$ $D$D$~[L$M\$T$u:$L$L$T$T$u Ã|ЃøJj릋S8J$T$T$l$\$uAM8É,$D$D$\$T$$uD$L$AH8ËL$ $L$L$~)L$L\$T$uS8@J\؃hT.$ $G ƒu!u1 u$B@D$$JT$tʉ$>$L$q\ƒhTu@Y$J$D$Ű T$$D$Yu1ËhT$L$ L$: D$ ÃT$ B@T%tL$ $JL$É$L$L$L$L$u1ËL$ $L$L$L$L$| $Ãu1ÃL$ $(\$u ËC8~^S8J|R$T$T$u ËL$ $D$L$L$b\$T$u J}S8$L$ L$L$$L$L$ Ã$L$, $e$L$L$L$L$L$ Cm Wu1$Ã|$} $h$D$ 1$Ã|$(~ $v$D$ٮ 1$1;L$}D$$L$L$L$A;L$| t- --$ËL$( $L$L$L$L$~trtSL$( $D$D$3u%^$$D$D$D$践 1$É$L$ǿ$ù< $L$譿$--$1$yL$$ $$L$L$L$k u1ËL$ $L$L$L$L$ u1ËL$ $L$L$L$L$_u1Ãu--É$ÃT$ B@T%t+BD$ |T$$9D$ |1ø$L$L$L$L$^u ËL$ $L$L$L$L$tt 1øà l$\$T$BH9|+B)ȋJI PJ IMJ$IM É$\$\D$ $%L$L$ $L$AL\$Xك 1D$DT$Hك 1D$|$Xt$TD$819}9~,C9| $l$$AL$0ǃu C L1;l$X}/ 21t$T QE;l$X|ыD$XD$(D$,D$$D$0|$0||$,u<$uD$8LË\$0|$ߋ RʃuL$0ʼnȉL$;L$@u ;D$<L$,;T$D;L$HL$0 $!|$u-<$T$8u1L u$B@L$8 $D$ D$iT$ t$Xl$T|$u u$B@Ћ|$됋D$< D$19} ;D$0L$(D$(D$P$D$0D$D$D$M|$D$4|$4L$4luD$4 RʋD$;L$@w;u;D$ 1`1;\$\}1L$hI \$P $ T$4\$P9~‰D$4C;\$\|Ϲ $AL$i-D$Xu  `ù $L$4AL$A-D$8uN D$X$zD$8$nD$T$bT$@u1` u$B@ $L$\T$,ŃD$Tuz 1;t$\}OL$hI t$P $L$Pl$T‰θL$XыT$8F;t$\|D$\D$DD$4D$H|$H| |$Du1\$D1ҋL$\9} Bt$0u${`ÃD$@l$D1;T$\} l$LR$CD$ u^$H1D$ڋ D$$1ËD$XD$ËK 9rk \$=t$l$11ҋNF9t%9|+A9$)ËQAÃF9uۉ)É؃萋 u^$`1D$, ÃD$(X1L$D$(@99C;D$$L$ $L$  D$\$)l$D$%L$+D$D$ D$ $A D$AD$%L$ \$kCD$(@9v $L$  D$D$$)D$%蕊 u^$n1D$1 1Ã$L$0l$(T$,@9uR,$T$>u1$É$L$L$L$L$t1$ËL$ $L$L$ $É)=,$T$D$ L$rD$L$( $L$,L$ L$L$0L$ND$ L$ $L$ L$P$Ã4L$< $|1L$L$0L$L$,L$ G u14ËL$, $D$uD$0D$04ËL$0 $L$ L$L$L$t14ËL$, $D$L$L$u14ËL$ $D$$D$}D$(D$$$D$(4$D$4u D$(͉D$($裭$L$ L$L$L$L$$L$ T$(u t D$(녉$B@ u1ËL$I $L$L$u1--ÃL$ $e7L$$1L$L$L$ = u1ËL$I $L$L$u1--ÃT$JITtL$ I $T$Z)1T$Bu $AËJ uB$B@@ЋT$уL$I $?à dR<7L. .P. dX.R<t..7. e. !.b.@. $ } @.D$$7D$@.D$a ÃT$J J J ȃË\$T$%%B%BفJÃ0L$4 $t‹D$4@ T$,@D$($ۢD$$L$8 $ytD$ L$< $itl$$D$ED$D$(X~@ ,$ى\$IL$L$‰D$ tV+tN t%-tD$4$D$,HD$T$t0D$8$D$ HD$T$tT$‹L$$A $L$L$pD$<$D$HD$L$\tT$L$rK? L$( $"L$L$L$L$L$ L$L$u: u1 ËD$$D$D$D$D$l" $D$ ÃXL$` $ _L$L$TL$L$PL$ L$ $$lL$B $$h+$l)‰T$,щ$t虿$u:$$`$u 1Ĝ u$B@ፌ$S $$XƄS/DŽ$\$ $$tL$D$: $uU$$u+Z$e#D$$D$TS 1Ĝ ủ$B@뿉$Z $=PKtB$k=St#e#$$\D$$D$ $ĜÉ$$t L$D$c $%$觩 $$ $葩 $x$ ${ $|$ $蒩 $$ $| $$ $f $$ $# $p$ $ D$ $ $ $pD$ .$l$ $$t*L$D$` $"$Ѩ $D$,$$p~ DŽ$pD$NÉD$H1$d;$p}KM U9A,$'$d$\$H/u/C\$HF$d;$p|$l$t$T$X $D$ND$+$XD$Me# $$SL$$L$$L$ $L$$L$$xL$$|L$$L$ k H$ $L$NL$D$(D$T$(D$$ t|$$ $\d$B@܋E E %=\t1\f# $ \D$ tf$f#L$zT$ D$ t3=St$f#$t:f#D$腾 D$øDf#$B@ЋT$ LM T$ D$멃hD$`L$p $Pf#L$L$DL$L$@L$ L$L$X $L$L$1ɉL$ D$D$$$~LT$u1XÉ$L$L$XÍL$뾃XD$ D$L$` $/L$L$$L$L$ L$ L$L$ u1XËD$,D$L$$ $L$,L$L$ L$|$t>1ɉL$ D$D$$$KT$u1XÉ$L$L$&XÍL$뾃\D$$D$ D$L$d $/L$L$(L$L$$L$ L$L$ u1\ËD$0D$L$( $L$0L$L$$L$L$ L$ |$t>1ɉL$"D$D$($KT$u1\É$L$L$a\ÍL$뾃\D$$D$ D$L$d $/L$L$(L$L$$L$ L$L$R u1\ËD$0D$L$( $L$0L$L$$L$L$ L$ |$t>1ɉL$"D$D$($?JT$u1\É$L$L$\ÍL$뾃\D$$D$ D$L$d $/L$L$(L$L$$L$ L$L$ u1\ËD$0D$L$( $L$0L$L$$L$L$ L$ |$t>1ɉL$P!D$D$($zIT$u1\É$L$L$\ÍL$뾃dD$,D$(D$L$l $/L$L$0L$L$,L$ L$(L$L$L$ u1dËD$8D$L$0 $L$8L$L$,L$L$(L$ |$tq1ɉL$ D$$D$0$HT$$u1dù/ $T$L$L$L$(L$ T T$$D$ tD$ dÉ$B@L$닃\D$$D$ D$L$d $!/L$L$(L$L$$L$ L$L$ u1\ËD$0D$L$( $L$0L$L$$L$L$ L$ |$t>1ɉL$D$D$($GT$u1\É$L$L$\ÍL$뾃\D$$D$ D$L$d $5/L$L$(L$L$$L$ L$L$ u1\ËD$0D$L$( $L$0L$L$$L$L$ L$ |$t>1ɉL$D$D$($FT$u1\É$L$L$M\ÍL$뾃\D$$D$ D$L$d $L/L$L$(L$L$$L$ L$L$> u1\ËD$0D$L$( $L$0L$L$$L$L$ L$ |$t>1ɉL$D$D$($+FT$u1\É$L$L$\ÍL$뾃dD$,D$(D$L$l $c/L$L$0L$L$,L$ L$(L$L$L$q u1dËD$8D$L$0 $L$8L$L$,L$L$(L$ |$tq1ɉL$0D$$D$0$^ET$$u1dù{/ $T$L$L$L$(L$ P T$$D$ tD$ dÉ$B@L$닃LD$L$T $/L$L$L$L$L$ u1LËL$ $L$ L$L$L$"D$D$$DL$ $L$ L$LÃLD$L$T $/L$L$L$L$L$  u1LËL$ $L$ L$L$L$-D$D$$DL$ $L$ L$LÃLD$L$T $/L$L$L$L$L$ u1LËL$ $L$ L$L$L$)6D$D$$CL$ $L$ L$LÃLD$L$T $/L$L$L$L$L$  u1LËL$ $L$ L$L$L$J@D$D$$CL$ $L$ L$LÃTD$D$L$\ $/L$L$ L$L$L$ L$L$ u1TËD$=-uD$L$ $L$(L$L$L$L$L$ BD$D$ $tBL$ $L$(L$TÃ$D$L$, $/L$L$ L$L$L$ L$L$ u1$ËL$ $L$L$.<D$L$ $L$L$i$Ã$D$L$, $ /L$L$ L$L$L$ L$L$p u1$ËL$ $L$L$;D$L$ $L$L$$Ã$D$L$, $"/L$L$ L$L$L$  u1$ËD$ @@T%tLD$ @ D$D$ @D$L$ $L$L$#;D$L$ $L$ IL$[$ËL$ $L$L$L$L$i5t1$ËL$ $L$L$:D$L$ $L$L$$Ã$D$L$, $>/L$L$ L$L$L$  u1$ËL$ $D$ |$ u1$ËL$ I $L$ IL$D$D$ L$L$D$L$ $L$ IL$[D$L$ tD$$ËD$ $D$ @@D$L$$ $O/L$L$L$L$L$ @ u1ËL$ $D$|$u1ËL$I $L$IL$L$L$nD$ L$ $L$IL$D$L$ tD$ËD$$D$@@$D$D$L$, $`/L$L$ L$L$L$ L$L$m u1$ËL$ $D$ |$ u1$ËL$ I $L$ IL$L$L$L$L$ D$L$ $L$ IL$D$L$ tD$$ËD$ $D$ @@ D$L$( $s/L$L$L$L$L$ u1 ËL$ $D$|$u1 ËL$I $L$IL$L$L$L$ D$L$ $L$IL$D$L$ tD$ ËD$$D$@@ D$L$( $/L$L$L$L$L$ u1 ËL$ $MD$|$u1 ËL$I $L$IL$L$L$L$ D$L$ $L$IL$%D$L$ tD$ ËD$$D$@@$D$D$L$, $/L$L$ L$L$L$ L$L$ u1$ËL$ $qD$ |$ u1$ËL$ I $L$ IL$L$L$L$L$ D$L$ $L$ IL$JD$L$ tD$$ËD$ $D$ @@ D$L$( $/L$L$L$L$L$ / u1 ËL$ $D$|$u1 ËL$I $L$IL$L$L$L$ D$L$ $L$IL$~D$L$ tD$ ËD$$D$@@ D$L$( $/L$L$L$L$L$ c u1 ËL$ $D$|$u1 ËL$I $L$IL$L$L$L$ D$L$ $L$IL$D$L$ tD$ ËD$$D$@@D$L$$ $/L$L$L$L$L$ u1ËL$ $D$|$u1ËL$I $L$IL$"D$ L$ $L$IL$D$L$ tD$ËD$$D$@@D$L$$ $/L$L$L$L$L$ u1ËL$ $SD$|$u1ËL$I $L$IL$&D$ L$ $L$IL$K_11/1(EM 9u1 ËM9 S$'l$\$uS$U&l$\$D$M 9st$'uT$$&t;D$t  1T$$6&uԋT$$E&uL$ _t11S$%l$\$[S$&l$\$>K_11/1(l$\$D$؃ to t; t1Ás!Ѓu 뭋D$É\$ $l$l$\$tD$Ãv|$u 1؃8%uR Ɓ|(ы!Ѓu D$þ벃tDt&9wC9vD$Ã|$uD$19uD$Ã|$$t$l$ F D$ D$ )؉\$9} rEtyt6;D$ s&4$l$Et$l$ \$}Ãuҋ)؃;\$ s) $\$ L$t$l$ \$u )ȃC‹\$ ;\$ s=s  (E+uCڋM;\$ s9uCt]t=:ED$;\$ s\$ $XЋt$\$;D$nCӋM;\$ ^9SCED$;\$ ?\$ $XЋt$\$;D$CύD$ ,$ L$\$0t$4l$@D$|$}D$<Ãt H HÃP @L$DH t$0MK\$C u3C @ tCL$8)ȋK I 9lC @C D$ D$ %uԗ|$0l$@\$(ًC C ~  ^ < (  t <ËC;D$8s+C=sK  (E+uCH1t$(;CD$$P u<ËH|$0ËD$$tt<É\$C$PHȃD$D$T$(|$0l$@\$Pt0C~C)P}Ѓ<þt$(C~R($PHȋK)ȃD$CD$u|$0l$@\$C)PKM$KM CKIKMKI TPL)t$4 sD,$ L$1t$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@K H t$0t}<þt$(CKIKM1t$(}<Ã~t$(KTKM1t$(5\$C$PHȃD$D$L$(l$@\$Pt}ȃ<þt$('CKIKM1t$( t}<þt$(KTKMKM$KM CKII9rC@@=t 1t$(EKI9tC\$KLP)ȃs@,$L$)t$0l$@\$D$|$}D$<Ãt HËHPȉ$\$CD$D$觥|$0t$l$@PFMHPL)؉\$4 sD,$ L$|$0t$\$4l$@D$|$}D$<Ãt HƋH ƒP 8@NI H ߉\$0`t}<þt$(GCKIKM1t$(-KI T\$C$!L$(l$@\$t}ȃ<þt$(1t$( +G7 C t}<þt$(KM,$K L$L$|$0l$@ƃ}<ËHÃu 1t$(D@@HM$HM C @=t CK I9ɉ\$KMPD$4L+D$4 s@,$ L$|$0l$@\$D$|$}D$<Ãt HËHT$4 ƃP 8@ C K F |$4|$0tt}<þt$([KKKM$KM CK I9\$KMPD$4L+D$4 s@,$ L$|$0l$@\$D$|$}D$<Ãt HËHT$4 ƃP 8@ C K F |$4|$01t$(t}<þt$(pKM$KM KKCK I9|C;D$8s CK9tKKՋCK I9|\$KMPD$4L+D$4 s@,$ L$|$0l$@\$D$|$}D$<Ãt HËHT$4 ƃP 8@C K F |$4|$0t8CtC~C)P}<þt$(JCtOC~G($PHȋK)ȃD$\$CD$薠|$0l$@\$KM$KM C C C C @uC;D$8sӋCK I9uËC @u6C;D$8sK $\$K L$|$0l$@\$t\$KMPL)t$4 sD,$ L$t$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@ K H t$0CtC~C)P1t$( t8 t}<1t$(C \$C }<Ãu 1t$(QC \$C KMt$()1t$(C;D$8r 1t$( CDCK I)ȉEEM9TPL)t$4 sD,$ L$it$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@ K H t$0CCK I)ȉEEM9s 1t$(%PL)t$4 sD,$ L$t$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@ K H t$0,$KL$K L$|$0l$@\$u 1t$(eC  1  C D$E$9D$| 1t$(L$p(L$P,tu 1t$(9r9sC;D$8sC8uFC9rC 1t$(C;D$8s4K $K L$|$0l$@\$t C C1t$(dM$KM KTKCgC[[LP)9vI,$ى\$,L$t$0\$,l$@D$|$}D$<Ãt HD$HPȉ$(D$؉\$,D$9|$0l$@\$D$,PC 0E$9|C @C @(D$@,|$tuC @C s;D$rC dtYC;D$8sCC K uKMt$(M$KM Kv,$K L$K IL$6|$0l$@ƃ}<ËHË@ @9} 1t$(WsKKjC @KT$8)9v 1t$(+KM,$K L$K IL$|$0l$@ƃ}<ËHÉpHH@K I9} 1t$(C K uKMt$(M$KM KC K 7C K @C <1t$(V0l$4]E D$(11D$D$D$D$D$ D$8u~D$8@D$ D$8@ vD$8@ H)D$(D$(9w@D$(D$ 2D$8xD$8@D$D$8D$T$D$D$8@D$81E D$(;\$(sT$;t%u C;\$(r10ËT$4T$;uFt$9u׉)AMډ\$,\$ )|$ AMD$ t 0É,$T$\$8 ӉL$M|$ l$4\$,t0ËL$T$4gD$8uzD$8PT$M 9s9u^9ˉL$(r10É]C\$,]D$ t 0É,$L$8L$T$L$(l$4\$,ƃt0C딃|$tlE D$(;\$(s$L$ $\$, L$Ll$4\$,t8;\$(r10É]\$,],$L$8L$El$4\$,ƃuCC;\$(zC\$,EE,$L$8L$ l$4\$,ƃJċD$ D$8D$T$L$J~A\u1øà l$\$D$t[ttt1 ËE9u  1M9t$K}S (E+u1 øEM 9u1 ËM9vVK}GK (E+‹M 9s, }  (E+9t  11111뿃tE5كU 9u% } (E+t  ËM 9t1EM 9u1 ËM9vVK}GK (E+‹M 9s, }  (E+9u  11111뿋M 9t" } (E+u1 ø t7EM 9u1 ËM9KuS /uZK_tR1ƋM 9sC u /u _t19t  111륋E 9u  1EM 9u1 ËM9KuS /uZK_tR1ƋM 9sC u /u _t19u  111륃 - EM 9u1 ËM9S$l$\$uS$>l$\$D$M 9so$zuT$$t;D$u  1T$$"uՋT$$2u‹L$ _t11봋S$l$\$aS$l$\$EK_91710EM 9u1 ËM9S$l$\$uS$l$\$D$M 9so$VuT$$t;D$t  1T$$uՋT$$u‹L$ _t11봋S$l$\$aS$l$\$EK_91710l$\$D$؃ to t; t1Ás!Ѓu 뭋D$É\$ $l$Rl$\$tD$Ãv|$u 1؃8%uR Ɓ|(ы!Ѓu D$þ벃tDt&9wC9vD$Ã|$uD$19uD$ÃT$$t$l$ F D$ D$ )؉\$9} Et9;D$ s&4$l$Pt$l$ \$}Ãuҋ);\$ s( $\$ L$t$l$ \$u)Ã뾋\$ ;\$ s=s  (E+uŃڋM;\$ s9ut_t>2ED$;\$ s\$ $XЋt$\$;D$iҋM;\$ W9MED$;\$ 7\$ $XЋt$\$;D$΍D$ s,$ L$\$0t$4l$@D$|$}D$<Ãt H HÃP @L$DH t$0MK\$C u6C @ tCL$8)K I 9C @C D$ D$ %up|$0l$@\$AًC C   _ < (  t <ËC;D$8s*C=sK  (E+u CI1t$(;CD$$P u<ËH|$0ËD$$tt<É\$C$PHȃD$D$蹁T$(|$0l$@\$Pt0C~C)P}Ѓ<þt$(C~R($PHȋK)ȃD$CD$.|$0l$@\$C)PKM$KM CKIKMKI TPL)t$4 sD,$ L$t$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@K H t$0 t}<þt$(CKIKM1t$(}<Ã~t$(KTKM1t$(5\$C$PHȃD$D$L$(l$@\$Pt}ȃ<þt$('CKIKM1t$( t}<þt$(KTKMKM$KM CKII9rC@@=t 1t$(EKI9tC\$KLP)ȃs@,$L$t$0l$@\$D$|$}D$<Ãt HËHPȉ$\$CD$D$`~|$0t$l$@PFMHPL)؉\$4 sD,$ L$B|$0t$\$4l$@D$|$}D$<Ãt HƋH ƒP 8@NI H ߉\$0^t}<þt$(GCKIKM1t$(-KI T\$C$WL$(l$@\$t}ȃ<þt$(1t$( ,J9 D t}<þt$(KM,$K L$L$ |$0l$@ƃ}<ËHÃu 1t$(D@@HM$HM C @=t CK I9ȉ\$KMPD$4L+D$4 s@,$ L$Y|$0l$@\$D$|$}D$<Ãt HËHT$4 ƃP 8@ C K F |$4|$0qt}<þt$(ZCKKM$KM CK I9\$KMPD$4L+D$4 s@,$ L$x|$0l$@\$D$|$}D$<Ãt HËHT$4 ƃP 8@ C K F |$4|$01t$(t}<þt$(nKM$KM CKCK I9|C;D$8s CK9t CKՋCK I9|\$KMPD$4L+D$4 s@,$ L$e|$0l$@\$D$|$}D$<Ãt HËHT$4 ƃP 8@C K F |$4|$0}t8CtC~C)P}<þt$(GCtOC~G($PHȋK)ȃD$\$CD$Ly|$0l$@\$KM$KM C C C C @uC;D$8sӋCK I9uċC @u5C;D$8sK $\$K L$|$0l$@\$t\$KMPL)t$4 sD,$ L$t$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@ K H t$0CtC~C)P1t$( t8 t}<1t$(C \$C }<Ãu 1t$(PC \$C KMt$((1t$(C;D$8r 1t$( CCC @K)MEM9PPL)t$4 sD,$ L$t$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@ K H t$01t$(C;D$8sSK $XЉD$L$I  $L$L$|$0l$@\$tC C C1t$(9tRt=t8C;D$8sCK 9u C C{1t$(-C C `C;D$8sKK $XЉD$L$I $D$@XЋ|$0l$@\$;D$u C C 1t$( jTKCu <ËKMK AKCKII9CKPL)t$4 sD,$ L$赻t$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@KI H t$0CKII9rC@@= EKI9CKM$KM KCCLP)9vI,$ى\$,L$ĺt$0\$,l$@D$|$}D$<Ãt HD$HPȉ$(D$؉\$,D$>ol$@\$D$,PLP)ȃs@,$L$(t$0l$@\$D$|$}D$<Ãt HËHPȉ$\$CD$D$n|$0t$l$@PFMHPL)؉\$4 sD,$ L$船|$0t$\$4l$@D$|$}D$<Ãt HƋH ƒP 8@NI H ߉\$0C ƃt@E E$9~/E$@D$D$9}D$D$@(D$9|u$KH(C TKCu <ËKMK AKCKII9CKPL)t$4 sD,$ L$Jt$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@KI H t$0fM$KM KKI TPL)t$4 sD,$ L$裷t$4|$0l$@\$D$|$}D$<Ãt HËHƒP 8@K H t$0thmC;D$8sKK $XЉD$L$I $D$@XЋ|$0l$@\$;D$t C C1t$(PC;D$8sCK 9t C Co1t$(! $\$l$@CCu l$@\$1t$(CCK HCTH C@KTKMPL)|$4 sF,$ L$|$4\$l$@D$|$}D$<Ã|$0tHT$0 ËHƃP L$0@C K F |$0CL$8)K I9v 1t$(KMC @u>CC K uKMt$(M$KM Kh,$K L$K IL$|$0l$@ƃ}<ËHË@ @9} 1t$(HsCCgCL$8)K I9v 1t$(KM,$K L$K IL$|$0l$@ƃ}<ËHÉp@CCK I9} 1t$(C K uKMt$(M$KM KC K C K @C<1t$(<0t$4nF D$(11D$D$D$D$D$ D$8D$8@D$ D$8@ v"D$8@ )D$(D$(9w D$(D$ ED$8xD$8@D$D$8D$T$D$D$8@D$81ۋF D$(;l$(sET$;t'u;l$(r10ËT$ET$;uC\$9uՉ)ȃFT$)|$ l$, D$ t 0É4$T$\$8 ӉL$|$ t$4l$,t0ËL$T$[D$8u}D$8PT$N 9sE9u_9͉L$(r10Énl$,.D$ t 0É4$L$8L$T$L$(t$4l$,Ãt؃0Ã둃|$toF D$(;l$(s$L$ $l$,ML$t$4l$,t9;l$(r10Énl$,.4$L$8L$t$4l$,Ãu띃;l$(ul$,F4$L$8L$t$4l$,ÃDËD$ D$8D$T$L$J~ȃ\u1øÃ $ ÃL$$ $@6L$L$L$L$L$ R u1ËD$t)L$ $xD$C6 $L$L$ ËD$ t)L$ $bD$E6 $L$L$ ËL$ $D$G6 $L$L$~ ÃL$A$A ǁT $Là \$$C@T%t#C D$ SD$(D$,D$ ËCPPtu^$I6D$ 1 ËBtۉ$D$T$BЃu‹L$$ $D$L$ L$D$ЃD$}^$c6D$j 1 ËL$$ $L$‹D$$@@T%u49t09u ^$|6D$ 1 ûD$$D$\D$bL$A$A L$$ $L$L$L$L$t$(l$,\$ǃu1Ã11L$K{K΍CK͍C D$$L$$KskD$ @tXD$$ËD$ @ t XܹX;l$vl$m;t$Xt$OT$Bu $۬ËJ uB$B@@ЋT$уl$t$D$ =-tE$9|2|$$t1҉׋L$ $|$T$--É@(t@,t@(M)ș]\$|$lj@,M)ș]\$|$뇃 _D$ tt-t $6D$ É $6D$ T$B t $0{T$BubBu7Bu $ËJ uB$B@@ЋT$ыJ uB$B@@ЋT$릋J uB$B@@ЋT$xD$ D$$ $$L$6L$[#L$ L$$L$L$ L$L$L$^ u 1ĈÍL$, $$L$L$$L$L$ L$ L$L$l$D$$|$$u 1ĈËD$4D$,|$Hu^L$, $у(L$%D$(l t 1ĈÍD$,$-$ $L$,L$L$(L$~)ĈÍL$, $у(L$ D$(렁D$ D$$ $$L$6L$[#L$ L$$L$L$ L$L$L$$ u 1ĈÍL$, $$L$L$$L$L$ L$ L$L$2$D$$|$$u 1ĈÃ|$Hu^L$, $у(L$CD$(D$,$. t 1ĈË$ $L$,L$L$(L$L(ĈÍL$, $у(L$FD$(렃|$$u1ËL$ $u1ÉD$$m T$ÉD$ u1É$L$ L$T$ÉD$ t_u1É$L$$L$) \$$T$ D$ t tD$É$C@$B@Ћ\$$щ$B@Ћ\$ 됉$B@Ћ\$NL$$ $D$D$T$ ÃD$u1ËBu t؃É$B@Ћ\$$6L$T$D$u t1É$B@ $Ūl$\$u8 tMEt1É,$E@$C@Ћl$ыL$ H $D$D$ \$T$D$ t@ t*L$ tD$ ËD$$D$@@$C@ɉ$B@Ћ\$믁D$(D$$$ $$L$26L$@[#L$ L$,L$L$(L$L$$L$葲 u 1ĠÍL$D $$L$L$,L$L$(L$ L$$L$D$,|$,u 1Ġ$D$@uD$D$1ĠËD$L;D$PD$D$$D$LD$D|$`L$D $у(L$`D$L$0l$,u1(ËD$9r1(Ë])9v1(Ã,$ډ\$l$, L$L$4L$\$0l$,u1(ËD$9r1(Ëu)9v1(Ã,$t$l$, L$jt$\$0l$,u1(É@t1(ÉScg9r1(ËU)9v1(ÃщD$9r1(É09r1(É9r1(Ét1(Étt9r1(É89r1(ÉD$)9v1(ÉŋD$)9v1(D$D$9sL$9r1(D$D$9rʼnt;,$L$L$L$\$0u1(ËAt1(É;l$1(1(1(9r1(Éwt9r1(ÉD$4@9I1(Ãtt k9r1(Ëu)9v1(Ã9r1(É9r1(É9v1(Áv1(É,$t$l$, L$L$4L$\$0l$,u1(ËD$9r1(Éo1(9r1(Ëu)9v1(Ã9r1(É9r1(É9v1(Áv1(É,$t$l$, L$L$4L$\$0l$,u1(ËD$9r1(É1(à l$\$T$|d~1 9sCuud,$كL$T$C à \$ك( $S$ (L$K L$u_$Ĉ6D$ 1 ø ÃT$BuZB u/J t $ËB$B@@ЋT$݋J uŋB $B @@ЋT$뮋J uB$B@@ЋT$냃 \$t$l$|OE$9}HE =-t4@(|'M $ I(L$ I,L$S ؃ Ë^$Ո6D$ 1 à \$T$B@T%t $ D$C@tBKI $T$ƒtT@@T%u.B@T%u tD$ É$B@T$$T$D$ק ΃L$ $L$L$;D$ L$ $L$ L$L$L$ÃT$ $JL$T$L$L$ MD$6 $6L$L$L$*Ãl$$\$ UT$$^ƃD$u11;l$}_L$ $l$\$$ I L$-L$ t$l$Ãut1É4$F@X E;l$|É$M L$-L$މ$"L$-L$$-D$L$, $L$0L$6L$0a#L$ L$L$T u1$ËL$(I$I $Q|$(ƃD$ u1$ýG$9}U<$l$l$L$L$|$(t$ l$Ãut1$É4$F@XEG$9|$Ã0-D$ L$8 $L$uu u$B@ u؉$C@ЋT$ NjD$$\$T$D$$D$ D$D$D$\$T$ 눃 $ $<L$N-L$D$ L$ u É$/D$\$tu É$$L$D$D$;|ދD$$D$D$$D$D$ D$$D$D$$D$;D$ D$$D$D$$D$D$ fD$$D$D$$D$D$ @D$$D$D$!$D$ D$ D$$D$D$($D$ D$ D$$D$D$.$D$D$ D$$D$D$8$D$(D$ D$$D$D$@$D$D$ D$$D$D$G$D$#D$ \D$$D$D$M$D$D$ 6D$$D$D$S$D$"D$ D$$D$D$Y$D$,D$ D$$D$D$b$D$'D$ D$$D$D$o$D$:D$ D$$D$D$y$D$/D$ xD$$D$D$$D$-D$ RD$$D$D$$D$D$ ,D$$D$D$$D$D$ D$$D$D$$D$5D$ D$$D$D$$D$7D$ D$$D$D$$D$D$ D$$D$D$$D$ D$ nD$$D$D$$D$%D$ HD$$D$D$$D$D$ "D$$D$D$$D$D$ D$$D$D$$D$@D$ D$$D$D$$D$1D$ D$$D$D$$D$D$ D$$D$D$$D$D$ dD$$D$D$$D$D$ >D$$D$D$%D$D$ D$$D$D$%D$&D$ D$$D$D$%D$D$ D$$D$D$%D$%D$ D$$D$D$*%D$ D$ D$$D$D$0%D$0D$ ZD$$D$D$>%D$D$ 4D$$D$D$E%D$!D$ D$$D$D$L%D$3D$ D$$D$D$V%D$9D$ D$$D$D$`%D$D$ D$$D$D$g%D$D$ vD$$D$D$n%D$ D$ PD$$D$D$u%D$ D$ *D$$D$D${%D$D$ D$$D$D$%D$6D$ D$$D$D$%D$+D$ D$$D$D$%D$D$ D$$D$D$%D$4D$ lD$$D$D$%D$2D$ FD$$D$D$%D$D$ D$$D$D$%D$$D$ D$$D$D$%D$D$ D$$D$D$%D$D$ D$$D$D$%D$AD$ D$$D$D$%D$*D$ bD$$D$D$%D$)D$ D$ D$$D$D$K%D$D$ T$ t É$B@_$s 1Nà D$<=PYt PY^$D${ lVt $-D$D$0i ÃVD$V;Zu D$ $sD$VÃL$ $-L$L$L$B u1ËL$ $ŹD$ L$ $#Ãz D$ D$$z E t1--à L$( $-L$L$L$L$L$ [B u1 / W;Zt $-D$ 1 Ã|$|$D$;XWuwL$ $T$|q u_$ 1 ËL$<D$<D$D$L$<tЃ -- ËD$;Xu1{L$ $@u^$T-D$/ 1 ú^C $9-D$ 1 ÃL$ $-L$L$L$ A u1Ã|$|.|$}'L$ <tȃ--ËW$-D$葂 1Ã4L$< $-L$L$L$@ u14b;ZtW$-D$< 14Ã|$t6L$ $L$L$ tW$-D$ 14ËlVD$lV$4ÃL$lV} lVЃÃ(ZZI- $-L$/L$D$ L$n u(É$D$ $XL$ $P-L$D$- $NXWL$ $X-L$D$,|e $[tSL$ $`-L$D$D$,T$|- L$ $e-L$,Uu(ËU<}@T$$m T$<=X<<B| <;XuCU < U < $^L$m ^ $ED$ $y-D$L$L$+T$^ $ D$ $-D$L$L$F+T$ $D$ $-D$L$L$ +T$ $D$ $-D$L$L$*T$\ $aD$ $-D$L$L$*T$ $(D$ $-D$L$L$b*T$ $D$ $-D$L$L$)*T$Z $趿D$ $-D$L$L$)T$ $}D$ $-D$L$L$)T$ $DD$ $-D$L$L$~)T$X $ D$ $-D$L$L$E)T$ $ҾD$ $-D$L$L$ )T$ $虾D$ $-D$L$L$(T$V $`D$ $-D$L$L$(T$ $'D$ $-D$L$L$a(T$ $D$ $-D$L$L$((T$T $赽D$ $-D$L$L$'T$ $|D$ $-D$L$L$'T$ $CD$ $-D$L$L$}'T$u] $D$ $ -D$L$L$H'T$u{ ( u$B@ u$B@ K$B@; $B@ $B@ I$B@9 $B@ $B@ G$B@7 $B@ $B@ E$B@5 $B@ $B@ C$B@3 $B@ $B@ A$B@1 $B@ $B@ <$ <@@uXW<-<$B@'$^D$]f ^}><<<\$ t C|ƒ=UU=XuIX=XWuXWË XW uXW$XW@@ʋ X uX$X@@돋 U iU$U@@M -$B@Ћ\$ -;XT$;XW$D$d \$ T$=PYu1%;Zt1PY, D$u -D$<<D$- $t$t$L$L$觙 t$l$<t6 < $D$ D$D$ t$T$ ʼnD$ t:u MEtF\1É,$E@Ћt$߉$B@Ћt$l$뱃$Ã;-$ -D$ Ã=<t ;Zt1<1Ã=PYuPY}<A|3xj cZ螅Zw ÃL$ A t $*L$ At5A$D$D$ @$FD$ @$L$ $ÃD$L$ $De2L$L$L$2 u1j D$ L$I $L$L$D$D$ $j L$ $wÃL$ I $D$dL$ t(A$_$Oe2D$)t 1ËA$^--ÃL$ I $D$tD$ @$!$Ewù $4wà 8 $RD$u1 PT$BB Bu3 t_$e2D$`s 1 É$B@։Ѓ ÃL$A t $(L$ $AЃÃ$D$D$D$} D$ @Y$e2D$r T$l$\$uBu#u1$MEu,$E@ uԉ$B@Ћl$ u$C@ЋT$l$kT$l$ÃD$tpB) $D$C)ЋT$\$ŃD$TX$L$(IL$#l$\$ƒD$'L$(I $D$\$T$l$\$tD$ tqL$ $L$(IL$l$WT$l$\$t MEt t؃$É$C@Ћ\$,$E@Ћ\$ω$B@Ћl${T$D$;D8uGt*$t^$7f2D$p 1Ã|$ tL$ $ݮuˋL$ $D$D$Ћl$\$ ƒu1Ãj Zbf2 $T$T$ՋT$BBu t1É$B@HT$BBtЉ$D$!T$th2 $D$ D$D$2\$ T$B t'Bz$T$eЃÉ$C@ЋT$ E T$B t!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 ÃT$B tZ B  BtZB BtZB BtZB Bt Qy ƒu1Ë@tJ $\z ƒtB@t#T$ J@ $L$IL$&T$ u $*z ċB@$D$@D$vT$ ؉$C@ЋT$e$C@ЋT$2$C@ЋT$$C@ЋT$L$At $A#L$ $D$$wT$Bu$BЃËJ uB$B@@ЋT$˃Kx u@Y$rf2D$+m 1ÉD$$L$IL$uzL$ $T$D$u1ËB;D8t%$J L$JL$BЋL$|ȃËD$$D$@D$1ËH؃L$ $,D$u ËL$ $ `L$L$舛T$u*`$f2D$B@ D$s Ãu É$L$ L$L$$L$L$L$ æÃL$ $D$u1ËL$ $ `L$L$l$\$ T$uЃÃu1ËE=)t,$\$T$(É$\$@u L$ $L$ L$L$L$ÃT$J B=-u--D$@tMT$ J $L$L$tD$ @$D$D$k T$t $u T$ t--É$B@临-^(L$,L$$AD$ eT$ BP$p D$ $^ T$$@^J $JL$J L$+ \$$ƒp ^ $l o \$$K tvK tSC u,D$,$/t @^D$ $hp t Ķ(ËK uȋC $C @@뵋C$C@@Ћ\$$떋C$C@@Ћ\$$pD$$D$D$D$ D$n f2$g2 $JT$$tUB$L$D$袉g2$D$$D$D$D$ D$g $J? \$$B$h"D$D$藆$B@Ћ\$$0D$$L$8 $g2L$L$L$ L$,L$L$(L$L$$L$:e u10ËL$, $ ^u $,g2D$h 10ËD$(@@T%u $Gg2D$g 10Ã|$$tD$$@@T% b $pu om 0Ë YIL$,HL$(HL$$H D$  $m T$ BBu$q!m 0ËD$,D$(|$$?[ y $L$ L$豳_$g2D$f L$, tlL$( tJ|$$u!D$ @$~m D$ $'q10ËL$$ uҋD$$$D$$@@뽋D$($D$(@@롋D$,$D$,@@|$0ËD$$ $_g2D$@f 10Ã^$f 1 --Sà u_$g2D$e 1 É$] à @^ $HÃD$L$ $g2L$L$L$# u1Ã|$}W$g2D$pe 1D$L$ $޳u%W$g2D$D$D$l 1Ãu_$g2D$e 1ËL$ $ÃpB) $`}ù) $J}ùh2 $!L$x'L$D$ L$z uÉD$$̶D$h2 $D$D$Ol D$$h2D$ _L$T6088 $}8D$$h2D$8D$)L$ $h2L$)L$ }@^h2 $(`uËT$RËL$9u1T$B JHà t$l$]UZFEn(u ÃL$ $l$ \$uSM PMKC,$dÃ\$ 1ҋ 9tB 9uЃÃ\$D$;L$t7ʉL$ 9t"$T$\\$L$ t Ë ;L$u1Ã\$9t J J9uÃT$ B@T%@t5Bt$BЋT$ tуA~I1ÃD$;L$t1AP\ȉL$ $D$D$ҋD$ ;L$uσÃT$B@T%@t7Bt$BЋT$tBu B1ÃuT$ $D$D$ D$ @ԃD$ ;L$ tbAt^˃ CP\L$A\$$-D$D$ D$ҋL$D$D$A=W.u $ML$;L$ uËD$L$ $D$$D$pD$@˃T$ B=$u$$ (UL$t 1B@T%tBt 1B=B+u $1ÃD$;L$t'ʃ D$ B=\4u$L$ ;L$uكÃD$;L$tEʃ L$D$ $$tD$$D$D$nD$@L$ ;L$uà T$B@T%@tQBt$BЋT$t,Bu$уL$ $D$D$D$@1 Ã\$ 9t/AP\ȉL$ $QD$\$ҋ\$D$ 9uуÃ4D$D$$XD$8;L$8ti˃ D$C@T@tFC@h~;KIh D$t'L$( $ L$(A D$uًL$;L$8uL$ $T$T$0 T$,B D$ $T$D$輮ƒuWD$ $*i L$, t)D$;D$0uD$0$D$L$u }ÃÃ=\t1ɉȃ\ $\ՃD$ $RmÃ8_T$ T$Bt9$9 8_T$BKJBSÃD$$ÃL$At!ʃBB JHÃD$$à T$v FT Éу $du )T ÉD$@0303;,3~ =[u ȃ Ã=,3t=\uRN L$u\*L$\븃L$ I $Iƒt L$ JЃà T$BD$Jȃ$ ƒtL$JL$JЃ Ã\$CPT$KIʃ؃v S É$у L$#L$蹭t$ $$@#L$蕭u܋D$8$3I# $ThW" $'D$T" $iG]8" $ _muN$D$L$ $FD$`uE"$( L$` $TD$@WQ\t{B]tP3t)?t $L$| L$tD$HbP=\O\@T5E,Ou`T$k"L$辵u\ T $o"L$蓵u\ T $t"L$hu\ T $|"L$=uL$< `nh"$"D$ $L$| L$tÃR4St"UtVD$D^ <_$sPtCbt3dt#hpiL]PWPhWtt$B@1 T$BtJ $L$L$D$Ѓt 1 ÃL$ $L$ } ËAtQA t1É$B@L$ $0\$ }C@T%tCÉڃBB JHC t $* \$ CtSC t$CЃÉ$B@Ћ\$ ""ÃL$ $ VL$D$oƒu1=(4t8t tY$Re/D$ 1É$B@֋D$=(4u tЃÉ$T$B@ЋT$""ÃL$ $ _L$D$"oƒu1=(4t8t tY$re/D$A 1É$B@֋D$=(4u tЃÉ$T$B@ЋT$""ÃL$ $ VL$D$znƒu1=(4t8t tY$e/D$ 1É$B@֋D$=(4u tЃÉ$T$B@ЋT$L$ $(4L$L$ u1ȃà L$ $ [L$D$m Ãe/ $ÃL$ $(4L$*u1""Ã8D$4D$0L$@ $e/L$ٳL$L$4L$ u18ËL$< $e/L$vPtD$0$D$ ÃD$,u18Ã|$4|PC;D$4|GSt8K $KL$.T$,D$( tD$(8É$B@`D$ |$0L$< $e/L$e/L$L$ jÃu.C\$,V t18É$C@@@T%uGY$e/D$\$C@ D$# T$\$, u$B@Ћ\$,덋C~21҉݃|$4C9};T$4}B uT$ oL$< $ f/L$f/L$L$ L$ i\$,ƒuB\$,Y@@T%uNY$f/D$T$B@ D$" T$\$, $B@Ћ\$,Bu! $B@Ћ\$,K$T$BL$$L$貝l$,\$UtmMT$$ $؃D$CD$T$\$, t)KtCKA aL`$B@Ћ\$,ƹ`돉$C@C9eB RL$ $(4L$jL$ u1ȃÃL$ $ (`L$D$iu1ÉD$ $jT$ u t1É$B@Ѓà D$D$L$( $Kf/L$ٳL$L$L$ u1 $D$u1 Ã|$i$Yf/L$`f/L$L$$L$ jg\$ƒu t1 É$C@t؃ É$B@Ћ\$L$$ $rƒu0 \$t t1 É$C@؃ ËL$ $T$T$\$T$}6 t t1 É$C@$B@Ћ\$Ӊ$\$T$D$ tD$;D$x6$B@Ћ\$܃ L$( $bf/L$L$L$) u1 ËL$$ $(4L$u1 ËL$ $pD$|$u1 ËL$ $qD$|$uO T$t t1 É$B@ t-- É$B@L$$ $ \L$L$L$D$ fƒD$u:>T$uL$ tJu(L$ t1 ËD$$D$@@ $B@D$$D$@@ЋT$띃D$L$$ $5g/L$L$L$ u1Ã|$}!L$ $=g/L$D$td$L$L$Ηu1ËL$ $ `L$D$D$D$ ~e\$ƒD$-$ WL$F\$T$D$ tw|$u \$uF$+D$ L$ $L$L$'T$D$ tD$É$B@ t1É$C@$B@Ћ\$u tЃÉ$C@ЋT$ $Z D$u1 ËL$$ $Eg/L$Jg/L$ L$ b\$ƒu2;uċL$ t1 ËD$$D$@@D$=-uzCu tЃ É$C@ЋT$ t8 T\ $\$nT$D$ tD$ É$B@$B@Ћ\$뷋@@T%uM t3 t^$Lg/D$ 1 É$B@։$C@ЋT$뼋Bu! E$B@Ћ\$1$T$a T$D$ t3|$iL$ t1 ËD$$D$@@$B@D$@}1L$1D$ A|FAD$A D$L$ $EDD$} VD$ D$$ T$}!D$ VY$ 1ÃT$B uB--É$BV}1ùH$ $q4L$q4L$L$L$ D`à T$$D$ЉŃt\E1ۋU  Ӊ] 1ۋU  Ӊ] U  Ӊ] U  Ӊ] E Ã(T$,B}1(ËJ $L$L$E%uD$ %=@t1(VY$D$0D$  (Ã8L$< $L$L$$}z=Vuq $! ` $q4L$L$D$ ]`$L$L$= T$u 8 u$B@18ÃXT$\D$PD$Hr4D$DD$<D$8D$4D$0D$,D$$D$ T$TB|(B $} XËL$` $L$dL$r4L$\"L$ L$LL$L$DL$L$$L$J u XËD$L@=@M-.L$LI $@M-L$= L$L $l$4|$Tt$8D$(|$(};t u W$Fr4D$ X l$4|$Tt$8|$(}yD$L@@T%u/D$L@=V#t!L$LI $V#L$=L$L $L$PL$L$L$l$4|$Tt$8} XËD$DD$@D$@D$@D$@btڃ+atbW$r4D$D$DD$ |$ u D$T@D$<|$Ht T$H tD$s4L$L$L$ u1LËD$ D$8 D$ VL$PI $L$L$L$L$D$D$ $A D$$T$},=Vu--LËY$ 1LÉ$nLÃDL$HI $L$L$T$LuZD$ D$4D$$D$8D$<$D$H@D$D$D$ D$T$LD$8u D$4= sЃDËD$8;D$@ uD$4;D$$D$D$D$D$D$ z D$ @ËL$$D$A D$A$L$ D$D$AÉ$B@o(L$4 $L$8L$T`D$ uD$,@(ËL$< $QT$ u+ tD$,@(É$B@ދL$0I $ l_L$T$D$D$ D$*\$T$ D$$  |$$uD$,@(ÍD$$D$$D$WD$ T$$ D$Qu D$sF u'Y$h$D$D$D$D$D$ D$,@(ËL$0D$A D$A$L$,D$D$A(É$B@o$C@$B@Ћ\$T$B\ W$$D$ ËB(tB($(T$J\ $1(T$B(B(u; ËBTt BT$I''T$BTBTu _$$D$! BXJ\Iȃt ȃuu4J\IJ`D$$T$FD$uD$ uT 1B`ʃ=(Vu $FO(V p\ $ u1ÍD$$D$D$D$D$ D$$D$D$D$D$ T$Bt#J $ (VL$L$Y"D$$D$D$D$D$ 1ËL$ tTL$ t2|$u ËL$ uD$$D$@@ՋD$$D$@@빋D$$D$@@뗃 L$$ $'T$$Ãu1 ÉBD$$T$Btу<IuuupBtуLIuYuT11ڃT$\$ D$JD$$$D$uD$u1 -- Éу4Iurу,IӃ4[)뀉$C@ЋT$$ WT$B 2Bt $ї$D$: 1 É $$D$# BJ $tW$$D$ 1 ËL$IT $D$#t6"T$BX$:L$D$AXAT$#D$ ËL$ $u1 É$thT$ WD$B 2Bt $)$D$7 1É $F$D$ L$ $l$L$L$L$W u1ËL$IT $D$"t~!\$CXCt?$@\$D$uCXCT$"D$Ãt t$L$L$ \$D$뼉$B@Ћ\$ՋL$ $m1ÃT$ WD$B 2Bt $t$D$ 1É $$D$ L$ $$L$ٳL$L$L$ " T$u1Ã|$}W$$D$ 1ËB2J $tW$$D$f 1Ã|$umL$IT $D$R!t:? T$BX$D$D$@XD$@T$Q!D$ËL$ $6u1ËL$ $L$L$=-tЃtXL$IT $D$ t%T$BX$L$L$D$ZL$ $u1É$B@뛉$T$ WD$ B 2Bt $$D$ 1É $$D$ L$$ $:$L$L$L$/ u1Ã|$}W$B$D$ 1Ã|$u$D$OËL$ IT $D$fmt$ FXNt$Nt< R11~fD$9~\$N(,]mى $L$L$t$ D$ uFXFT$%D$ ËD$F,J0ӋFt 4$6t$ ƒD$ tth4$L$ $t$ tu1ɋD$9~L$N( $L$L$t$ D$ UT$V,V0C$B@Ћt$ 뇉, R<]m)L$ $81à WT$ B 2Bt $_$D$ 1É $|$D$ $L$L$`Ã,T$0D$(D$$D$BJ $^|$4t$0tW$$D$5 1,ËNt$Nt< R]T11݃|9:F(,[ЉD$$ L$l$ l$jl$ \$ti$D$)AL$bD$(|$(tL$+L$AT$0B,J0|$$uD$(,ËL$$ uD$$$D$$@@;l$4u,$l$D$(|$(tL$ T$0B,J0띋L$0IT $D$,L$0AX$hT$ D$$uD$0@XD$0@T$9L$ $T$_D$(tL$$ $D$\$ L$(}&tD$( u $A@|tD$( U\$؉T$0Z,J0|$4|)\$4D$0@t$L$0 $ƒD$0$ L$0 $L$4l$(ÃtL$$ $l$l$(|<t MEt T\ $L$$L$&D$(,$E@ԃ{D$(MEd,$E@T|9#L$0Q( 9sLB u,$щT$)l$L$ŃD$(T$+T$L$0Q,Q0 ,$\$ \$rL$ ŃD$(;L$4uʋL$0Q,Q0L$$ $D$L$(}.D$( w $A@gtD$( t D$ D$|$4,D$ )D$4 $A@Ӊ$B@ $A@Ћ\$ L$0 $<, R<]m)$|$4t$0I'T$ WD$B 2Bt $$D$= 1É $י$D$& L$ $$L$ٳL$L$L$ T u1ËL$ $L$L$PÃWL$A 2At$ $D$ 1É$'$D$ D$$L$T$D$uD$ u1ËBtу<IuEu@BtуLIu)u$11)T$\$ L$ $L$ L$MÉу4Iu˃rƉу,IӃ4[)밃HT$L WD$4D$,B 2Bt $M$D$ 1HÉ $j$D$ L$P $$L$L$0L$L$4L$ 趆 T$Lu1HÃ|$4|$4BvJ $)tW$$D$ 1HÍD$@$D$0D$WD$ql$LD$@uD$Du l$L|$4t EMT $D$l$LEXEtW,$\$LD$,uCXCT$D$,HÃtD$,4$l$L|$4uTEt<IEtLI11)T$@\$DD$8$l$D$@D$D$DD$ D$4D$\$LD$8u D$<!C4C8L$8 $L$,I4[)ˉT$ \$$)$B@Ћt$pL$p $D$4$01lÉ$,D$ D$L$4 $$L$L$(L$L$$L$ L$ L$L$L$c u ,Á|$trL$( $(4L$_u ,ËL$$ $(4L$u ,ùl/ $$L$L$(L$L$ L$ T$0BBu ,ùdD+ $$L$L$$L$L$ L$ k\$0C C u1CtSC t ,É$B@1,ø,à T$BtJ $L$L$D$Ѓt 1 ÃT$ BtZB tZB tZ B t.BtZB t1É$C@$C@ЋT$ $C@ЋT$ 땃T$ ӃCC KHBtZB tjB tZ B t>BtZB t$BЃÉ$C@ЋT$ ݉$C@ЋT$ 뱉$C@ЋT$ 녃L$ $L$L$u`$D$D$g 1ÉD$ $L$L$rT$ D$ tD$É$B@ L$I $$L$L$L$k à L$I $ $L$L$L$D à L$I $$L$L$L$ à L$I $$L$L$L$ à L$I $$L$L$L$ à L$I $#$L$L$L$ à L$I $)$L$L$L$ à L$I $2$L$L$L$Z ÃL$I $;$L$L$L$3ƒu1t$L$I $A$L$L$L$É$B@σL$I $G$L$L$L$="tЃt$L$I $N$L$L$L$É$B@σT$ B u_$U$D$ 1ËJ $ ZL$Ã$u 1ĐË$ u狄$$$@@̋$ u$$$@@뗉$B@뀋$@ D$x$IT$xD$|E@t,$ $MIL$E@Ћ$D$l;D$tsP\$t+\$lD$|+D$x$ $MIL$L$lL$\$ L$xL$D$E@Ѓ$@ L$x)‹$@9t$ $T$YF cD$4$T$h$uCtrv t$ $L$(L$%ĐÉ$B@Ջ$ u$$$@@ЋT$h뎋$I $$L$L$lL$L$hL$ D$$D$$袠Ã4T$<\$8D$,D$ B@T%D$0T$C )90K  $D$l$ l$9 D$L$ H 1ËW$s-D$܄ Ã|$t$l$ }}U MEu@$t$A \$ CCu ËKI K C@K C1Ã$t$(T$,J9j )͋BJ ) $NIL$T$l$ у L$D$F@Ћ\$(tFtAK $ك L$L$,L$KL$ D$t$(T$,l$1$à D$L$( $L$,L$s-L$P3L$ L$L$L$L$-v u1 ËL$$ $L$L$L$L$ ÃT$ B@ t#у $JIL$B@ ЋT$ uB --1à D$L$( $L$,L$s-L$ }#L$ L$L$xu T$$u1 É$D$ЃD$u1 ËL$$ $s-L$T$ÃD$u@u!u1 u$C@ u։$B@Ћ\$ŋ@=1t!^$s-D$ \$T$땋KJB L$ $\$T$BBeB@t+у $JIL$B@Ћ\$T$/ tЃ É$C@ЋT$1à T$BrBw1 ËBtJ $L$L$D$Ѓtك ÃD$$[2T$BtBrBv J t$BЃËB$B@@ЋT$ׁD$`D$$ $$L$t-L$P3L$ L$,L$L$L$;s $u 1ĄËL$,L$d\$41D$|$B D$B ډL$`L$h $L$`L$T$TD$,$詗L$`t;L$dug|$|u>$u 1ĄË$ u狄$$$@@̋L$| uD$|$D$|@@렉 $돋$ $L$hL$$M|$tD$h;D$pD$h;D$ps$L$hL$$@ L$t)‹$@9t$ $T$; D$,$}L$`;L$dt $|$|u$ĄËL$| uD$|$D$|@@ЋJ $у L$L$hL$JL$ L$Z$ Ѓ$D$`D$D$D$y$L$H B )9~ B ډ\$ ‰T$($$D$`$ЃD$B D$ $I T$` $D$dD$D$ D$T$($@ WT$ B@ t#у $JIL$B@ ЋT$ uB --1à D$L$( $L$,L$(t-L$ }#L$ L$L$o T$$u1 É$D$ЃD$u1 ËL$$ $>t-L$]T$ÃD$u@u!u1 u$C@ u։$B@Ћ\$ŋ@=1t!^$Dt-D$V| \$T$땋KJB L$ $\$T$BBeB@t+у $JIL$B@Ћ\$T$/ tЃ É$C@ЋT$1à T$BrBw1 ËBtJ $L$L$D$Ѓtك ÃD$$,T$BtBrBv J t$BЃËB$B@@ЋT$׃Hl$LT$Tu$D$8 H1D$@D$DT$TM$ $L$PL$D$l$LÃusuX|$@u/|$Du1HËL$D uD$D$D$D@@؋L$@ uċD$@$D$@@@ u$C@뒉\$(C@T%u ^${t-D$z \$(YCD$E CM )9~ \$(CM $D$}T$L\$(D$D$$ЃD$B D$\$(L$LI T$ $؃D$CD$T$( \$D$L@ CL$, $ى\$(L$D$$D$Hl$L\$(N|$$~!,$L$,L$l$L\$(&|$=|$T2D$,;D$4s!,$L$,L$cl$L\$(D$D@ L$8)‰D$ 1ۉ\$(|$T|ttD$D@9tL$D $T$F5 \$(u1|$@uD$DHËL$@ uD$@$D$@@@ uƉ$C@빃|$$tT$TM$ $L$PL$yt-L$T$ l$L$C@ЋT$ l$LD$,;D$4M $ L$L$,L$ML$ L$Il$L\$($B@1/D$L$$ $t-L$D$L$ L$L$s u1ËD$=-tc|$t\D$@@T%t+L$ $‹L$ $t-L$T$Ë^$t-D$v 1ú뿃D$L$$ $t-L$D$L$ L$L$Es u1ËD$=-tc|$t\D$@@T%t+L$ $:‹L$ $t-L$T$Ë^$t-D$u 1ú뿃$D$ L$, $t-L$D$L$ L$ L$r u1$ËD$ =-|$ D$ @@T%tmL$ $y‹L$( $u-L$T$u1$ÉD$$L$S T$D$ tD$$É$B@^$u-D$t 1$úzT$ B@ t#у $JIL$B@ ЋT$ uB --1Ã(D$L$0 $L$4L$Cu-L$.L$ L$ L$L$L$f T$,u1(É$D$ЃD$$u1(ËL$, $Tu-L$zT$$ÃD$u@u!u1( u$C@ u։$B@Ћ\$ŋ@=1t!^$Zu-D$ss \$T$$땋KJL$ J$D$ B L$ $\$T$$BBXB@t+у $JIL$B@Ћ\$T$$" tЃ(É$C@ЋT$$1à T$Br3Bw+B$tJ$ $L$L$D$Ѓt 1 ËBt͋J $L$L$D$ЋT$t ÃD$$#T$BtBrBv J t=B$u$BЃËJ$ uB$$B$@@ЋT$ˋB$B@@ЋT$묃L$ $L$ L$D$Ju ËL$I$ $u-L$u-L$D$D$ ܿ\$‰D$ t*u  t1É$B@$C@ЋT$ŃL$ $L$L$Et1--ÃL$ $u^$u-D$p 1D$ L$ $ST$ 9}`L$ $T$au1ËL$ $D$D$T$D$ t|$u1D$ 뙉$B@--Ã$T$(ЃD$ J $у L$L$ L$J L$ JL$L$‹D$(@ u1$ÉT$$T$~JL$(I$ $u-L$u-L$T$ T$u t1$É$B@ t--$É$B@(D$L$0 $L$4L$u-L$.L$ L$ L$L$L$a T$,u1(É$D$ЃD$$u1(ËL$, $u-L$}T$$ÃD$u@u!u1( u$C@ u։$B@Ћ\$ŋ@=1t!^$u-D$vn \$T$$땋KJL$ J$D$ B L$ $\$T$$BBXB@t+у $JIL$B@Ћ\$T$$" tЃ(É$C@ЋT$$1à T$Br3Bw+B$tJ$ $L$L$D$Ѓt 1 ËBt͋J $L$L$D$ЋT$t ÃD$$T$BtBrBv J t=B$u$BЃËJ$ uB$$B$@@ЋT$ˋB$B@@ЋT$묃L$ $v-L$uW$2v-D$l 1ËL$ $Hv-L$‰D$@tJ $BЃu#1 $u1ËL$H1Ã0|a-D$$0D$^3D$D.D$ D$$1 $}0ùnv- $$&9L$D$D$ L$ӁD$(u01Ƀ|tNL$,L $'T$,}0ËDD$($D@ D$DD$蹐L$,A|uk t ~v-$2V0à =_u@w1 $  u1 ÉD$$w1L$赝T$_ t _ É$B@ D$(@@T%u^$w1D$j 1 dD$u1 ËD$(D$  [t#T$ $L$ L$T$udT$x1D$Mj 1 É$;x1L$D$u1 ËL$ $D$D$D$}T$D$ tD$ É$B@$>VD$_D$_D$mD$aD$pD$_D$D$$$D$^$ $\x1L$D$D$ $ $L$L$L$ L${$u à X1Ã|$t$ l$|$~1s+} ËEL$EN|$1Áv Ã} É<%t%с9s É%с9wމ%с)%Jf=tMEʁHL$E|$t$|$~F݈Ç݃|$} ÇÇ=s#ȕL$L$|$1Ã|$} ÇÇ݃<ňn#t@ȕ:͌n#s Ë@ȕ:͍n#w@Е Ռn#)ȕ݈ؕn#B=tl$L$|$ t$|$~;D$(s1} Ë݈݋D$L$O|$1Áv Ã} ÉWD$_D$_D$mD$aD$pD$_D$D$$$D$$ $8q8L$D$D$ $ $L$L$L$ L$Ɇ$u à X1Ã|$(t$$|$ ~;D$(s1} Ë݈݋D$L$ O|$ 1Áv Ã} É<ż4t49s É49wމ4)ݼ4Jf=t%u9 ʁɀHD$L$ } Ë@ԁ@D$M\ D$!AD$%I$1$4$D$3A@D$1$4$D$ _-AD$L$ |$l$|$~HEވÇރ|$ } ÇÇ=s$ȖEL$L$ |$1Ã|$} ÇÇ=uE@=Ç5<7.t#E@5Ж 7.9s ËE@5Ж !7.9wԋE@5Ж 7.)Ȗؖ7.B=tEl$L$ |$} ËE@=uE@=t ËE@=uE@=r=fE@ʁrʁfD$E@=udf1ƃt D$u ƒtiLL$IӍ El$L$ =r =vf 3frAJ .f|$t$ l$|$~1s+} ËEL$EN|$1Áv Ã} É<ż4t4с9s É4с9wމ4с)ݼ4Jf=t M%t"EʁHL$EEʁɀHփ|$t$|$~F݈Ç݃|$} ÇÇ=s#ȕL$L$|$1Ã|$} ÇÇ5<7.t&@5Е 7.9Ç݃<;t@ȕ:;s Ë@ȕ:;w@Е ;)ȕؕ;B=tl$L$@5Е !7.9R@5Е 7.)ȕؕ7.B= z|$,t$(|$$~Ã|$ } =s#EˉL$EL$ |$1Ã|$} Ë@=D$ ȃD$ƒD$L$ hn$L$ p@1ވÇL$ X )=tÇ=u =t=u}Ç=uB=uE0l$EL$ ET$ '1=uET$ /1뭸ÇÇ=u0=uET$ 461oiLӁu%1ȖȖIӍ M-=t =v ƒ1r=r =rƒt=u=r =vˁ'ʁƒψʃ^1ȃ!ވÇʃ^ƒ!‡Çރ<7.tȖ 7.8s ÖȖ!7.8w–Ж 7.)Ȗؖ7.BM=tl$EL$ ƒoHƒ-ÍEi{q8 $ 48L$D$D$ L$it$Rà = Vu@$" $*u1 ÉD$$4"L$ӅT$ V t  V É$B@ D$(@@T%u^$C"D$R 1 dD$u1 ËD$(D$ Wt#T$ $L$ L$2T$udT$c"D$kR 1 É$"L$D$u1 ËL$ $D$D$D$蛢T$D$ tD$ É$B@$>YD$_D$_D$mD$aD$pD$_D$D$$$D$|$ $"L$D$D$ $ $L$L$L$ L$v$u à X1ÃT$ D$L$ ȉ1Չ9t T$; u&} Ë~D$L$O_Ã} Ë@HD$L$ ͱ#9Ͱ#)ݬ#Jf=Nm|$t$|$~F݈Ç݃|$} ÇÇ=s#ȕL$L$|$1ÇÇ=uV|$} Ë@=r =v Ëʁl$L$IÇ=|$} Ë@݈Ç݋@ÇÇ5<\#t5Е `#9s 5Е a#9w5Е `#)ȕؕ\#B=tl$L$b|$} Ë@ÇÇ=u=Ç5<0q7t5Е 4q79s 5Е 5q79w5Е 4q7)ȕؕ0q7B=tl$L$}<|$ t$|$~_D$(f=r=r:=w0} ËʈD$L$O|$1Ã} =uR<Ŭ#tͰ#9<f@!%t ݈Ç%$ȕ߃to^ $ȃ߈‡Ç݃˃s=ʃ?s!ƒ@AD$L$ƒA1뒸Éͱ#9Ͱ#)ݬ#Jf=u f\8> u f~'arvv f@f|$t$|$~<ƒ|$} =s!ʉL$L$|$1=r===|$} Ë@Ã@fÃ~v=P=Bʁ&D$ˁÃʃ^1L$ȃ!݈Çʃ^ƒ!‡Ç݃!uƒ@tÇ݃<0q7tȕ4q78s Õȕ5q78w•Е 4q7)ȕؕ0q7B=tl$L$B<l$L$&ƒAÃ?=r=UËʁ$|$8|$4~zD$0(fs \f\=r=r?=w5|$<} $ËʈD$0L$4L$<|$41$Ã|$<} $þt$=G`|$,uYtOu $Á]RtTtSVt߁Ytׁ[\tρw^tǁ&vtk~t|$,u  u f~7a+@f~f|$|$~BD$ƒ|$ } ƒ\s%ʉD$L$L$ |$1ƒ\u ƒ~s ʉƒ~u > ƒu =r=a=2=$|$} ËD$@Ã@Ã~v==ʁˁÃ˃^q1ʉʍH݈Ç˃^JÃ!ވÇއÇ݃^~!|$ Ç݃.uÇރ!u ÇÇ݃/u Çރ~t߇Ç݃Ou ÇރTtLJÇ݃Ou Çރ~tÇ݃tu Çރ'tÇ݃~uÇރz{Ç݃~uÇރ{_Ç݃~uÇރ|CÇ݃~uÇރ}'Ç݃~uÇރ~ Ç݃<0q7tȕ4q78ÇÇ݃<ż3tȕ38ÇRÇ݃ÇޕЕ U-)ȕؕU-B=D$l$L$ Çރ;·Ç݃csÇ݃_t =o7eÃÃl?H=r=Ëʁ" $(6L$D$D$ L$=t$à =d_u@' $/u1 ÉD$$'L$YT$d_ t d_ É$B@ D$(@@T%u^$'D$& 1 dD$u1 ËD$(D$ XVt#T$ $L$ L$7T$udT$'D$p& 1 É$7'L$D$裟u1 ËL$ $D$D$D$vT$D$ tD$ É$B@$>[D$_D$_D$mD$aD$pD$_D$D$$$D$聿$ $X'L$D$؞D$ $ $L$L$L$ L$J$u à X1ÃT$ D$L$ ȉ1Չ9t T$; u뾸ÃL$=s\u,=u f\Ë=> uf~Ë~t͋fӃL$5=r5=v 5ÃT$=ar =v Ë@fÃ=Sua0' $;'L$DWL$D$ Bu,J' $U'L$D$`L$ t S1Ã=`l$E<tEU I8s EU I8wEU I)]ߍB=tÃ=DWl$E=s&E<tM@M9s ËM@M9w݋M@M)]ߍJf=t%uøøÃ' $4w4L$D$D$ L$`t$Zà =Zu@P. $u1 ÉD$$`.L$2T$Z t Z É$B@ D$(@@T%u^$o.D$1 dD$u1 ËD$(D$  Ut#T$ $L$ L$xT$udT$.D$H1 É$.L$D${xu1 ËL$ $D$D$D$xOT$D$ tD$ É$B@$>\D$_D$_D$mD$aD$pD$_D$D$$$D$Y$ $.L$D$wD$ $ $L$L$L$ L$v#$u à X1ÃL$ $|u ÉD$ $L$L$o0\$ u t É$C@D$$.L$fwuW$.D$\$ 몋L$ $.L$swt$ L$ l$$\$ƒtȋJtJM tt1É4$F@$C@Ћt$ Ӄ=\^u--. $8.L$SL$`L$ u\^1øà |$~HD$(s>|$$} ËD$ ݈݋D$L$D$ L$$|$1 ÿ|$$} Á]D$_D$_D$mD$aD$pD$_D$D$$$D$胍$ $4L$D$lD$ $ $L$L$L$ L$$u à X1Ã|$t$ l$|$~1s+} ËEL$EN|$1Áv Ã} É<.t.с9s É.с9wމ.с).Jf=t%t  MEʁɀHL$E|$t$|$~F݈Ç݃|$} ÇÇ=s#ȕL$L$|$1Ã|$} ÇÇ5C<B9r B9sJ)ȋD$l$ L$(BÇÇ݃rÇ݃Ȗiˍ =w|$(} ËL$(D$l$ D$1Ë\$T$L$ t}Ë~@}1Ã|$t$ l$|$~<stD$ u+} ËEL$EN|$1Ã} ËE~E@}EPL$ED$ yv É<.t.с9s É.с9wމ.с).Jf=t%t ËD$ uS} ËE~E@{MAEʁHL$ED$ t} MEʁHL$E9D$1ËD$1Ã|$t$|$~i݈Ç݇Ç݃~@|$} ~u4|$} Ë~l$L$|$1{u D$tE}u D$t& ul$l$GËD$֋D$ʇÇ%t ËD$u+|$} ËȕL$L$|$} Ã|$} ÇÇ݃ D$@\$D$AD$@$] T$\BD$DB L$PJL$LJ D$@L$\ $L$HL$6DD$TD$@$ \$\T$Tu C u |$Htu-D$L$C+D$DD$r\$D$LXÉރ<$T$8;D$D$=-t3D$$=\$ ȟt1D$ D$$s D$$L$ $0L$L$ L$\u1D$ $a L$ÃL$ $0L$L$ L$u1D$ $ L$Ã4D$<$D$$D$d9T$T$<\$,  $L$8L$L$0L$u&D$ D$0D$,D$,;D$$|‹L$ $@D$,뢃( W $|7L$L$Mt1(ËL$0 $L$$L$L$L$蓡t1($L$L$辍u1(ÉD$$1ÉD$ D$D$D$;D$}PT$$D$$ /thD$$v\$ C\$ D$D$;D$||$u0L$ tD$0D$0(ËD$$D$@@݋D$( /tD$$\$ 냈| DŽ$ W $7L$L$޸t 1 Ë$( $ރ7L$$L$$L$ 8u 1 Ã$t*$} W$7D$`z1 Ã$$֋$t'$  /V$u$0T$ $$L$$L$蜎‹$;$ti$I /tE$t'$  /$tHD$$D$7D$$D$ 襎W$D$D$y1 Ã=VtHD$$D$"7D$$D$ TW$D$D$x1 É$2 $$ $$L$$L$S$ DŽ$ W $C7L$L$<t 1 Ë$( $t7L$$L$$L$ M6Wu 1 Ã$t$$}$}7D$w1 Ã$$܋$t'$  /O$u$7D$Uw1 Ë$ $$L$$L$ƒ$u 1 Ã$u%$lt$Lu$$t#$  /u}$teD$$D$7D$$D$ W$D$D$av$ t 1 É$B@Ё $E$o  W $Є7L$L$t 1 Ë$( $7L$$L$4u 1 Ë$t'$  /$u W$7D$Yu1 ËSSul= $2$$$D$WD$gݜ$$ $莄|$fD$ l$ \$ l$L$ ) S\9ܜ$ut$t#$  /um$tHD$$D$+7D$$D$ 迉W$D$D$+t1 ݄$$ $U1 ËT$ 7D$sS1 $ 4D$,D$(D$ D$L$< $N7L$L$,L$L$ L$ L$(L$L$L$1u14ËD$ ;D$tW$]7D$=s14$L$ǃu14Ã1ہ} 3C|1;l$ }L$, T$( E;l$ |4ÁTDŽ$<DŽ$,DŽ$  W $7L$L$菰t 1TË$\ $7L$$8L$$4L$ $$L$$,L$$ L$0u 1TÁ$$t W$Ʌ7D$q1TË$4$L$8@$$(D$$$u 1TË$ $$H$0$8 $Ö$(Ń$ $D$D$D|aE?$H$H$L$L%9tDŽ$<$D$D}$<t$TË$ t$8$8TË$$$@@1ہ} $L %DC|1;$ }*$, %L$C;$ |։N|JEۃ|t#$H$HD%9tDŽ$<N}$<uB$ t$8$8TË$$$@@΃~!$$$H+$0D$$TÃ|$t$l$ )l$1;\$M83u>t3\$ A $AL$IL$ |$t$l$ \$ u؃C;\$~Ãt$ l$(D$|/L$ $t$ t$L$$L$l$ Wt$ l$(ÃuD$ÉD$)D$믃$\$4T$,tA9=L$( $T$L$0L$\$ l\$,T$@T$@uD$DD$($ËD$<+D$4L$|$u7 $vD$ |$ u1$ËD$ D$DL$D$ $Á|$1D$|$u1$ËD$D$ T$@~~D$$D$(D$\$똋L$( $\$L$0L$L$4L$ \$,tD$$D$(D$L$L$kT$4\$D$()D$,\$D$$D$8D$D$L$pT$d$!L$L$4L$L$0L$ L$,L$L$(L$L$'L$=u |$4D$@$D$ D$D$pD$DZ D$ `$D$L$d $D$L$@L$L$t|$}L$D$0D$ ËBB`$L$4 VÃD$u[D$D$$@$D$D$D$D$ D$D$F1\$|$5uD$L$ VRu L$DD$7B#S$ $$L$L$ L$L$L$ {u 1Đ=M D$$ $L$ L$L$L$L$L$ VD$D$$HM |$u U$K!D$V1ĐÃ|$t$@ЁĐ--ĐÁ$ $$L$L$ L$L$L$ u 1ĐlL D$$ $L$ L$L$L$L$L$ D$D$$wL |$ u uL$ $襗Đ1ĐÃL$I $胗ÃL$I $rT$} BЃÉD$$J L$JL$JL$ 6D$uD$$<L$ȃÁ$ $L$L$u 1ČÍD$$D$D$D$L$ȃ$Ã|$[D$(@Ѓ$Ã0T$4D$,B3B`'B\$B#PXD$t赿D$4@\$ V.H D$L$4 $D$D$\$D$(u+L$4I $L$8L$L$D$\u+L$tI $L$lL$L$hL$L$`L$ #D$dD$$? V|$\u)D$($`U$!D$I1pÃ|$t t3t.D$($`T$d} D$t@ЃpÉ$Zp+l$ \$ 1B#D$($0`pÃtD$dL$| $!L$L$(L$L$dL$ T$xu1tËD$(D$pD$0D$lBB`B\$B#PXiD$tSD$x@\$ V= D$L$x $L$D$\$oD$hD$`u+L$xI $L$pL$L$lL$L$dL$ !D$hD$$= V|$`u)D$($^U$!D$AG1tÃ|$t t}txL$\L$hT$xtD$($^1tÃ}A|$\ u |$lD$($v^|$h} D$x@Ѓt--tL$p)L$l l$ \$1B#[D$($^tÁD$18ÍD$$D$D$YD$HfD$D$$D$4D$D$L$ $L$,‰D$$D$<@9D$4u |$D]L$( $T$C8T$$D$ tO|$ 1D$4D$4! $L$< L$L$,L$L$(L$ `D$0$B@뤋D$@$D$D$D$T$$T$B@Ћ\$4s|$D18Ã4L$< $!L$L$0L$yu14ËL$0 $L$L$L$L$ }143 D$`$D$ L$0 $.D$,D$$3 D$L$, $L$L$L$L$ OD$`$D$4Ã@D$0D$,L$H $!L$L$(L$u1@1ҋL$( $L$,L$L$T$ "T$,}1@D$tV$!D$<1@ÉЃD$D$1 D$`$D$L$ $L$L$L$L$a-D$$D$$1 L$$ $L$0L$L$L$L$ %D$ `$D$ @à D$L$( $ !L$L$L$L$L$ eu1 $1 D$L$ $L$L$$D$D$$B1 T$uV$!D$:1 ËJ $D$ L$ $I| à D$L$( $7!L$L$L$L$L$ u1 Ã|$|$w_0 D$L$ɉ $D$ L$ $L$L$&D$D$$g0 T$uV$n!D$:1 Ë $.M ËW$I!D$91 ÃL$ $!L$L$L$u1/ D$ L$ $&D$D$ $/ T$uV$!D$n91ËJ $zÃ4D$,D$D$D$D$ L$< $!L$L$ L$L$L$ L$L$$u14ËL$ $L$L$L$L$L$$L$ } "4ËL$$ $L$ L$L$L$L$L$ \$,ƒD$0u{|$u2uD$$$j\$,T$0uD$($i\$,T$0u#uD$4 u$C@ uԉ$B@Ћ\$,ËL$( $L$ L$L$L$L$L$ qT$0ÃD$,N $T$D$4%\$,T$0D$(,D$L$4 $!L$L$$L$L$ L$ L$L$L$L$u1,ËL$$ $SD$$|$$} ,ËL$$ $L$ L$L$L$L$L$ ,ÃL$ $!L$L$L$)u1Ã|$}W$!D$61ËL$ɉ $ $@xÃT$B@T%twRT$ u6T$ uW}W$!D$l61Ãu6T$ u$/D$L$ $q11ËB@T%t'$ƒD$ uK6T$ t1Ë ^ $*"L$JI L$l=ÃL$ $F"L$L$L$u1Ã|$}W$N"D$51ËL$ɉ $$vÃT$B@T%t^RT$u5T$u>}W$}"D$51É$D$ L$ $-1ËB@T%t'$诱ƒD$u 5T$t1Ë ^ $"L$JI L$.<ÃL$ $"L$L$ L$u1ËL$ $"L$u!D$L$ $L$EËL$ $OD$|$uЋV$"D$31ÃL$$ $"L$L$L$L$L$ u1Ã|$tV$"D$31ÍD$$D$D$D$D$<$t$PD$ L$ $Fà L$( $D"L$L$L$L$L$ Wu1 Ã|$uV$Q"D$ 31 ËL$ $L$L$L$L$V}$:1 Ãu$v"D$21 Ã|$uL$ $L$XD É$"D$21 Ã8D$$D$D$L$@ $"L$L$4L$L$0L$ L$,L$S Wu18Ã|$4uh|$,t $"D$218ËL$4 $L$0L$L$L$L$ 6uV$818É$D8É $"D$D$4D$0918ÁD$tD$pD$lD$,D$(D$$1D$4D$8D$D$uù" $ YL$D$b0VuÉLb-D$$"D$L$M" $ VL$D$0]uD$$"D$L$5M" $ VL$D$/0SuD$$"D$L$L" $ VL$D${/UuD$$"D$L$LI-L$ $"L$I-L${LtI-L$ $"L$I-L$NLtù"D$$"D$L$%LHb- $"L$D$D$L$ $"L$L$L$KtËD$$ "D$D$LD$$"D$D$LD$$"D$D$LD$$'"D$D$tLD$$/"D$D$VLD$$<"D$D$8LD$$E"D$ D$LD$$O"D$D$KD$$X"D$ D$KD$$_"D$D$KD$$k"D$D$KD$$v"D$D$KD$$"D$D$fKD$$"D$D$HKD$$"D$D$*KD$$"D$D$ KD$$"D$D$JD$$"D$D$JD$$"D$D$JD$$"D$ D$JD$$"D$@D$vJD$$"D$D$XJD$$"D$D$:JD$$"D$D$JD$$"D$D$ID$$"D$D$ID$$("D$D$ID$$4"D$D$ID$$@"D$D$ID$$L"D$D$hID$$U"D$D$JID$$]"D$D$,ID$$g"D$D$ID$$o"D$D$HD$$x"D$D$HD$$"D$D$HD$$"D$D$HD$$"D$D$yHD$$"D$D$[HD$$"D$D$>HD$$"D$D$ HD$$"D$D$HD$$"D$D$GD$$"D$D$GD$$"D$ D$GD$$"D$D$GD$$"D$D$lGD$$"D$D$NGD$$"D$PD$0GD$$"D$D$GD$$+"D$D$FD$$7"D$D$FD$$G"D$D$FD$$["D$D$FD$$f"D$D$}FD$$w"D$D$_FD$$"D$D$AFD$$"D$D$#FD$$"D$D$FD$$"D$D$ED$$"D$D$ED$$"D$D$ED$$"D$D$ED$$"D$ D$oED$$"D$D$QED$$"D$D$3ED$$"D$D$ED$$"D$D$DD$$#"D$D$DD$$."D$D$DD$$9"D$D$DD$$F"D$D$DD$$R"D$D$aDD$$_"D$D$CDD$$j"D$D$%DD$$u"D$D$DD$$"D$D$CD$$"D$D$CD$$"D$D$CD$$"D$ D$CD$$"D$D$qCD$$"D$D$SCD$$"D$ D$5CD$$"D$D$CD$$"D$D$BD$$"D$D$BD$$"D$D$BD$$ "D$D$BD$$ "D$D$BD$$ "D$D$dBD$$$ "D$D$FBi`Ãt$ 1a} i@} FÉh<uhE뽉j  uډ i$l$ i@@Ћt$ l$뫃 L$(D$D$D$,AAL$$ $'L$`Ńu D$MITE9D$vMITLl$E L$u D$ $B?|$,t$l$ÃuN|$ u!MEt É,$E@L$ uҋD$ $D$ @@Ћl$빃`;D$~\$كT$( `| W$'D$l$YD$ v vX v@Ft$v@D$W$'D$l$L$l$@ MEt D$@ É,$E@EW$D$1 T$, @|D T$, @T$(t$, I!ЃtD$G맋L$ $Nt$,ǃu1$D$ 1ۍ [@ [hT$(!Ѓtc [\$[|$<$L$ L$T$|$t$,\$}t1$É<$G@D$ CW$Á,D$x-D$t$4 $"'L$L$L$ $L$$L$L$|L$L$tL$u 1,ËD$t=-D$<DŽ$ DŽ$DŽ$$ $L$hL$$ L$D$4}8$ $+$$$$ D$x,Ë$ $L$\L$$L$oD$0|L$| $L$PL$$L$G\$0ƒoL$49~9ʉL$(~T$(n D$ L$( $L$hL$L$\L$L$PL$ L$.L$L$L$$$t$E.L$L$L$^$$t[$T$X$$tD$@0L$ t 1\$ Su $$‹D$ PuЃT$u--É$D$ L$ $L$ L$L.L$P à T$u-- É$L$L$S.L$ ÃT$u--É$#ÃT$ u--É$L$L$4"1ÃD$ $D$%RD$ @$D$à \$<Y/u.Z. $L$L$L$L$\$  Y/  Y/ ÃT$1ۋBBBtOBJ $L$L$L$ L$L$$L$ BЋT$ËJutJul1BJt؃ËBtDBJ$ $L$L$L$ L$L$$L$ BЋT$ËJuJu1BJ؃ø1Ã$D$(@u1$ÍD$ $D$D$D$D$'|$u-D$D$ $L$ L$L$L$L$L$  u"D$ $D$D$D$D$I 1$ËL$( $L$,L$L$D$D$ jT$D$ |$u$D$ $D$D$D$D$ D$$Ã|$ uR|$u)|$tL$ u֋D$$D$@@L$ uʋD$$D$@@뵋L$ uD$ $D$ @@댉$B@J YD$|$$u1 tz D$L$ $L$$L$L$L$D$ 蠜\$u1 ÉC$D$D$D$-L$ %}1 ËL$( $L$,L$D$z l$\$D$uxE0u$RD$0@$D$6!L$ $L$L$\$T$}1 ËD$K H tЃ É$C@ЋT$,$\$L$D$ \\$T$}u1҉T$ u$B@Ћ\$ރL$ $L$I Ћ\$ƒuЃËC,uЃËK, $T$T$螋T$Ãu*L$I, $T$T$YuD$1É\$  t؃É$B@Ћ\$ JgL$ $L$u ù $ \$$T$(D$u ËL$ I ,$T$\$uC t-D$ $`D$ @$D$LÉ$C@ƉC D$ @ $o.L$L$8T$ D$L$ $J0I L$L$L$T$ \$‰D$D$ @ tNu-D$ $D$ @$D$ t1É$B@$C@ЋT$롉$T$\$T$B t1B(t)$J L$J(L$5D$@(ȃ1Ãl$\$T$B u$l$\$ËB(؋J$9~?T$ $w}ËL$ $L$rl$\$T$ uËB$9~!T$ $l$\$D$ @(뉋B T$ J(ȉ$l$\$D$ L$H(]4D$8D$0$D$_L$0 $l$0\$@}4ËEM $l$0‰D$E$L$,uD$0$41;|$L$0 $|$ \$@ L$l$0D$u&,$lT$, t4É$B@T$ \$@ I $M IЋ|$ t$l$,ÃuHD$0$ \$T$, t t4É$C@$B@Ћ\$ՋD$0@+E 0E X;|$L$0 $L$\$x} tÉCC$CD$1tËL$| $.L$Iu,$ $ƒ} tËD$xP1tËL$| $.L$AIu,$ $ƒ} tËD$xP 1tËL$| $.L$Hu,$ $\ƒ} tËD$xP1tËL$| $.L$H$L$x B@T%u ^$.D$tËRA$9u1tà W$.D$tÁT$p~=D$ $6.D$D$蠇W$D$ D$ctËA t#A(t $L$xA $T$p$"T$xB B utËL$pJ$1tËL$| $^.L$GuL$x $"} tËL$x $L$|L$$L$t1tË`$D$|D$tÃl$1ۍ<Y/tLE0t.M0\$ $L$L$D$Ћl$\$ tC<Y/u1à D$$D$L$A,tQ,A, t1 É$B@0D$,D$(D$$D$L$8 $L$H<JL<P<uT<X<}\<`<d< h<}l<`p<t<x<|<0< $.L$D$8tD$H$.D$L$L1h<tO . $j IL$l$j IL$\$ uK t5D$ |$ D$H$#.D$D$ D$$C@뾉$D$D$诸t$$l$T$D$ t|$}E,$B@Ћt$$l$׃LÉ$C@ЋT$4<$B@t$1<Y/tz|$tF0E؋F0F0l$ u)F$D$  Y/Ћt$l$ uΉ$C@Ћt$l$ 빃à L$ $3L${u1 ËD$й3 $D$V ÃL$ $3L$L$ L$\{u1ËL$ $D$й3 $D$ ÃL$$ $3L$L$L${t$L$ $D$Љ¹3 $T$NL$$ $3L$L$ L$zu1ËL$ $D$Љ뭃L$ $3L$L$ L$zu1ù3 $L$ L$D$й3 $D$,ÃL$ $3L$L$L$2zu1ËL$ $D$й3 $D$ÃL$( $3L$L$L$L$L$ yu1ËL$ $L$L$D$ йÅ3 $D$ÃL$ $t)D$$D$D$L$ L$/gT$ tÉ$B@=P W $Ņ3L$L$}ù3 $#=L$D$D$ L$uÉ$ D$$3D$-D$zfD$$3D$-D$\f1pfT$=ʉ $ʉ $1ÃfT$=ʉ $ʉ $O1ÃT$B=@M-J $@M-L$P L$ $L$L$ 3|$}W$YR9D$诹1Ã|$ut|$~kL$ $d6D$ɹT$t6 W $聻tW$vR9D$N119u֋D$fÃ\at1ËD$fϋ^$4R9D$1ÃT$B=@M-J $@M-L$! L$ $L$L$1|$}W$R9D$耸1Ã|$ut|$~kL$ $55D$蚸T$t6 W $RtW$R9D$119u֋D$fÃ\2t1ËD$fϋ^$R9D$轷1à * XYD$|$u1 ÃuD$ ÉL$D$t,L$ $=L$oQuD$D$uԋD$ ËL$ $L$ ‰D$ )ʉT$ D$u誼븋L$ A $: D$u荼T$ u$B@냋L$ $L$L$6T$u*L$ $T$L$L$q8T$t 0T$ t)L$ "D$$D$@@ $B@ʃ ` $~à ` $L$ L$ à ` $L$L$D$D$$D$ ÃL$ $D$ }1ɫD$L$ $D$ЉD$D$$|$} M--ÃD$L$ $L$$L$ |\L$L$L$ su1HD$L$ $D$(ЉD$D$$m|$}L$ $ËD$$)--Ã(|\D$$D$ L$, $L$0L$T$L$$L$ T$L$ L$su1(蠪D$L$$ $L$ L$D$4ЉD$D$$轪D$$$D$ $|$t (--(ÃL$ $L$L$L$ L$ _Љƃu1ý @l$ t$@=-u% --t @  I HE ~ø-$-@Ћt$l$ ÃD$ L$ $T9L$L$ L$qu1Ã|$ u ] $ËD$ ]--ÃL$ $ŃD$uÃ=]tYL$ L$D$}< X*(L$L$D$$Ml$ËL$T$h L$T$XÉڃ < $) D$u1 ËL$$I $L$A L$$I $D$O7L$AL$$ $D$17L$AL$$I $L$AL$$I $L$AL$$I $L$A T$$J $JL$6T$B$1ɉL$L$$D$D$$@D$L$ {D$$D$D$$@D$D$D$ SD$$ D$D$$@D$D$D$ +軱T$t t1 É$B@Ѓ ÃDD$ L$L $L$PL$ |\L$L$ L$ mou1DËD$ D$D$L$ $L$$L$D$TЉD$D$$|$t$L$ ${D$D$$D$DÍL$$ $D$ڃ$L$, $T9L$ |\L$L$ L$ L$L$nu1$ID$L$ $L$L$mD$D$$gD$ $:|$u $腳$1L$ $T9L$L$L$=nu1ËL$ $͛u iÉ$ Ã(L$ $u @(ÍL$ $ (à L$ $T9L$hL$ Ã$D$ L$, $T9L$ |\L$L$ L$ L$L$mu1$ D$L$ $L$L$fD$D$$*|$}L$ $$ËD$ $--$Ã0D$,L$8 $T9L$ |\L$L$,L$ )L$L$*L$*+L$L$(L$lu10ND$ L$, $L$*L$L$(L$D$$D$ $b|$$}L$, $0ËD$,$--0à D$D$D$ʣD$D$D$D$$軶D$u@D$$|$u B ËL$ $ D$ D$$D$ É$L$L$`D$uD$$躷L$u=Vub D$L$ $L$ D$D$$:|$u ÍL$ $FD$L$ $L$L$ |\L$ U9L$ } à L$ $U9L$L$ Ã,D$(D$VL$4 $U9L$L$ L$ju D$бL$4 $$U9L$ |\L$L$(L$ oju1,D$L$( $蟮D$D$$!|$uL$( $,$JD$$u3誡D$D$$ZD$$ԡD$($1,VmD$L$ $D$D$$蓡T$=Vu52D$D$$D$$\D$($/D$$,D$D$$譮D$$'T$$ tL$( $,É$B@.u3$xDT$B.u$ZDT$$EDD$ L$ $L$ L$* D$ |$ u/L$$ t D$$D$$$D$$@@ރ|$tCL$ $ |\L$/U9L$Jy ƒD$L$ T$ L$$ $L$ L$T$$tIL$ t# t D$$a$B@D$ $D$ @@ЋT$$ċL$ D$ $D$ @@D$ $D$ @@ЋT$QƮK$D$D$L$, $6U9L$ |\L$L$L$ L$L$Egu1$ўD$L$ $L$L$FD$ D$$|$ }L$ $y$ËD$$--$à L$ $AU9L$L$a à L$ $MU9L$L$ ÃL$ $L$ L$VU9L$L$ D$D$ÃL$ $^U9L$L$L$4fu1D$ L$ $荜D$D$ $L$ $%ÃL$ $gU9L$L$ L$eu1ËL$ $aD$ |$ } ËL$ $à L$ $oU9L$L$ Ã4D$L$ $:D$D$$+|$} 4ùyU9 $L$ L$L$$L$L$(L$ L$,L$L$0L$4ÃT$B=@M-t]J $@M-L$ T$u@$ƒD$u謦T$uD$ D$$1øÉ$C\$ L$ $u ÉD$$T$ÉD$ tpu5\$uTD$ ى\$D$l$ x $<$fD$l$\$,$D$L$$D$$} D$$1øÉ$B@Ћ\$|\$(L$TL$X ${rD$X9 $L$0L$(D$(T$(D$(\$L$4L$(D$(T$(D$(\$ L$8L$(D$(T$(D$(\$L$u1ËL$ u $1D$ L$ $OY9L$L$ L$>u1ù]Y9 $L$ L$=ÃD$ L$ $_Y9L$L$ L$K>u1ùjY9 $L$ L$ÃD$ L$ $lY9L$L$ L$=u1ùwY9 $D$蟢Ã=Pte W $yY9L$L$\}1jku É$Y9L$Y9L$L$ Ii1뷃( D_ $Y9L$L$}1(Ã=P W $Y9L$L$踼}1(ÍL$ $^5u[,Z9 $D$/Z9L$葡`$L$ L$ ~T$ u1( u$B@L$ $[ (1r\$ C@T%tD$$KËC@T%1T$,؃D$9s@l$ЉT$L$ $D$\$( ÉL$Al$T$\$}#9rW$KZ9D$z}1Ã~E땋D$$ڋ\$( ӋIË^$kZ9D$8}뼃L$ $L$L$P 4L$ L$ Ã$D$ L$, $[9L$L$L$fL$ L$L$&;t:VL$ $L$L$w]ƒu =Vu$D$ D$ $'$D$ L$, $[9L$L$L$fL$ L$L$:t<VL$ $L$L$w\ Vƒuu$菽D$ D$ $à uD$$ރL$ $L$L$ |3L$ L$ ÃD$L$$ $[9L$*hL$L$L$ 9t2VL$ $gZƒu =Vu$ؼD$D$\$D$ $L$ÃD$ $D$$D$D$hD$ D$|$u 1;\$$saډ\$\$ ӋI $DŃtsL$ $T$\$ ӉL$l$l$s&\$l$tCMEt'C;\$$rL$, $L$(L$L$L$藟É,$E@Ћ\$ȃu+L$ t ËD$$D$@@MEuʉ,$E@뽃P 4 $ L$[9L$L$L$ t ù |3 $ L$[9L$L$L$ }t 1ÃI[9$Nd1ÃL$ $\9L$L$L$7u1Ã|$} W $\9L$$L$L$Њ u1É $D$HL$+3T$u t1É$B@Ѓà L$ $L$L$L$L$ à L$ $^9L$D$t ËL$ $^9L$L$t ËL$ $^9L$L$et ËL$ $^9L$L$9t ËL$ $^9L$ L$ t ËL$ $^9L$@L$t ËL$ $^9L$L$t ËL$ $^9L$L$t ËL$ $^9L$D$^t ËL$ $^9L$L$2t ËL$ $^9L$L$t ËL$ $^9L$L$t ËL$ $^9L$L$t ËL$ $^9L$L$t ËL$ $^9L$ L$Vt ËL$ $_9L$@L$*t ËL$ $ _9L$L$t ËL$ $_9L$L$t ËL$ $_9L$L$t ËL$ $#_9L$L$zt 1 Ã+_9 $("L$t7)L$D$ L$D$u,ƒL$ $1_9L$T$T$T$r UL$ $tËL$ $x `tD$$9_9D$L$舙[=HUuD[HU=T?_9$$P8$P@$PH<$$D$ق 0< _/0<Q_9m-<$m-D$衂  $R T<D$$f_9D$<D$谘<D$$r_9D$<D$茘TÉ$B@P ` $Izà ` $L$ L$yÃ@\$D\[# $K,L$KL$K L$ KL$KL$ L$KL$KL$ KL$$K L$(K$L$,K(L$0K0L$4K4L$8K8L$ t(D$D$$wD$$wD$$É$C@ˉ$D$ D$)g\$T$ tN t8L$ tD$D$$Gw떋D$$D$@@Չ$B@ tC$B@Ћ\$(L$0 $ \#L$L$L$*u1(ËL$ $D$!r} ((ÉD$$$dL$$D$u $ǝ(ËD$@%u1 $襝D$$gv`$\#D$k1(ËD$$>v$LaD$uD$$$O1(ËL$$ $L$L$&D$~N1;\$\$ R\$  $r\$uk tUD$D$$uD$$$ҜT$|$}$t t (É$B@Ѓ(É$C@랉$D$ D$d\$ T$ tQ t;L$ tD$D$$ufD$$D$@@҉$B@ tC;\$D$$t$B@Ћ\$ Ӄ8L$@ $&\#L$L$,L$L$(L$ L$4L$L$$L$L$0L$3(u18_D$L$, $L$(L$L$4L$L$$L$ L$0L$zD$ D$$_T$ } 8É$)8ÃL$$ $2\#L$L$L$'u1d_D$ L$ $?D$D$ $_T$u É$BD$D$$sD$ÃL$$ $9\#L$L$L$#'u1^D$ L$ $D$D$ $_T$u É$D$D$$sD$Ã\L$d $A\#L$L$L$L$XL$ &u1\ËL$X $L$L$;u1\9^D$L$ $L$L$؇D$D$$W^|$} \--\Ã\L$d $J\#L$L$L$L$XL$ %u1\ËL$X $L$L$u1\]D$L$ $L$L$~D$D$$]|$} M\--\ÃL$ $T\#L$L$L$e%u1$]D$ L$ $"D$D$ $J]|$} --ÃL$ $]\#L$L$ L$$u1ËD$ $~1Ã(L$0 $e\#L$L$$L$L$ L$ $u1(ËD$ @@T%]L$ $W]øED$uW$\#D$8f1(ÉA1D$|$u1(19ډ\$}|L$ $T$T$D$ЉD$ L$ $\#L$T$\$ L$#\$T$u)D$$p^$\#D$e1(B9ډ\$|L$D$$$D$D$5D$$o2(Év1ډ\$t $n\$D$ @@T%tL$ $P øaD$^$n\#D$d1(ÃL$ $\#L$L$L$"u1ËL$ $ƒu VÃD$ u T$ $Á$ $\#L$a"u 1ÍL$ $L$} ÍL$ $-w à L$( $\#L$L$L$L$L$ !u1 YD$L$ $L$L$niD$D$$YT$} a É$ Ã(L$0 $\#L$L$$L$L$L$ L$L$l!u1(+YD$L$$ $L$L$L$L$D$ D$$AYT$ } (É$r(ÃL$ $\#L$L$L$ u1XD$ L$ $GD$D$ $X|$} g--à L$( $\#L$L$L$L$L$ w u1 6XD$L$ $L$L$D$D$$TXT$} É$腣 Á$  $\#L$$L$u 1WD$ $ $L$L$L$P$D$ $W$} TÍL$ $t à L$( $\#L$L$L$L$L$ ]u1 WD$L$ $L$L$}D$D$$:W|$} ËL$ $i Ã,L$4 $\#L$L$(L$L$L$ L$$L$L$ $L$L$!tv}VD$D$$D$(D$D$D$D$ D$ D$$D$D$$VD$ u D$s ,ËL$ $L$ L$,1,Ã4L$< $\#L$L$0L$L$,L$ L$ L$u14$L$,L$q D$|$u14UD$L$ $ D$L$0 $L$L$L$,L$L$ L$ L$$L$D$(D$$UL$(}+L$ t 4ËD$$D$@@;L$,tD$$L$SD$4Ã0L$8 $]#L$L$,L$L$L$ L$(L$L$ L$u10TD$L$, $L$L$L$(L$L$ L$ L$$L$/D$(D$$T|$(} Q0ËL$( $0Ã,]#D$$D$ L$4 $]#L$L$(L$L$$L$ L$ L$Gu1,TD$L$( $L$$L$V#D$D$$$TT$u ,É$]#L$L$$L$L$ GtL$ $D$ D$IIL$ȃ,ÃL$$ $!]#L$u1]SD$ L$ $/_D$D$ $S|$t ù']# $L$L$L$L$Á$$, $,]#L$L$ L$L$L$ u 1$ÍD$$$D$6]#D$D$ D$ nL$$ $L$6L$lD$} d$ËL$ $<D$L$ $,D$ L$ $L$L$L$ L$Z@L$;D$t $Ӎ $É $迍 S $$,I L$L$L$T$ta-$ u$B@ރ D$L$( $<]#L$L$L$L$L$ u1 Ã|$t D$u T Ã|$t D$tRQD$T$tBL$ $L$L$D$D$$dQT$} É$蕜 1뾃L$ $H]#L$u1O]#$E1ÃL$ $}]#L$L$L$u1PD$ L$ $RD$D$ $P|$} K--Ãl$1ۉtP\$ u(L$ $T$ L$谣l$\$ T$u't/El$B uEt E9uBЃÃuBB'tB1rBEl$B ]4L$< $]#L$L$0L$L$$L$ u14$ND$u14ËL$0 $T$D$0u t 4É$B@D$0D$(D$0t L$$ $L$0 L$脢D$0uD$($JcD$4ËD$0D$,$L$$L$`D$0L$, $k \$u( tD$0$b14É$C@$D$D$RBL$ t4L$ tD$0$b14ËD$$D$@@ًD$$D$@@D$0 R^# $71L$p7L$D$ L$mu ÉD$$$X^#D$`D$D$$^^#D$D$}D$$d^#D$D$}D$$l^#D$D$}D$$s^#D$D$v}D$${^#D$D$X}D$$^#D$D$;}D$$^#D$D$}D$$^#D$D$|D$$^#D$D$|D$$^#D$D$|D$$^#D$@D$|D$$^#D$D$|D$$^#D$D$i|D$$^#D$@D$K|D$$^#D$D$-|D$$^#D$D$|D$$^#D$D${D$$^#D$D${D$$^#D$D${D$$^#D$ D${D$$^#D$ D$y{ à l$(\$$u-- =X SBSA $ՃD$u ËL$$ $GT$u t1 É$B@$D$D$D$,Ћ\$$1ҋC9‰T$ RSщ $L$(L$L$,L$L$0L$ L$4L$T$u t1 É$B@$D$@D$L$D$,Ћ\$$T$BC9‰T$x=Su-K $g D$D$$D$@D$D$D$D$,ЋD$ 1=L$4L$0 $ՉD$|$L$$ $D$D$$D$D$D$D$,ЋL$$I $jf D$D$$D$D$D$D$,Ѓ|$0u1L$$I $膔D$D$$D$D$D$D$,Ѓ|$4u1L$$I $ND$D$$D$D$D$D$,ЋD$ Ë@Y$*D$R1 Ãt$l$Ef9} Mf9} E=}M $NL$ËEN9} ËFM9} 1ۋE9}C [Uщ $\$ [VщL$Ut$l$\$ tCE9|1Ã\$ T$9u1ÃttK $JL$øÃs1 $m\$ ƒD$tXL$H @ЃÉ$裿T$D$@$苿D$$@iÃ8\$@T$DD$4D$0D$,|$<$T$*L$-L$ s1L$L$T$tL$$I u(4Ѓ ø"$T$*L$ -L$ >T$볃 \$(T$,D$|$$u\$T$*L$,-L$ s1L$L$$L$=T$tL$$I u"Ѓ ø(4$T$*L$0-L$ y=T$볃 |7 $L$L$L$L$軫 Ã8^$D$ D$KÃDD$@D$<D$8L$H $L$LL$L$PL$-L$ L$@L$<T$<tfL$@ $D$@-L$|$Tu_L$ L$L$L$8L$蝩t*$L$TL$ƒt L$8JЃDÍD$$$1T$<럃L$ $L$L$*L$L$ ÃL$ $L$L$*L$L$ Ã$D$ L$, $L$0L$*L$<-L$ L$L$;u1$ËL$ $豃uW$%*D$rI1$ËL$ $pƒt4=u\T$$;pT$t=$L$D$ |$ u aItD$ $ø*$$^=u6T$$pT$t$L$ND$ 뛉$!=SuL$( $L$躀D$L$( $D$L$\$D$($薮D$ |$ iL$( $L$ L$L$L$9D$ tD$ $D$ |$ (|$D$@@D$ $WT$L$ AD$ @t$D$ @$ЃD$D$ D$bT$ t)L$( D$($D$(@@$B@ʹ* $L$(L$*L$c8^$L$L$d@T$L ?$B@/ $B@Ћ\$T$L$9t(8^$*D$L$D$ G1øà D$@;D$t%8^$.*D$D$D$G1 ø ÃT$$T$T$h\$t`t$T$RT$IuCD$ |$ u ?tD$ Ë8^$V*D$D$D$G1뾃D$@D$|$tT$$T$ T$1D$uh?L$D$u3L$L$ IT$Rщ $ L$v*L$t|$ȃût;\$}\$ [\$[ډ$ T$x*T$\$ t$[\$[ڃ$L$$ы\$ u 1뒸D$$D$D$(D$L$ZT$R$L$$уL$AD$ $IT$w\$T$t D$ S$T$z*T$t$T$R$T$ 1tK|$uzT$R0$T$*T$MtT$RH$u 1ȃËT$R`$T$*T$t͸ȃ|$uËT$R0$T$*T$t)T$RH$T$*T$u 1hT$R\$[ڃЉ$ T$*T$^T$R\$[ڃ$($D$*D$L$ 1L$AD$ $%T$Qt |$1tD$Ѓ)ЃXL$u;L$D$Ѓ)Ѓt%L$ $D$*L$ȃÃt|$~;\$}tމ\$ [\$[ډ$T$*T$\$ t5[\$[ڃ0$ T$*T$\$ u 1끍[\$[ڃ$i1\$ tԍ[\$[ڃH$q\$ t묋D$$D$*D$L$T$R\$[ڃ¸$T$*T$t5T$R\$[ڃЉ$ T$*T$u1l$KT$R\$[ڃ$tϸʋT$R$T$*T$T$R$10T$R0$ T$*T$>sT$RH$XPL$AD$ $T$p\$T$t D$ S$T$*T$t5T$R\$[ڃ$T$*T$nu,1t|$tȃËL$I $ω$D$*D$L$ 1BL$AD$ $,T$o\$T$Zt Lt %S$T$D$t(T$R$T$D$ouu1t|$-|$} L$ $L$*L$ȃúL$t;T$}T$ RT$Rщ $ T$ BыT$R0$ pT$R\$[ڃ$T$*T$7/K $ R1L$ $GL$L$*L$ ÃL$ $RL$L$*L$ ÃL$ $-L$&L$*L$ |Ãt$\$ V19*$1Í[N5)؃uI [Vу $L$D$Ńl$u*$+l$É)؃u׍[^ڃ$T$D$4t5T$ R\$[ڃ0$ T$*T$u 1mT$ R\$[ڃH$$T$*T$t‹T$ R\$[ڃ`$T$D$t뉃$)؃ [Vу $L$D$DL$ AD$ $T$t$l$ t /1ƒu1Ã}J*$1ËE$= u?1ۉ\$ vM@xt ؃9~t,$\$‰ЃÉ\$ [Uщ $gt$l$ \$ Ct[Mt9}\$ [Uщ $ L$l*L$ t$l$ \$ CM9E[M$<[M%؃9n\$ []ډ$T$j*T$t$l$ \$ t'[]ڃ$)t$l$ \$ u1ƒ u; vUу $ L$n*L$l$ u1L$M $l$ \$ Ct؃;D$Ot D$)؃}6&D$)؃D$v*$BT$\$ []ډ$ T$r*T$Sl$ \$ t'[]ڃ$1l$ \$ 1ƒMD$)؃>[M'\$ []ډ$T$t*T$l$ \$ t#[]ڃ$c'l$ \$ u 1ƒV[M\$ []ډ$T$p*T$3l$ \$ t#[]ڃ$&l$ \$ u 1ƒ5,$D$VT$$LT$6\$t#$T$*T$V\$u61t C=MtK $MȃËK $ŃT$$OT$\$t#$T$*T$\$u61t C=PtK $\ȃËK $ŃT$BJ` $tAT$R$T$*T$tT$R$Ju 1ȃËT$R0$T$*T$:t͋T$RH$t뱉$L$*L$LT$BJ` $tAT$R$T$*T$tT$R$7Iu 1ȃËT$R0$T$*T$ct͋T$RH$%t뱉$L$*L$LT$BucJ0 $3tAT$R$T$*T$tT$R$$u 1ȃø$L$*L$U돃T$BucJ0 $$tAT$R$T$*T$JtT$R$1$u 1ȃø$L$*L$돃T$BD$$ L$_T$\$tuK $L$7ȃÃuoS$T$*T$tT$R$\u1붋T$R0$T$*T$HtѸ̉$L$*L$eL$ $ L$)L$*L$ uÃT$$ T$Tt#T$$T$*T$tu61tD$P= u$ȃÉ$zŃL$AD$ $ T$t |$1|$} L$ $L$*L$L$tD$t|$ȃût;\$}\$ [\$[ډ$ T$*T$\$ t#[\$[ڃ$\$ u 1듸L$L$ IT$Rщ $ L$*L$A=T$R$KT$R\$[ڃ$T$D$T$BD$$L$*L$zT$tsB=t=uJ $0Iȃ=t=t=t=t=!t=#t="tD$*$L$뮃|$uD$8^$1*D$BD$/L$uT$$$T$ht'T$$T$\*T$1u1ËD$P=%t=&u$2Hȃ='t=(t=)t=t=It=tD$8^$j*D$D$.L$뤸mT$=Tu $É$ÃL$ AD$ $T$_l$ tL$1t|$tt;\$|ȃÉ\$[]ډ$T$*T$xl$ \$t#[]ڃ$-l$ \$u 1델E@=oU$T$*T$tT$ R0$12D$ @@,@D$ $*T$8tT$ $*T$u*D$*$4L$T$ $*T$ڝtT$ $*T$tT$ $*T$覝tT$ $*T$茝jT$ $*T$nLT$ $*T$P.T$ $*T$2T$ $*T$T$ $*T$T$ $*T$؜1YU$l$ ^V L$$AD$ $T${T$l$$t 1tȃ ËE@\$D$ =0C\$ IUщ $[T$ \$tt ؃;D$~ett;t;\$} [T$$Rщ $ L$*L$8YL$$ $\$*L$9\$[\$$[ډ$ T$*T$\$t#[\$$[ڃ$\$u1!}),$L$*L$CT$ \$[]ډ$#T$\$t#[\$$[ڃ$\$u11U$T$*T$T$l$$ T$$T$ *T$~t&T$R$T$*T$u1 ËT$R$=tރL$AD$ $T$T$t4tu*T$R$T$*T$T$u*1ttȃËL$I $mуL$AD$ $T$@\$T$t D$ bK $L$*L$st |$t|$_t|$tȃËT$R0$ T$-*T$tT$RH$u1봸T$R0$ T$#*T$tT$RH$uh1T|$IT$R`$ T$%*T$ztT$Rx$)u 1듋L$I $$D$'*D$L$ `W1UL$AD$ $TT$RT$t4tu*T$R$T$/*T$T$u*1ttȃËL$I $у T$$T$t#T$$T$5*T$u1 ËT$R$tT$BD$$L$dT$\$t#u$K $L$D$ȃÃuS$T$D$t)T$R$T$@*T$cu1륋T$R0$T$D$5tҸ͉$L$C*L$UL$AD$ $ T$htL$1t;\$|ȃÉ\$ [\$[ډ$T$R*T$\$ t4[\$[ڃ$T$D$Y\$ u 1yT$R$T$D$@8T$BD$$L$j\$T$tuK $ȃÃunS$t)T$R$T$T*T$u1붋T$R0$T$D$]tҸD$ W*$L$ iD$@D$L$uT$R$1t;\$|ȃÉ\$ [\$[ډ$ T$*T$\$ t#[\$[ڃ$\$ u 1델uT$BD$J $Wt @;D$|ȃÉ\$ [\$[ډ$ T$*T$\$ t#[\$[ڃ$\$ u 1늸 T$$T$>t#T$$T$*T$^u1 ËT$R$T$*T$ptԋT$R$&t븃\$C9}RKtHB܃ T$$BD$$\$$@K@= ЉT$ȉL$D$$T$>l$$\$t 1ƒt[M@0t9t[M@0uЃ Í [Uу0 $ك9L$u-[]ڃ0$T$*T$ u1뢋T$R\$$[ڃH$t׋T$R\$$[ڃ`$T$*T$t띉ك9L$U$T$*T$l$$\$|$t+T$R]ڃ$Pl$$\$[]ڃ$T$*T$l$$\$e]1T$BD$$L$*L$T$tBB=t&=tD$*$^L$ȃËJ $.7|$uD$8^$*D$BD$L$뵃L$AD$ $!T$tL$1D$ u<L$ tNT$R$T$+T$t$T$R$T$81t;\$|ȃÉ\$[\$[ډ$ T$#+T$i\$t,[\$[ڃ$T$\$u 1넸l+$L$ |$L$AD$ $"T$Ot<|$t |$?T$R$T$%+T$1D$ uL$ t|$_t|$tȃËT$R`$ T$D+T$.tT$Rx$ u1봸T$R0$T$A+T$tT$RH$ u 1X*+$eL$ /T$R$Q|$L$AD$ $#T$t8|$t|$u*T$R$T$F+T$1D$ u,L$ t_t|$ȃËT$R0$ T$f+T$tT$RH$l u1봸M+$DL$ 뎋T$R$5 XPL$AD$ $&T$t8|$t|$u*T$R$T$h+T$ 1t|$tȃËT$R`$T$p+T$t)T$Rx$ T$u+T$u1뢋T$R$ntۋT$R$%VT$R0$ T$n+T$2)T$RH$L$AD$ $'T$dt8|$t|$ u*T$R$T$w+T$1t|$ tȃËT$R$T$+T$kt,T$R¨$ T$+T$?u1뜋T$R$tۋT$R$+PT$R0$T${+T$#T$RH$;T$R`$ T$~+T$T$Rx$b L$$AD$D$ $(T$\$t 1D$T$$R$T$+T$\$l$$t1U$ T$+T$\$l$$1ƒT$t[MMt ;\$T$t ;\$t;\$|Ѓ É\$[]ډ$T$+T$7t%T$$$T$T$+T$u1롋T$R\$$[ڃ$ T$+T$tŋT$R\$$[ڃ0$t띍[M \$ [UыI $+L$\$l$$T$[]ڃ$ T$+T$1\$l$$t#[]ڃ0$\$l$$u 1ƒ[M=+Q\$[]ډ$J\$l$$t5[]ڃ$ T$+T$\$l$$u 1ƒ[]ڃ0$K\$l$$tѸ̍ [UыI $+L$訄\$l$$T$,$T$+T$t)T$$R`$ T$+T$u1 ËT$$Rx$tދU0$\$l$$T$R]ڃЉ$ T$+T$[\$l$$T$R]ڃ$!\$l$$h`@ \$l$$T$H+D$@M@=+tD$@MȋP8^$+D$T$0\$l$$T$D$ ؙD$|$D$ YQL$AD$ $+T$\$T$t<t S$T$+T$\$T$1t ttȃËC@0uKK0 $L$+L$tT$RH$ku1몸K0 $ L$+L$s볋K $'\$T$X>.L$AD$ $0T$T$\$tу1tC=AtOK $GT$t7u)T$R$T$ +T$u 1ȃËT$R0$tߋT$RH$T$ +T$QtT$R`$t뚃uS$u1끸L$AD$ $.T$bT$t|$ t=1t B=/tt J $ȃËJ $뾃L$AD$ $1T$tL$1t!L$I $t;\$|ȃÉ\$ [\$[ډ$T$+T$\$ t#[\$[ڃ$#\$ u 1델_L$AD$ $2T$t L$tx1t;\$|ȃÉ\$[\$[ډ$T$+T$A\$tT$R$;\$u 1똸T$R$phL$AD$ $3T$N\$T$tytuotBuJS$T$+T$tT$R$u 1ȃøuK $1뒃L$AD$ $4T$t L$ tq1t;\$ |ȃÉ\$[\$[ډ$^\$t#[\$[ڃ$\$u 1럸T$R$YwoT$D$BD$ $5L$T$u1Ã|$ Jt+t-t!tt9+$̸L$ȃùL$Q$+T$g|tRT$R$ +T$J|t51D$u8^$#+D$D$@D$ L$넸ƃzqQc$L$Z+L$8T$R$T$t T$R$T$u91D$ L$p+$蓷L$T$RR$b+T$3{u'T$RR$e+T${u낋T$RR$i+T$z\T$RR$m+T$z8믃L$AD$ $6T$tL$1t;\$|ȃÉ\$[\$[ډ$p\$t5[\$[ڃ$T$+T$\$u 1델T$R$e]L$AD$ $7T$tL$1t;\$|ȃÉ\$[\$[ڃ$!T$+T$\$t [\$[ډ$;\$u 1델T$R$e]L$AD$ $8T$tL$1t;\$|ȃÉ\$[\$[ډ$T$+T$\$t#[\$[ڃ$\$u 1델T$R$e]\$l$CD$ L$ uS$L$ыl$\$1ƒt;l$ |ЃÉhK;D$ t+l$ iSщ $L$$L$褾l$\$ƒt'l$ iSу $D$Ћl$\$ƒznT$$9T$Dt,T$$T$"T$#T$ u1øT$$:T$t,T$$T$T$T$ u1øL$D$AD$ $;T$艽l$\$tL$ 1t;\$ |ȃÍ [U t [U u7\$[]ڃ$kl$\$u 1뙸 [U 0t [U u롋U$l$\$JBL$AD$ $<T$荼\$tT|$ u6K t K u;S$\$t Ã|$ uS$u1K t؃L$D$AD$ $=T$l$\$t |$1ƒt ;\$t;\$|ЃËD$)؃t+$߰1ÃtԋD$H9}ˉ\$[]ډ$$T$+T$l$\$t#[]ڃ$l$\$u 1ƒ됸[M=B>C\$ IUщ $l$\$U$l$\$T$BD$$>L$蝺l$\$t Xt"EthtQtLt1ɉȃút9}T$ RUщ $L$*T$l$\$Bƃu 15[]ڃ$T$+T$[l$\$uN1bYE@=TuM $*6M $!뭃 tl,[]ڃ$T$=l$\$u+1M $\ЃuU$u 1T$R0$T$¸t׸҃uM $ L$蚸5uCU$zt T$R0$ T$`u 1D$ +$tL$ ,$AL$+L$Xl$\$T$JL$L$ +$l$L$|$uE@=Mt D$)؃}\t D$H9t%;\$tD$+$转L$ȃÍ [Uщ $ L$+L$ѷщ\$ []ډ$ T$+T$褷l$\$ t#[]ڃ$Gl$\$ u 1/M $PJ $l$T$JL$L$ $+$˫l$L$|$uE@=Pt D$)؃}\t D$H9t%;\$tD$M+$lL$ȃÍ [Uщ $ L$K+L$耶щ\$ []ډ$ T$I+T$Sl$\$ t#[]ڃ$l$\$ u 1/M $ PJ $l$L$AD$ $T$El$t<|$ t |$ %U$2T$v+T$莵l$1t|$ uȃËU0$T$x+T$Kl$t4UR]ڃЉ$T$z+T$l$u%1t|$ uMH $x֋U$l$FUR]ڃ$T$D$蝴l$|$ L$AD$ $T$ֳt|$ };11҃t;T$ |ȃÉT$ RT$Rщ $4T$B˸L$AD$ $*T$iT$t"tuT$R$T$ua1ttȃËT$R$T$|+T$至tT$R0$4u1봸뚃L$AD$ $)T$跲l$tT$1)уtE1t D$9|ȃÉT$ RUщ $l$T$ċU$T$+T$踲l$tUR]ڃЉ$ T$+T$脲l$]UR]ڃ$Ol$7/L$AD$ $T$觱l$t|$t1ËUR]ڃˆ$T$+T$l$tƋUR]ڃ $T$;l$tUR]ڃЉ$ T$+T$舱l$cUR]ڃ¸$Rl$=UR]ڃ$-L$AD$ $T$艰l$t |$ 1‹E@M@=u4tUR]ڃ$tu 1ȃøtUR]ڃ$pu1ʸUR]ڃЉ$l$YQL$AD$ $AT$襯\$t4tu*T$R$T$+T$\$ue1ttAL$ uL$ tȃËD$$D$+D$bL$ ֋L$I $K[\$[ڃЉ$ T$+T$X\$b[\$[ڃ$\$;3L$AD$ $/T$z\$t4tu*T$R$T$+T$Ǯ\$ue1ttAL$ uL$ tȃËD$$D$+D$7L$ ֋L$I $ [\$[ڃЉ$ T$+T$-\$b[\$[ڃ$\$;3l$ ED$1ۺ|$,$L$AL$+L${Ã|$~K1;\$}C[M=Ku'[Mȉ@uA@=PC;\$|tD$)؃KD$)؃~>[M=Ku@\$ [Uщ $t D$@;D$uȃø+$諡1@\$ [Uщ $L$+L$踬l$ T$\$t )؃t )؃t+$:1u[]ڃ$&t5T$R\$ [ڃ0$ T$+T$+u 1T$R\$ [ڃH$$T$+T$t‹T$R\$ [ڃ`$t뚍 [Uу $n$D$)؃ua\$[]ډ$$T$;+T$dt#T$R\$ [ڃ$u 12>+$ܟ1]+$ȟ1\$[]ډ$l$ \$t5[]ڃ$ T$+T$踪l$ \$u+1ƒD$t3 T$l$ \$и+$)1ÃL$AD$ $KT$Ʃ\$T$t&t S$\$T$uy1ttYttȃËS$T${+T$֩tT$R0$u1븸K $詻럸낃_rL$AD$ $BT$T$\$mt _D$ *C tYt1ɉȃÉ$T$+T$轨t T$R$T$Zu1뵸$T$+T$qtT$R$u 1oT$R0$ T$t׸ҍ RSу $L$}+L$;|$ L$I $$$D$+D$货L$ 1L$ $CL$tL$+L$ <ÃL$ D$AD$ $DT$ t$l$\$ t 1ƒuu +$1ËC$T$+T$t&T$ R$T$+T$u1ËT$ R$T$+T$ϦtыT$ R0$T$+T$覦t룃uAC=0uK $CȃËK $ L$+L$XًC t9l$ iSщ $ L$+L$ t$l$\$ ƒtVE)t$ tJhK=0u)l$ iSщ $t$ l$\$ ENtuЃÉ iSщ $6K $?t$\$ ½)D$@D$T$$T$+T$ߤ1D$ u2L$ tPt#L$I $ L$+L$Ӥt|$tȃËL$I $sL$ $L$+L$M뎋T$$ET$UML$ $FL$L$+L$ 蹤ÃT$ BD$$HL$董l$ 1ۉ\$D$ $|$tE@  C\$ IUщ $l$ \$t D$)؃}mD$ t|$ uȃËD$H9u) [Uщ $ L$8+L$b;\$tD$:+$L$막\$[]ډ$ T$+T$l$ \$t#[]ڃ$l$ \$u 1tE@=PWt E|$o[]ډ$Hl$ \$t9[]ڃ$ T$+T$Ml$ \$1t D$)؃} D$ v\$[]ډ$ T$4+T$l$ \$t#[]ڃ$l$ \$u 1끍[]ڃ0$ T$6+T$莡l$ \$t[]ڃH$1l$ \$t뚍[]ڃ0$l$ \$D$ +$Εl$ \$L$E@H=PEU$l$ \$t-U$ T$+T$趠l$ \$u 1U0$Xl$ \$t܋UH$聲l$ \$t뼋U$l$ \$tU$Gl$ \$u 1L$AD$ $T$耟t|$ }J1t D$ H9|ȃÉT$ RT$Rщ $L$3T$B뿋T$R$tT$ R\$[ڃ$D$sk\$tuȃËCD$D$ =&=B=tv= It;=t(=t+$蚓1ɋ\$ 냉$$$ȳ= t= u$軵뼉$밉$脷=t0=t=v${v$.g\$$T$+T$t&T$R$T$+T$u 1=td=\$$T$+T${t&T$R$T$+T$蓝u 1\$$T$d+T$"T$J tJ u=D$t BD$ @|$5n+$L$J tJ tJ t1뚉\$$T$+T$pt&T$R$T$+T$舜u 1=tx=At0=t=a$޽a$ǺR$EC=t="$-"$$=#At0=!t="$$[$4=$t=%$茟$m$}=8! =2tx=)At0='t=(5$5$&$=,t=0$$躢$=5At0=3t=4$K$$=6t=7o$o$`$Q=>tx=;At0=9t=:$u$ $=<t==$$$b=IAt0=Ft=G$$$@u=Rt=TT$DT$עEL$ $D$|$u 1tD$ø+$褍l$EHD$|$|,T$R]ډ$D$/l$11҃t;T$|0L$ uL$ tȃø+$%L$ RM= u$T$ RUщ $Il$T$B댉T$ RUщ $L$D$l$T$ɸJ \$CuS$u.1D$|$u tD$ ø+$]̓$D$ D$D$L$, $7+L$s1L$L$L$ a\$t;JÉD$u#uD$ $ u$C@C+ $L$L$L$\$t$D$D$\$豅\$t4F+ $ aL$D$D$\$T$D$ tG t-L$ GD$$D$@@Ћ\$+$C@Ћ\$‰$B@Ћ\$먃(H)s1+ $ %L$D$D$ L$8^ÃD$$u(Ãu#+ $D$D$\$$ƒ8^u($+L$T$t(s1D$$$+D$s1D$s1D$$$+D$s1D$xD$$$+D$1D$D$$$+D$h'D$D$$$+D$xYD$+ $kD$ $+L$OD$L$$ $ +L$6aL$$ $ +L$l$aƉD$t u`uAu&L$ t(ËD$ $D$ @@uщ4$F@ u$C@Ћt$MEu,$E@Ћt$a{m,$s1L$t$\$ D$$t$l$aƒ3&$B@Ћt$l$a =Pt> W $B }!D$$/D$!D$ N/ $B } N/D$$/D$ N/D$\`6 $A }\`6D$$/D$\`6D$aÃ,D$0$\$D$$|?0\$-\$$|?0L$$$)|$fD$l$\$l$L$ȃtdtGt$/\$$D$0\$xL$,D$$ 8 "$\$"L$$$\$d$$ "$\$떃t&uD$$8 "$\$kD$$0; "$M-#\$D\$ \$1\$vC I|,D$ L$9\$ D$L$ͼ;\$I}D$ t$1Ƀ }D$ t$9\$ D$t$ͼ;\$A҃PD$T$D$i_D$T$J\$TuVt$TPD$T$$\$TuY\$TvVrP3\$Tr*D$T|$fD$l$\$l$L$͘1PD$T$9\$HT".\$Hv5t$T\$@D$@$D$~t VD$@P6\$Hs<\$TvD$T$=#PV$PD$Hl0+\$8D$Hl0+D$8d$H\$ D$ %l0+\$0D$0 't$8\$0\$TD$H$\$D$8$B\$D$H$H%"t$HL$t$\$@D$0L$@l$@\$@>6\$HvMD$8$D$H 8\$|$@\$@D$@$D$!t VD$@PD$8$D$H5|?0X8\$c\$(D$(|$@\$@D$(|$@\$@D$8$a\$D$H$t$\$@D$0L$@D$@\$@>6\$Hv'D$8$D$H 8\$L$@\$@,D$8$D$H5|?0X8\$\$(D$(L$@\$@D$(L$@\$@D$8%l0+\$ D$ d$H\$0"D$T$膸u\$TrVMPD$TPÃHD$L$D$貸D$L$.D$L$\$Lu|?0\$LD$L$\$8T".\$8vD$8$8-#H\$LD$L' 8$\9D$L 8\$0D$L$\$(D$($%'D$0\$@D$@$D$踷t VD$@HD$8' 8$\9D$8 8\$(D$8$U\$ D$ $Q%'D$(\$ D$8$7\$D$8$\$D$$\$D$$\$"$d$d$d$ \$@\$LrV$蜶HHD$L$?tD$LH$mHÃ0D$4L$4\$(\$ Pu4\$1Ƀ}&D$(L$ t$|?0\$ l$\$A|ڋVD$d$($D$ L$45/\$D$VD$0Ã`"\$dw`D$dL$d\$X\$P0\$H\$@\$8D$HD$X\$0\$(1Ƀ2}xD$HD$P\$P|?0D$H\$HD$HD$X\$ D$@\$D$ L$@D$PL$8\$@D$\$8D$0\$D$ L$0D$PL$(\$0D$\$(A2|VD$d$X$D$@t$0L$d5/\$D$VD$`ÃD$$utD$D$$T\$Dy3\$vD$$D$$\$\$s d$D$\9D$$tD$D$$\$Dy3\$vD$$-B1D$$\$\$sD$|?0d$D$$uBD$$`-D$$D$貳D$$D$蕳tR$D$\$:B1u;$D$\$h;$D$\$X;$D$\$D$$D$u$\$tD$$D$\$$D$\$葹B1u$D$\$sxy;$D$\$Y à D$$D$yuD$$t@D$$tD$ \$sD$ V蟱 \$sD$$  V\$u$轱-# N à D$$D$軱uD$$;t@D$$*tD$ \$sD$ V \$sD$$z  V\$u$-# 萰 à V WD$u $z6D$轨D$ Áu;D$$QB1s D$΋W$z6D$t뵉 $蜯뫃D$ $E\$\9\$u舨]VSSul= $BD$$D$$\$ L$ $舷|$fD$l$\$l$L$) SD$ $ttLD$$cu7 VtD$ $uD$ $B11D$ $D$~ VtD$$D$_uD$$߮t1z|$(t gT$z6D$S11ÃD$ $ND\$\9\$uVSSul= $AunD$$D$$\$ L$ $|$fD$l$\$l$L$) S=VtD$ $6uD$ $@1ËT$z6D$S11Ã8L$< $L$DL$L$L$ L$4L$L$0L$覢u18ËD$4$C\$(D$0$C\$ \9\$(\9\$ VSSul= $?8D$($D$ \$D$@\$L$ $蘴|$fD$l$\$l$L$) SD$$脬t]D$($suD$ $bt41Ƀ VtD$$uD$$?818ùD$$D$} VtD$($D$^uD$($ޫt1wD$ $D$-uD$ $譫uϹCT$z6D$ϣS18b18à L$ $ML$D$# à L$ $>L$D$ à L$ $LL$D$ à L$ $tL$D$ à L$ $LL$D$ à L$ $D8L$z6L$ à L$ $L$D$J à L$ $IL$D$& à L$ $ L$z6L$ à L$ $cCL$D$ à L$ $=AL$L$ ÃL$ $D7L$0ÃL$ $7L$à L$ $IL$L$[ à L$ $L$L$6 à L$ $IL$D$ à L$ $L$D$ à L$ $=L$D$ Ã1ҋD$(ۋD$ 9}|7u x_$z6D$ËD$D$(1ËD$;T$$uHى\$ $ \$ƒtT$$D$$D$D$ D$:\$T$u$ى\$L$e \$UxDŽ$lDŽ$`DŽ$\ D$DD$@\$0\$($ $$p$pu 1xËSSul= $9$p $$`tnL$ $W$p|$fD$ l$ \$ l$L$ ) S t$D$D9D$@t D$@$ $lxÉ$B@\$0tED$($tW${6D$"YD$0$8$lA\$ KًT$@\$ ~ZD$ ݜ$TKًT$@ݜ$L݄$T܄$L\$ D$ ܤ$T\$݄$Ld$\$\$t~r\$v~ًT$@@#sfD$ |?0ݜ$LD$ ܄$Lݜ$T݄$Td$ \$݄$L\$u ݄$T\$ D$ $7$l4\$s܉ًT$@@#vq$t$I:$tݜ$T K݄$T\$81뉬$h;$`$dL$@ݜ$L݄$L$\$݄$T$$h$d\$s*݄$Tݜ$D݄$Lݜ$T݄$Dݜ$L݄$T܄$L\$ D$ ܤ$T\$݄$Ld$\$\$tD$E$hT$@D$ ݜ$TC;$`艬$`ܜ$T݄$T$D$胣uv݄$T$$`u[;$\|3L$@ $T$L$DL$$\L$ $`<݄$TB$`T$@D$8$D$uD$8$ttAD$8$D$ʢt D$8D$(\$(D$8D$0\$0DŽ$`W$z6D$_$B@T$z6D$3$pS t 1xÉ$B@,T$4B=@M-<J $@M-L$> T$4$RD$$|$$u|$$}W$S{6D$莙1,ù $D$ u1,D$(D$(;D$$|L$( $\$ u t1,É$C@$D$D$\$ T$D$ t9|$t tL$L$ D$(D$(;D$$~ȃ,É$C@׉$B@Ћ\$ 1,B\$ D$ $D$辠uD$ $>tW$*{6D$j1,D$ $\$ uD$ $u1,ÉD$$T$D$$ U$B@E L$ ${6L$D$F ÃD$$$\5\$\9\$uD$$]uD$$D$賟t)D${6 $D$\$L$L$ [\$tˋSSul= $1uJD$$D$D$\$L$ $誦|$fD$ l$ \$ l$L$ ) SfT${6D$ΖS11Ã4L$< ${6L$L$,L$L$ L$ Tu14ËD$ @@T%u1D$ @@T%u^${6D$F14ËL$ $L$L$fD$ud|$t|$D$\$,t.D$,$D$uD$,$L$tt\$$u\$,D$D$$$D$zD$$D$]uD$$ݑtk1\$s t D$$\$,6D$$$\$u \$,t$D$$\$襘\$,D$$Y\$D$$|?0\$B1PX]UD$$D$膑D$$$B1u \$,k\$sD$$$B1wX\$vD$$$B1r \$,d$\$,\$$VD$\$,D$$D$轐D$$9VSSul= $"D$$$D$\$\$,L$, $—|$fD$l$\$l$L$) SD$,$D$uD$,$蕏 D$,$耏tVD$,$D$Ǐ\$$uVVT$R|6D$VS1<艇1<ÃD$$$\$\9\$u RuD$ (($!1ÃD$$c$\$\9\$u uD$ 1$6!1ÃD$$$\$ \9\$ u u D$ $D$L$ $͉1ÃD$ $#\$\9\$u mu(D$$D$3D$ L$ $r1Ã?}6 $$L$3L$D$ L$輛D$uxy;$0 D$D$$D}6D$D$D$辪;$ D$D$$G}6D$D$D$菪뜃$-D$L$, $L$0L$I!L$ $L$ L$L$L$L$2wT$(u1$É$D$Ѓu1$@@@D$ L$H D$L$ $T$ BBu t1$É$B@Ѓ$ÃD$$5T$BB BuhBu=Bu$BЃËJ uB$B@@ЋT$ˋJ uB$B@@ЋT$렋J uB$B@@ЋT$rJ ZB $B @@ЋT$@J $B$B@@ЋT$ T$Bt!J $L$L$D$ЋT$t ËB t!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 Ã$T$(BumJ $T$(Ńu1$ËB =-9l$ EZrZjt u$C@ЋT$(BtBBZJJu`$JL$u1$ù $L$(IL$D$D$*o T$D$ tD$$É$B@ u$C@ЋT$(놋J $JL$L$裰 T$(u1$Ã@ $C@Ћl$ T$(J $l$ l$D$~l$ T$(ƃMEt1$É,$E@. $2l$ \$u1ÉhEX D$$n1D$ÃD$$1T$J t/J t $R3ËB $B @@ЋT$݋B$B@@ЋT$뺃 T$Bt!J $L$L$D$ЋT$t ËB tJ $L$L$D$Ѓt 1 Ã$D$(hEu4l$ M $l$ ƒu1$ËE =-uz]UL$(I $l$ ML$L$誮 L$ 1$ËAD$AAtQA tD$$É$B@M $T$T$D$zl$ T$Ã\ t1$É$B@" $0\$ u1@ @XD$$h/D$ÃT$BuJ $T$BBuBËBT$\$ C 9}X؃ËK $^l$ Ãu1E L$X˃l$Et!M $L$L$D$Ћl$t1ۋE 9}E@t0ډ\$ I $L$L$D$Ћ\$ l$tCE 9|EtM $L$L$D$Ѓt1ÃT$ t B="tu u$B@uڋBD$B tT$뮉$B@l$EtUE tl1E 9}6@t!Xt$ @ t FE 9|ʋME $'1É$C@Ћt$ l$ˉ$B@Ћl$냃D$$-D$$FD$$&/ÃT$B 9|6J $T$ÃD$u1ËJ t6ZB J $J L$u1ËD$@ ȃËB$B@@Ћ\$T$믃 T$BtJ $L$L$D$Ѓt 1 Ãr8 $-\$ ƒu1ËCKJK J BT$$,D$ÃL$ $yƒu1Ë@=r8T$J $r8L$I T$r8 $,T$D$ |$ u#uD$  u$B@$T$ BBu$j-T$D$ B B$'+T$딉T$$T$D$ {L$ $!L$L$L$ L$L$ wu1ËL$ $ÃL$ At $l/ L$ AtQA t1É$B@D$$*D$$D$$j,Ã(D$ L$0 $!L$L$L$L$ L$ i7u1(Ã|$ }W$!D$y1(ËL$ $b D$u1(Ã|$ u(ËL$ $F\$u t1(É$C@D$$!L$轫 T$t$$kT$t$ÉD$ ut1(É4$F@^ l$$;l$ }U$ʔ!L$D$t$l$$Ãut1(É4$F@X El$$;l$ |(É$B@Ћt$\$Zt$D$(=$ .uӔ! $L$0L$vL$, $۔!L$L$L$ L$L$stu1$ËL$ $D$ u1$$l\$(T$ D$u t1$É$B@$D$Ћl$\$ u8 tMEt1$É,$E@$C@Ћl$щXh @$1$ÃD$$'T$B u=Bu$BЃËJ uB$B@@ЋT$ˋJ uB $B @@ЋT$렃 T$Bt!J $L$L$D$ЋT$t ËB tJ $L$L$D$Ѓt 1 Ãl$M $ƒtND$@u L$I $T$T$oT$uЃ t1É$B@ut ,` $cwtkzL$I $+lu1ËL$I $zl$u1ËUEE ,$B@Ћl$1Ã(D$,=3u! $L$4L$sL$0 $!L$L$L$ L$$L$L$ L$wqu1(ËL$ $T$,D$u1(É$D$Ћ\$ƒu t1(É$C@D$$L$$JZ BЃ(1(ÃD$$%T$Bu=B u$BЃËJ uB $B @@ЋT$ˋJ uB$B@@ЋT$렃 T$B t!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 à D$$@ D$D$@@pD$ L$ $D$ Ћ\$$ƒu1 ËCuЃ ËK $T$T$D$)u(L$ t1 ËD$$D$@@D$$舰 \$T$D$ t?|$uD$$@؃ t|$?1 É$C@$B@Ћ\$밃(D$,= 34u! $L$4L$MpL$0 $'!L$L$L$ L$$L$L$ L$nu1(ËL$ $T$,D$u1(É$D$Ћ\$ƒu t1(É$C@D$$L$$JZ BЃ(1(ÃD$$N"T$Bu=B u$BЃËJ uB $B @@ЋT$ˋJ uB$B@@ЋT$렃 T$B t!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 ÃL$ Q Au1É$B@pЃu1ËL$ I $D$D$D$~\$u t1É$C@D$$ \$T$D$ t;|$ ~؃ t|$ u D$ @1É$C@ۉ$B@Ћ\$봃HD$@D$!D$D$ @D$$JT$ t1(É$B@T$X E;l$sL$ $, |$,T$t$ŃD$u t1(É$B@19}--H C9|<$D$Ћl$\$u8 tMEt1(É,$E@$C@Ћl$щX L$Hh(1(ÃD$$T$B u=Bu$BЃËJ uB$B@@ЋT$ˋJ uB $B @@ЋT$렃 T$B t!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 ÃD$ @D$D$ p|$u1Ët$1;|$}cD$ @ |$@ $@@pЋ|$t$Ńut1É4$F@X h t G;|$|É$C@Ћ|$t$ދL$ $) ƃD$u11;l$}D$ @ l$@ $@@pЋl$t$Ãut1É4$F@X E몃$D$L$, $L$0L$!L$6L$ L$L$L$L$g1u1$ËL$, $B* T$(u|$|:$D$Љƒu1$ËD$L$JL$J Ѓ$D$뼃D$$T$Bu$BЃËJ uB$B@@ЋT$˃ T$BtJ $L$L$D$Ѓt 1 ËL$A u1ËA ~I AAÃL$I $\ \$ƒu1ËC u@! $щT$ L$XY T$ D$ tD$É$B@빚! $щT$ L$K L$Y T$ D$뷃T$ B u^$!D$y=1ËJ $WÃ,-D$L$4 $wT$8D$tB=\4L$ $& D$ u1,1;l$l$$T$4@ $Ul$$ÃuW ^ $>T$ t$^$!D$D$$@D$KDT$ t1,É$B@T$ X E;l$sL$ $>& |$0T$ t$ŃD$u t1,É$B@19}--H C9|<$D$Ћ|$t$l$\$ u8 tMEt1,É,$E@$C@Ћl$щXpp hx,É$BiL$8 $!L$ D$tL$8 $6^$!D$P;1,ÃD$$mT$BuhBu=Bu$BЃËJ uB$B@@ЋT$ˋJ uB$B@@ЋT$렋J uB$B@@ЋT$r T$Bt!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 Ã\$ CD$k|$u1ËC u1ËE$l$ED$D$;D$}ICL$@ uRC{L$p L$x tD$D$;D$|É4$F@Ћl$\$ ׉D$ $荓l$\$ ǃuK C t\9t$ l$\$ uFC{|$CL$@ P4$F@Ћ|$l$\$ 4C MEt1É,$E@L$ $" \$ ŃD$u1D$D$;D$CL$@ uCsL$p D$ƉD$ $胒\$ l$ƃuK C tX{8|$ \$ l$uBCst$CL$@ u<$G@Ћt$\$ l$pC MEt1É,$E@p$U-D$4D$$ .D$3D$ 34D$$0D$(#D$,0"D$09D$43D$8#D$<#D$@4+D$D.D$H0/D$L>1D$P`l/D$T>#D$X|)D$\D$`H)"l! $|A9L$1L$D$ L$LD$hup1Ƀ|thL$lL $ }pËT$lLI $.L$\$l‹DD$h$@D$DD$[L$lA|u" $ }pùr8 $ }pù. $ }pÃpÃD$p< $`7 D$u1$W+T$D$u t1É$B@D$ XtU\$ $H ƒL$ $T$T$/\$ T$ uL$ $hH t$l$E A El$-H -L$ I $zt$l$E A L$H &5T$t t1É$B@ЃÉ$B@Ћ\$ NuJL$ t(L$ t1ËD$$D$@@D$$D$@@ u$B@렃L$ $ugu1ÉD$$L$L$&{T$u t1É$B@ tjL$ $F WuFD$} $$D$D$D$;;1É $$D$D$D$;މ$rÉ$B@뉃L$ $T u1ÉD$D$$ET$D$ u? W$/$D$D$D$:T$ t1É$B@ tL$ $É$B@$=(D$u1KtJ$ƒtHL$ $T$T$,T$u+ u$B@u*D$Ãu-L$ t 1ËD$$D$@@ uʉ$B@뽃C$ $6L$P-L$D$ L$GuÉ$ D$=pWup<$P"D$@ D$$G$D$p<D$SpWÃh"$ͷ-D$]/$W\$ D$ $h"$ַ-D$)$\$ D$ $kh"$-D$$\$\$ D$ $3h"$-D$$\$Y\$ D$ $h"$-D$$|?0\$\$ D$ $h"$ -D$K$\$F\$ D$ $h"$-D$$\$ \$ D$ $Lh"$+-D$$|?0\$\$ D$ $--Ãa6\$ u$h"$<-D${4øh"$C-D$W߃L$\$ SSul= $L$u?t$\$ L$ $>|$fD$l$\$l$L$) SD$ ÃSSul= $0uBd$=B1\$ L$ $#>|$fD$l$\$l$L$) S]T$g-D$G.Sa6Ã)|?0d$=B1\$ T$J-D$-Sa6ÃL$\$ SSul= $FL$uvu?t$\$ L$ $6=|$fD$l$\$l$L$) SD$ ÃuD$$L\$ 봃u|?0d$=B1\$ 뙋T$-D$%-Sa6ÃSSul= ${uEd$=B1\$ L$ $n<|$fD$l$\$l$L$) SD$ ËT$-D$,Sa6ÃSSul= $u?t$\$ L$ $;|$fD$l$\$l$L$) SD$ ËT$-D$+Sa6ÃSSul= $UuAD$L$\$ L$ $L;|$fD$l$\$l$L$) SD$ ËT$Ѹ-D$m+Sa6Ãڸ- $[4L$D$D$ L$$AuÉ$]} D$- $D$D$2\tD$$-D$L$Ã$--à 1$h"D$Ã$1$h"D$--Ã$=Stl=$D$ø?1$d1 $.L$D$D$ L$?uÉ$)| D$k1 $D$D$1[tD$$x1D$L$wÃL$ $0Nƒ}1ËD$Á8$@ $8L$yL$$4L$ $0L$$$L$$ L$o$ ~ W$8D$(18ÍD$ $$$D$$ D$D$$4 $$0L$L$ L$*?$(D$$$(}Y$/18ÍL$ $$ L$ : 8-DŽ$,$@ $8L$yL$$4L$ $0L$$,L$Hu 18D$$4 $$0L$$,L$J>$(D$$$(}Y$.18É$h8ÁHDŽ$,$P $ 8L$yL$$DL$ $@L$$4L$$0L$$,L$^$,d$0GD$+$$4D$$0D$$0D+T$+D$+9ЉT$$D$ $D $$@L$L$$L$ $8D$ $$,t $0~_$8}Y$c-1HÃ$,t$8 $gHÍL$+ $$0L$7 HË$4$D$+D$$0D$z$D $$@L$T$, $89$4$0~ W$8D$i%1HÍD$+$$4D$$0D$s$0D+T$+{*$P $48L$yL$$DL$ $@L$$4L$$0L$-$0~ W$@8D$$1HÍD$+$$4D$$0D$贿$0D+`D$$$D $$@L$L$+L$ $8D$$$m$8}Y$O+1HÍL$+ $$0L$5 H)DŽ$<$P $Z8L$yL$$DL$ $@L$$<L$u 1HD$$$D $$@L$$<L$$8D$$$$8}Y$m*1HÉ$dHÃ98E| E='~ W$"D$1Ëu7 ~M $ L$9l$L$$M 늋A9u! nE`M $ L$L$T$$ HD=۹79$D$D$D$ D$T$ j1 D$$T$ D$T$  L$ $L$L$L$L$t à D$$$D$(D$@BD$D$ $D$$D$<D$D$$D$ D$<D$wD$$D$D$D$ZL$ $L$L$L$L$J Ã|$t, $ * u ËL$ Hù҃|$t, $) u EËL$ Hùҋ\$T$B%B فJL$ JL$JÃT$$$D$Љt(L$ $D$D$D$D$D$ D$ L$ȃÃT$ L$T$u?B=t'J $L$E> L$T$uȃ B tJB tJރ D$D$0L$$ $L$(L$L$,L$ ƒu =-uj1ۉ\$D$0 t@a|؃ ËW$"D$D$(D$\$ Љ$B@Ћ\$믋@=8tWT$J $8L$B= T$u6^$"D$D$(D$B@ D$ E\$T$EB ~iQT$JȉD$L$ $<L$L$L$`T$ÉD$|$u BW$R"D$D$(D$T$\$\$L$ $"L$L$L$L$L$ (à T$$-u -ȃ É$L$(L$L$,L$L$L$ ƒD$} T$uJ|$t -$ IL$D$L$ 8L$w1 ÃL$ $"L$L$L$L$L$ WÃT$-um-t-uȃËA@T%u^$"D$L$A@ D$@T$ t1봉$B@$"L$"L$L$L$ ZqD$ L$ $\$=-u Ãu\KtS$T$s: \$t ËK"tS$"T$B: uӸщ$L$L$L$L$T$ u u|$t ø1à L$ $@D$L$ $0T$;D$u+ЋT$$1ɉD$T$(1 ËL$ $L$L$T$T$u ËL$ $L$,L$L$$L$T$(u ÃD$=-uD$ËL$ $/ D$ L$ $/ HD$L$ $L$L$G ‰D$L$ u1ÉT$8" $ D$ D$$D$ D$@ L$ $( D$ D$$D$ D$ B" $: D$ D$$D$ D$ D$ËD$$D$@@ЋT$_$K S щ $KL$KL$$ÍD$,$D$"D$ /D$ JG1D$BD$$D$$D$$D$ B J ȉD$$L$, $E ĬÃ0L$@ $L$DL$L$L$ƒD$,u( T$,|$t D$410D$#+}D$#-ډ$<L$L$$L$D$4$D$8D$"D$D$#D$ L$D$\$ƒukuLu1|$ uD$ËL$ uD$ $D$ @@ uƉ$C@ u$B@Ћ\$뚉D$$ SL$#T$ÃD$l L$I $=\$ƒAD$$\$f"\$T$D$ |$   D$L$ $ 8]L$;#\$ƒD$L$ tGD$ L$I $=T$ÃD$$D$!\$T$D${D$ $D$ @@뤉$C@V$B@Ћ\$5$B@0D$D$L$4 $ 8]L$!T$ÃuBu#uD$0 u$B@ uԉ$C@ЋT$ÉD$$L$ \$ƒD$t$u \$1҉T$D$ u\$L$ T$cL$,V$D$x \$ƒD$3 a$ SL$ T$ÃD$ $L$ \$ƒD$$$u \$1҉T$D$ u\$L$ T$L$($D$ \$ƒD$g$t D$ uv\$L$ T$89t$W$"D$\$T$ $L$(L$L$,L$D$ L$8L$n\$T$D$$B@Ћ\$$C@ЋT$L$ $iu1ÉD$$L$L$T$ÉD$ tBu1É$8L$T$ D$ tD$É$B@$B@Ћ\$ 뭃L$ $u1ÉD$$L$L$ T$ÉD$ tBu1É$8L$T$ D$ tD$É$B@$B@Ћ\$ 뭃$t$(T$,(=+D$ F=8t5N $8L$% L$ t$(T$,u(=+uȃ$ËB=8t%J $8L$[% L$ t$(T$,tn J ͋^JˋFJȉ,$\$D$L$ 8L$Q냃T$J ى $JىL$JىL$L$ 8L$ÃT$J $JL$JL$D$ 8L$ÃT$ B }$xȃÉ$$t$(T$,(=+D$ F=8t5N $8L$>$ L$ t$(T$,u(=+uȃ$ËB=8t%J $8L$# L$ t$(T$,tn J )͋^J)ˋFJ)ȉ,$\$D$L$ 8L$냃 t$l$\$C=8tTK $8L$# t$l$\$u/tt,$\$ ú$t$ ËU K )ʃuUK)ʃu֋UK)̃D$ @u1L$ $W t D$$& T$L$ A t D$ @É$B@ \$T$(=+L$B=8teJ $8L$" \$L$T$u@B@T%u B@T%u(=+uȃ É$\$TC@T%uC@T%t$T$$밃 \$T$(=+L$C=8t5K $8L$! \$T$L$u(=+uȃ ËB@T%uB@T%tЉ$T$58T$DB@T%cB@T%OB=@M-tLJ $@M-L$D! T$Du/^$"D$D$D$@u $ É$K"L$T"L$L$L$ -ËD$@@T%tD$@u$ ËW$"D$D$@@ D$1Ã\$K S щ $KL$KL$&A $C Ã$T$(B J ȉD$ $,T$(D$L$ $JL$JL$D$+L$ $L$L$L$W\$ ƒ}WK\$ $L$) $L$L$L$ \$ ¹V" $\$AL$L$AL$ $Ã4D$|҉A $o\$ T$9D$|C1봃T$B="t}J $"L$ T$u`$Z"L$ \$t(=+(=+ÃttL$ $L$L$ú$\$;ËL$ $у L$L$x\$ǃ\$ K S щ $KL$KL$D$ D$D$L$Ã0T$4B J ȉD$$BD$ BD$L$8 $L$ !6eĉ $D$D$D$ 8L$fL$( $"L$D$$D$wST$$ ɚ; $QL$?BL$D$ 8L$bL$( $"L$D$$D$ST$$8 x"D$( $L$L$"L$ 迓L$( $"L$D$$D$RT$$ ' $ L$L$"L$ W`L$( $"L$D$$D$-RT$$6  $D$D$D$ 8L$讔L$( $"L$D$$D$QT$$ D$($D$D$D$ -L$L$聓JL$( $"L$D$$D$?QT$$   $;L$;L$?BL$ -L$L$L$( $"L$D$$D$PT$$ u$D$L$D$ 8L$F:L$( $"L$D$$D$WPT$$  +D$( $L$L$D$ D$D$D$-L$L +L$ 5L$( $"L$D$$D$OT$$a D' $ L$L$L$ ;L$;L$?BL$-L$L +L$ 蠐L$( $"L$D$$D$'OT$$ $D$L$D$ 8L$訑`L$( $"L$D$$D$NT$$6 D$,$"D$D$D$,$"D$'D$"D$,$ "D$"D$L +D$,$"D$L +D$zD$,$"D$D$V8D$,$"D$8D$2.D$,$'"D$.D$z3 $."L$D$u0ËD$,$E"D$L$ $ ` $ `@B $ 8] $ @\Q $ S=`t =`u0Ã=8]t=@\tt/$ Wd<-$u |`0G+$a X=Wt =|`u0Ãt0É$B@0É$B@U0É$B@0É$B@0É$B@{0É$B@0É$B@Y0É$B@0É$B@[0É$B@0É$B@Q0É$B@0ÃD$$D$ʧuD$$JtGD$$9t $D$\$DB1u 1\$t0$D$\$ B1u ø$D$\$ۭB1u øÃPD$X$D$uD$X$jtLVD$X$)L$D$`$t$ =|$TPD$`$D$tuD$`$uD$X$6D$`$6d$X\$@d$`\$HD$@$|$t$@D$XB1\$0D$`\$8D$0$|$t$0pD$@$D$0\$m |?0\$ D$0L$HD$8L$@$}\$(V|$Tt$ PD$`$\$D$$D$X\$\$ \$Xv]D$X5|?0$D$`5|?0\$\$D$$1\$D$$D$`\$褫-#\$(QD$X5|?0$D$`5|?0\$5\$D$$1\$D$$d$`\$E\$(HD$P$D$iuD$P$tLVD$P$\)L$D$X$Et$<|$LHD$X$D$uD$X$suD$P$Z6D$X$>6D$P\9\$8D$X\$@D$8$|$t$8D$PB1\$(D$X\$0D$($|$t$(D$8L$(D$@L$0$d{\$D$@$D$(\$ |?0\$ V|$Lt$HD$P5|?0$D$X5|?0\$C\$D$$1\$D$X$D$P\$V\$ 뎃4d$D\$$D$<\$,D$$$|$t$$&D$,\$d$$\$|$8t$4ÃPD$X$D$%uD$X$襡tLVD$X$)L$D$`$t$<|$TPD$`$D$诡uD$`$/uD$X$6D$`$6D$`B1\$@d$X\$HD$@$|$t$@d$`\$0D$X\$8D$0$|$t$0D$@L$8D$0L$H$"y\$ D$`$D$@L$0D$HL$8\$|\$(V|$Tt$ P\$`wD$X5|?0$D$`5|?0\$\$D$$[1\$D$$D$X\$\$ D$X$\$D$`$D$\$\$(WD$X5|?0$D$`5|?0\$n\$D$$1\$D$$d$X\$~-#\$ t4d$D\$$D$<\$,D$$$|$t$$D$,\$d$$\$|$8t$4ÃD$$ޞBD$$ɞ-D$$D$D$$D$tR$D$\$裥B1u;$D$\$聥h;$D$\$gX;$D$\$MD$$D$yu$\$tD$$D$\$$D$\$B1u$D$\$ܤxy;$D$\$¤uÃTD$\$D$uD$\$btLVD$\$)L$0D$d$t$0Ƹ<|$XTD$d$D$luD$d$u\$\vXD$$|$t$\kD$$$|$t$D$X$|$t$$UkTD$d$o\$<6$轊\$\6$衊\$<\$\u$$y\$<d$\d$\D$D$@\$HD$8$D$h\$荑\$PV|$\t$HXD$8\$HD$@$D$h\$O\$P\$0r\$( D$0$5D$K\$0D$($5D$2\$D$0$D$\$D$0\$D$$x\$ D$ $D$\$@\$HD$h\$P|$\t$HXÃ4d$D\$$D$<\$,D$$$|$t$$&D$,\$d$$\$|$8t$4ÃXD$`$D$euD$`$D$`$D$7t:D$h$D$u!D$h$螈u\$hD$`$ )L$D$h$t$ƌY<|$HD$h$D$覈tHD$`$D$荈u/D$`$ uV|$\t$HXV\$`sK\$HD$h$[\$D$h$} |?0L$\$$D$\$軎\$P<\9\$HD$h$ \$D$h$. |?0L$\$$D$\$l\$PD$h$D$蓇?D$h$*6$a\$D$`$\$$D$`\$\$HD$`$ 8\$D$$\$D$h$-\$D$h$O ?1L$L$\$PV|$\t$HXD$`$9\$@D$h$\$8D$`$=B1\$0D$@L$8\$(D$(L$(B1\$ D$8L$8B1L$@t$ \$HD$8t$ L$0L$0\$P[DL$L $9)L$L$4L$L$$L$ <u1DVSSul= $CD$4$|$t$4)D$L@uHD$$$|$t$$D$4$|$t$4|$t$$/TL$4 $Ҍ|$fD$l$\$ l$D$ )S=Vt CDÍ<$t$4NYDËT$9)D$|S1DÃV Wu $9)D$|1ÁuW$:)D$t|ى $蜃σ4L$8 $:)L$L$$L$k:u14VSSul= $D$$|$t$$D$<ЍL$ $肋V|$ fD$l$\$l$ D$)SuW$':)D${14ÁuW$9:)D$x{14Í<$t$W4ËT$:)D$C{S14ÃL$ $6EL$ÃL$ $GL$ÃL$ $IL${ÃL$ $IL$_ÃL$ $LL$CÃL$ $>NL$'ÃL$ $QL$ ÃL$ $QL$ÃL$ $OUL$ÃL$ $[L$ÃL$ $\L$ÃL$ $\\L$ÃL$ $_L$cÃL$ $dbL$GÃL$ $bL$+Ã(L$0 $J:)L$L$L$7u1(VSSul= $ug<$t$\$L$ $貈|$fD$ l$ \$ l$L$ ) S=Vt #(D$$`(ËT$R:)D$xS1(Ã4L$< $_:)L$L$$L$6u14ËSSul= $<$t$$\$<$t$$S\$L$ $躇|$ fD$l$\$l$ L$) S=Vt +4ùv:) $D$\$D$\$ Ě4ËT$g:)D$wS14Ã@L$H $y:)L$L$(L$L$ L$ 5u1@VSSul= $D$($D$OuD$($~:D$($D$!t.D$ $D$uD$ $~D$($)L$D$ $t$h<|$0\$(tD$($)~taVL$0 $|$fD$l$\$l$D$)S=Vt f@Í<$t$0qR@D$ $D$~tV\$ \$(su$}\$D$ $\$D$$D$\$y\$0$}\$D$ $\$D$$D$\$A\$8$H}\$D$ $\$D$$D$\$-#\$0$ }\$D$ $\$D$$D$\$ƃ-#\$8KD$ $D$|D$ $c|D$ $L$(\$0D$ $L$(\$8V T$:)D$TtS1@à L$( $:)L$L$L$G2u1 D$${u'D$${u1D$ L$ $[w ø L$( $:)L$L$L$1u1 D$$D${u/D$$D${u1D$ L$ $v ø ;) $<[4L$М!L$D$ L$*D$u xy;$ D$D$$;)D$D$D$,;$o D$D$$;)D$D$D$ =h;L$$zL$Yxy;L$$zL$Yxy;L$$`zL$Yxy;L$$>zL$-#Yxy;L$$zL$-#Yh;L$$y-#D$XD$wyD$$yL$YX;L$$yL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YX;L$$1y-#D$XD$xD$xL$YX;L$$xL$YTh/Th/YX;YX;YTh/Th/YX;L$$xL$-#YX;L$xL$YX;L$$@xL$YTh/Th/YX;YX;YTh/Th/YX;L$$wL$-#YX;L$UwL$YX;L$$wL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YX;L$$!w-#D$XD$vD$vL$Y;L$$vL$YL$$vL$YL$$vL$YL$$vL$-#YL$$_vL$-#Y;L$$7v-#D$XD$uD$$vD$XD$uD$$uD$XD$zuD$ouD$XD$^uD$SuD$XD$BuD$7uD$XD$&uD$uD$XD$ uD$$Xu-#D$XD$tD$tL$Y<D$$uL$$YL$$tL$<$YL$$tL$<$YL$$tL$xy;YL$$tL$xy;YL$$ptL$h;YL$$NtD$sD$XD$$+tL$$$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$$sL$X;YL$>sD$3sD$XD$${sL$$$YTh/Th/Y$$YX;YTh/Th/YL$$sL$X;YL$rD$rD$XD$$rL$$$YTh/Th/Y$$YX;YTh/Th/YL$$irL$X;YL$qD$qD$XD$$+rL$$$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$$qL$X;YL$>qD$3qD$XD$${qL$ؠ$YL$$YqL$YL$$;qL$YL$$qL$YL$$pL$YL$$pL$;YL$$pD$TpD$XD$$pD$1pD$XD$ pD$pD$XD$pD$oD$XD$oD$oD$XD$oD$oD$XD$$ pD$oD$XD$oD$oL$Y<D$$oL$-#ؠ$YL$$oL$-#YL$$zoL$-#YL$$VoL$-#YL$$2oL$-#YL$$oL$-#;YL$$n-#D$unD$XD$$nL$-#$$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$$EnL$-#X;YL$mD$mD$XD$$nL$-#$$YTh/Th/YYYTh/Th/YL$$mL$-#X;YL$mD$ mD$XD$$UmL$$$YTh/Th/YYYTh/Th/YL$$lL$X;YL$xlD$mlD$XD$$lL$$$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$$ClL$X;YL$kD$kD$XD$$lL$ؠ$YL$$kL$YL$$kL$YL$$kL$YL$$kL$YL$$kkL$;YL$$IkD$jD$XD$$&kD$jD$XD$jD$jD$XD$jL$YL$wjL$YL$`jD$UjD$XD$$jD$2jD$XD$!jD$jL$Y<$$Y$$Y$$YX;YX;YX;YL$iL$Y$$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YX;YL$iD$iL$Y$$YTh/Th/YYYTh/Th/YX;YL$hL$Y$$YTh/Th/YYYTh/Th/YX;YL$!hL$Y$$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YX;YL$gD$gL$Y$$Y$$Y$$YX;YX;YX;YL$gL$Y$$YL$fD$fD$XD$fD$fD$XD$fD$fD$XD$fD$fL$YX;YL$wfD$lfL$Y\<D$$fD$EfL$YTh/Th/YL$$wfL$YL$$YfL$YTh/Th/YL$$'fD$eD$XD$$fD$eD$XD$eD$}eL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$eD$eD$XD$dD$dD$XD$dL$YTh/Th/YYYTh/Th/YL$dL$YL$pdL$YL$YdL$YTh/Th/YYYTh/Th/YL$cL$YL$cL$YL$cD$cL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$bcD$WcD$XD$FcD$;cD$XD$$cD$cL$YTh/Th/YL$$JcL$YL$$,cL$YTh/Th/YL$$bD$bD$XD$$bD$lbD$XD$[bD$PbD$XD$?bD$4bD$XD$#bL$YL$ bL$YL$aD$aD$XD$aD$aD$XD$aD$aL$Y_<YTh/Th/YYYTh/Th/YYYL$9aD$.aL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$`D$`D$XD$`D$`D$XD$`D$`L$YTh/Th/YYYTh/Th/YL$1`D$&`D$XD$`D$ `D$XD$_D$_L$YTh/Th/YYYTh/Th/YL$_D$_D$XD${_D$p_D$XD$__D$T_L$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$^D$^D$XD$^D$^D$XD$$_D$^L$YTh/Th/YL$$^L$YL$$^L$YTh/Th/YL$$^D$^D$XD$$f^D$]D$XD$]D$]D$XD$]D$]D$XD$]L$YL$]L$YL$]D$y]D$XD$h]D$]]D$XD$L]D$A]L$Yh<D$$]L$$YL$$c]L$<$YL$$A]L$<$YL$$]L$xy;YL$$\L$xy;YL$$\L$h;YL$$\D$N\D$XD$$\L$$$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$$$\L$X;YL$[D$[D$XD$$[L$$$YTh/Th/YL$$[L$-#<$YL$$[L$-#xy;YTh/Th/YL$$L[L$X;YL$ZD$ZD$XD$$[L$$$YTh/Th/YL$$ZL$-#YL$$ZL$-#YTh/Th/YL$$|ZL$X;YL$ZD$YD$XD$$>ZL$$$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$$YL$X;YL$QYD$FYD$XD$$YL$ؠ$YL$$lYL$YL$$NYL$YL$$0YL$YL$$YL$YL$$XL$;YL$$XD$gXD$XD$$XD$DXD$XD$3XD$(XD$XD$XD$ XD$XD$WD$WD$XD$WD$WD$XD$$XD$WD$XD$WD$WL$Yd=D$$WD$nWL$YTh/Th/YL$$WL$-#YL$$|WL$-#YTh/Th/YL$$DWD$VD$XD$$!WD$VD$XD$VD$VL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$7VD$,VD$XD$VD$VL$YL$UL$YTh/Th/YYYTh/Th/YL$UL$YL$UL$YL$tUL$YTh/Th/YYYTh/Th/YL$UL$YL$UD$XD$TD$TL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$TD$|TD$XD$kTD$`TD$XD$$TD$=TL$YTh/Th/YL$$oTL$YL$$QTL$YTh/Th/YL$$TD$SD$XD$$SD$SD$XD$SD$uSD$XD$dSD$YSD$XD$HSL$YL$1SL$YL$SD$SD$XD$RD$RD$XD$RD$RL$Y3=D$$SD$$ SL$-#YL$$RL$-#YL$$RL$-#YL$$RL$YL$$RD$XD$$gRD$$URD$XD$QD$$2RD$XD$$RD$$RL$-#YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$$QD$$QD$XD$QD$ QD$XD$$RQD$$@QL$-#YTh/Th/YYYTh/Th/YL$$PD$$PD$XD$]PD$RPD$XD$$PD$$PL$-#YTh/Th/YYYTh/Th/YL$$(PD$$PD$XD$OD$OD$XD$$OD$$OL$-#YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$$`OD$$NOD$XD$ND$ND$XD$$OD$$O-#D$XD$$NL$YL$$NL$YL$$NL$YL$$NL$YL$$rND$$`ND$XD$$HND$MD$XD$$%ND$$N-#D$XD$MD$MD$XD$MD$uMD$XD$dMD$YMD$XD$HMD$=MD$XD$$MD$$sMD$XD$MD$LL$YY<\9YTh/Th/Y\9Y\9YTh/Th/Y\9Y\9YL$jLD$_LL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$KD$KD$XD$KD$KD$XD$KD$KL$YTh/Th/YYYTh/Th/YL$fKD$[KD$XD$JKD$?KD$XD$.KD$#KL$YTh/Th/YYYTh/Th/YL$JD$JD$XD$JD$JD$XD$JD$JL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$*JD$JD$XD$JD$JL$YYTh/Th/YYYTh/Th/YYYL$ID$wID$XD$fID$[ID$XD$JIL$YL$3IL$YL$ID$ID$XD$ID$HD$XD$HD$HL$Yh<D$$ID$HL$YTh/Th/YL$$HL$-#YL$$HL$-#YTh/Th/YL$$HD$HD$XD$$eHD$GD$XD$GD$GL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL${GD$pGD$XD$_GD$TGL$YYTh/Th/YYYTh/Th/YYYYTh/Th/YYYTh/Th/YYYL$yFD$nFL$YTh/Th/YTh/Th/YTh/Th/YTh/Th/YL$ FD$FD$XD$ED$ED$XD$$,FD$EL$YTh/Th/YL$$EL$YL$$EL$YTh/Th/YL$$ED$8ED$XD$$ED$ED$XD$ED$DD$XD$DD$DD$XD$DL$YL$DL$YL$DD$DD$XD$DD$wDD$XD$fDD$[DL$Y ÃD$ @uW$U/D$<1øÃ"D$@u(4ȃÃL$ $u1--ÃL$ $rT$ u1ËJ $J L$M à -D$L$$ $5u1 ËL$( $'V/L$D$L$ L$L$8u1 ËL$ $y \$$}1 Ãt S C9~SK $T$&M ËSL$ $u1""à L$ $t\$T$u ËCK )ȉ|C9?~ W$.V/D$: ËCK ȋL$S Ѓ Éʃ}1붃D$D$ L$ $?V/L$L$L$u1ËL$ $L$ L$L$L$'D$}1ËL$ $L$L$K ÃL$ $t\$u ËSK ʉՋCKȉ9s u#9sB)~D$(S ЃB΃T$ D$t$$GV/L$L$L$u1ËL$ $L$ L$Mƒ}1Ã|$|D$9|L$ $T$K É+D$D$D$)‹D$L$)H σ$D$D$ L$, $SV/L$L$L$'u1$$q. D$u1$ËL$( $L$L$}(L$ t1$ËD$$D$@@uD$$ËL$ $D$ D$1ËB;D$ ~L$ JJJ --à L$ $D$ƒu1 Ë@u* t,`$61 É$B@߉Ѓ ÃD$L$ $u1ËL$ $lV/L$L$L$L$L$ tL$u1Ã|$u.AD$|$}D$ȋL$H --Ã|$uҋA D$ɃL$ $=l$(Wu ËT$ ~$uV/D$5ËB )9|$V/D$5ËJ B9L$|gZ9T$J $\$ \$@l$(T$u x_$V/D$$5ËL$ JBBJ 9}0BJȉ$D$B T$J)ȉD$l$(T$BT$J ȉ$D$$D$l$T$L$J BJ 9}J JD$(ÉC-DL$L $V/L$L$L$u1DËL$H $L$L$L$L$HD$ D$$K|$ }1D--DÃ\$CtC$i>\$CC1CC --ÃL$$ $(D$|$u1ËL$ $ۍD$$L$ L$L$L$X uJL$ t(L$ t1ËD$$D$@@D$$D$@@ËL$ $L$ L$L$L$T$uBL$ t t1É$B@D$$D$@@ЋT$  $B@L$ t2t1--ËD$$D$@@̃L$AtA$<L$ $uJ à - $M u1 @ @D$@L$ $;T$BBu>x_$nW/D$1T$B t1 É$B@L$JЃ ÃD$$2ID$@@1ɉH --ÃD$$HD$$I ÃLW/ $L$PL$4Tu1LÉD$$W/L$L$L$6T$D$ t_|$ u1Lù#- $L ƒuD$$lH1LËL$HL$Hǃt$ B ЃLÉ$B@딃D$L$ $W/L$D$L$ L$L$a-u1Ã|$tL$ $ù $à W/ $-L$~)L$D$ L$Eu É$- D$H)#-H)-- $6 } ù#- $ } ù3 $X/L$D$ԨD$$ X/D$L$L$?T$u@D$$/X/D$#-D$D$$9X/D$-D$ u$B@몃 D$XD$PK\$| t8K\$}D$@tD$@$ 9D$$F Ë$T$@@Ћ\$T$뫃?. $!J u1@ @D$H  $I7T$BBtЃ t 3É$B@\$784D$.Ãl$} ËD$@9|1ËD$pD$XNt$ 9|(t\$ tNt$ 9}؋D$h1É$B@Ћt$ l$\$΃\$C =?~&3ËK ɁȉL$K $D$7\$tĉCL$K 1ÃD$@+D$D$$ ǃu1Ët$1;l$}D$@ A FE;l$|D$L$HÃD$@+D$D$$" ǃu1Ët$1;l$}G L$I FE;l$|D$L$HÃt$$1҉T$1ۉ\$ D$(t4$D$fOt$$\$ ‰D$t |$ tL$ $&? T$Ãt?\$ $T$W \$T$ D$ t[ tE|$u1Ë\$D$$\$ \$7+T$ t1É$B@$C@뮉$B@Ћ\$딃t륋D$$-D$*111Ã|$ u1ËD$@$  D$L$ $L$L$$L$L$IL$ D$D$$ D$@$ L$$D$9tY$1ÉȃÃ\$T$\$ u1Á\$~LL$I $T$L$X@Ћ\$T$=t Á\$L$I $T$\$X@;D$t ËD$ Ã|$u1ËD$ Ãl$\$ T$D$ B8u1ËJ4 $J8L$L; \$ŃD$u ËC 9C $ l$\$CMECt?K $KL$D$Rt\$D$ C~K tLC|$ t5L$ tC8D$ ËD$ $D$ @@Ћ\$ظËC$C@@Ћ\$띉,$E@Ћ\$IC@ u Ch 3KI uC@ $C@ @@Ћl$\$ŋC@KI 9uK $l$\$|KAAKI(MEt É,$E@B8tB8)9Y~(,$\$c9 \$ʼnD$ËB4J8ȉ$l$\$T$ D$P8ЃÉ$D$D$zl$\$ T$zÃ\$$T$BD  D$$/T$BHu,ËL$JDB $T$D$JH $L$L$$L$JL$ D$D$$D$@ $W\$T$$D$9t>K $tU$3&ËY$i-ËD$ KHЃÉBD97JH $\$0T$u+ÉBHL$$JD\$CDu.( $.\$CHu~+CD(D$CDH9D$}[K $\$KI SR9K $f\$KHT$  tdD$CDH9D$|CD=?~*ËCDKH $D$ D$/\$u*ÉCHL$ KDEKHT$ @D$KHD$@ËKA A %T L$,L$D$L$,L$$I $L$ L$T$T$XЋT$L$,;D$tU$$ ÃuLD$ D$D$(L$D$ ËD$ D$L$,hfD$ 9t ÃD$D$D$L$ I $L$L$X@ЋL$Ã} D$uW$84D$D$@@ D$D$D$ '!D$@@1É$B@뵋L$ID $T$-L$T$}' tD$@@1É$B@ t É$B@ L$A@I@2|\L$ $# u1 ËL$ID $D$D$&T$} t1 É$B@ t  É$B@ T$$pZL$L$B0Ѓ} 1 Ã\$D$hC$|Bt6D$$L$L$L$C0Ѓ} 1øȉ$ $L$ -[L$C0Ѓ}ϸÃ<\$@D$DHC(ugD$ID$$D$84D$L$ -L$ $AT$@D$$L$L$L$L$B0Ѓ} <1<É%D$%D$%D$%D$ D$ u D$t,D$J$L$L$T$C0Ѓ}<D$u D$KD$M뼃K8$F3 D$0L$0 $9 T$@D$8$YL$L$B0ЋT$@$L$0L$L$8L$B0ЋT$@$84L$L$B0ЃD$4,T$0D$4@\$$B(t`D$GD$$$L$L$D$ " T$0} ,É$L$L$ L$B0Ѓ} ,1,D$ D$D$F$L$L$L$B0Ѓ}D$$.b D$ ,D$$$gL$L$ D$D$D$u뮉$茬T$0D$$L$L$L$L$B0ЋT$0y$94L$L$B0ЃVD$ I$L$, $}7 l$(Ã} $ËE(%L$, $0 u $ÉD$$77 \$(T$D$}$u $ u$B@ЃD$$_L$L$C0Ћ\$(T$|$L$L$L$L$C0Ћ\$(T$|$94L$L$C0Ћ\$(T$\u+|$0t$L$,L$} $1$ ủ$B@Ћ\$(뻁D$U\$ \$,$L$L$T$E0Ћ\$ T$(} $Á~ B@=?.t-$L$,L$\$B0Ћ\$(:$É$D$D$\$(} $ËC@KI 9uK $\$(|#D$,KAAKIL$,$Á\$ /D$T}DB|$Ãl$$ 9~ $ˉL$Z! |$$5SD$|$u1ÃuD$Ël$l$OD$ D$ E\EUEEEE EEEEڃ OLED$$+D$D$˲ D$Ás\uRE\Eu EEEEڃ  tE$T$,B@T%u $ËD$(@('J $JL$u $ÉD$$2 T$(\$D$}$u $ u$C@؃D$$ `L$L$B0ЋT$(\$|$L$L$L$L$B0ЋT$(\$|$94L$L$B0Ћ\$`u/|$0t"L$( $L$,L$S} $1$ uȉ$C@뻉$u $ÉD$$1 t$(\$Ń=D$ ~ $D$X}DB|4$L$L$T$F0Ћl$ T$(\$z~ B@=?.t?$كL$l$B0Ћ\$C $C@$D$D$\$D$(@@L$(II 9uL$(I $\$|#L$(IAAL$(IIk$ÃD$1;T$$}EщT$T$ @ uD$ËL$ $D$D$g%T$|B;T$$|D$ƃ D$D$L$( $ \$$}1|$uD$ ËL$ uD$$D$@@փD$uFC$t-D$)$L$L$T$C0Ѓ|D$D$(D$t̋L$( $u \$T$$D$|$] B$H$VL$L$B0Ѓ)L$$ $L$(L$L$L$L$$I $L$L$蘉T$$B(tM$VL$L$B0ЋT$$$L$L$D$1ɉL$;L$Ή$hUL$L$B0ЋL$T$$TAȉ$ZL$L$B0Ѓ.L$$ $L$(L$HD$$L$(L$\$fL$$I $L$L${\$$th1ɉL$;L$}6$hUL$L$C0ЋL$\$$AL$;L$|ʉ$L$L$lD$_$T$ @TL$L$C0Ѓ6 D$D$$@$L$( $bu t 1 ËL$$ $D$D$D$!T$D$ tD|$} ËL$$ $,UL$L$D$$@0Ѓn É$B@믋L$( $XaD$uea\$tQ|$u$u u$C@L$ uϋD$$D$@@Ћ\$1 ËL$( $`T$$D$\$zL$$ $L$L$D$ T$$\$M$,UL$L$B0Ћ\$&|$lT$ [$B@K$VL$L$B0Ћ\$L$$ $L$L$D$' \$|$tT$D$ D$tIL$$ $\$D$\$XtD$ tD$|$uBL$$ $lZL$L$D$$@0Ћ\$|$CL$( $'_ÃD$U*\$돉$C@q$B@Ћ\$D$D$ @,tL$ $L$$L$Jt;D$ @(ID$]L$ $L$L$T$D$ @0Ѓ}7D$ @,tL$ $L$$L$tD$D$L$$ $ |u#L$ $L$$L$L|D$됋L$ $L$$L$YsL$$ $ ]ÃD$ XYB J ; U~94$&\$ uE1u!L$ $\$e\$ D$YH $C@D$(D$l D$D$$@$$L$( $]ƒu't 1 Ë@@T%T$$ L$$ $L$I L$D$T$ÃD$|%L$$ $JL$D$T$ÉD$ tB} ËL$$ $`L$L$D$$@0Ѓ É$B@Ћ\$뭋^$294D$ ËL$( $[ƒD$ue\$tQ|$u$u u$C@L$ uϋD$$D$@@Ћ\$1 Ë@@T%$O L$( $W[T$$D$X\$UL$$ $L$I L$D$D\$)L$$ $L$IL$D$T$$\$$`L$L$B0Ћ\$|$T$ $B@$VL$L$B0Ћ\$L$$ $L$I L$D$n\$SL$$ $L$IL$D$B\$'|$tT$D$ OD$C@T% $ L$$ $L$I L$D$\$L$$ $KL$D$\$}tD$ tD$|$uBL$$ $[L$L$D$$@0Ћ\$*|$hL$( $XÃD$\$돉$C@q^$94D$o\$$B@Ћ\$^$[94D$;\$$D$ D$D$L$, $誚T$(D$D$,$D$D$D$ D$D$D$ L$( $L$ L$D$} $ËL$( $L$L$D$T$(} $É$`L$L$B0Ѓ} $1$D$$VL$L$B0Ѓ} $ËL$, $L$L$L$ L$L$L$ T$(tg$L$ L$D$;} $ËL$( $L$L$D$T$(} $D$D$=l$[L$L$B0Ѓ} $ËL$, $T$(;D$t _$94D$$Á|$1$ÃD$D$ @,tL$ $L$$L$t;D$ @(D$}L$ $L$L$T$D$ @0Ѓ}7D$ @,tL$ $L$$L$tD$D$L$$ $ |u#L$ $L$$L$|D$됋L$ $L$$L$sD$$@=\4uD$ @$L$$ $94L$94L$FHÃD$ (YB J ; U~94$a\$ uE1u!L$ $\$\$ D$YH $C@붋YB J ; U~94$u11L$ $L$$L$D$YH [D$(D$dHD$DD$@D$8D$4D$0D$,D$D$L@,tL$L $L$PL$Zt+L$L $VL$L$D$L@0ЃUD$L@,tL$L $L$PL$?|$@|$D|$8|$4uZ|$0u1|$,uD$HËL$, uD$,$D$,@@֋L$0 u‹D$0$D$0@@뭋L$4 uD$4$D$4@@넋L$8 lD$8$D$8@@TL$D 8D$D$D$D@@ L$@ D$@$D$@@@D$L$P $ TL$+ D$DD$L@(t%L$L $L$DL$D$$WL$P $ tWL$+ D$4$ ZL$D$BD$, L$, $D$ 1;\$ }wL$, $\$\$5L$L $D$D$D$w\$T$} $B@  C;\$ |D$L@(D$D@utV$:4D$=L$D $D$uE+B$T$D$D$W.$ l$$\$,T$0s$T$D$$1RBF$T$D$D$f$T$KL$}\$,T$0&D$9(ÃT$B$|7D$B$D$$L$L$L$B0ЋT$} É$L$L$D$FT$} É$TL$L$B0ЋT$} É$D$D$B0Ѓ} 1ÃL$At A$^--Ã@T$HD$,t"$5=4L$L$,L$ID$D@@=?.ttV$A=4D$1@ËL$D $D$D$T$D}1@ËJL$ AD$4D$L$D$ q1ù+ $l$ \$ƒu1Éh$}H(BB BBBB B4B,B@BDB8B<T$B\$Z1I\$T$Bu t1É$B@C=+hK $+L$< T$\$CC XI9J0BTT$tq?4 $ lT$gD$$ `L$O \$T$B< tB<1$D$É$C@ЋT$ӉZ<؁-u 5J0_DJ0C=?.tF$ ^L$ T$B B u%b^$>4D$T$ $Z# T$B4B4`T$n$ T$BBu W$>4D$VT$7J0貥T$Ã1 D$D$L$( $?4L$L$L$uNvD$L$( $L$,L$$?4L$@h"L$ L$L$L$L$u1 ËL$ $L$L$s ÃD$$訄T$B BKBDBBBuwB uLB<u!B4$*" L$ $AЃËJ< uӋB<$B<@@ЋT$뼋J uB $B @@ЋT$둋J yB$B@@ЋT$_J GB$B@@ЋT$-J B$B@@ЋT$JD BD$BD@@ЋT$J B$B@@ЋT$J oB $B @@ЋT$U T$B t!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBDt!JD $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËB t!J $L$L$D$ЋT$t ËB<tJ< $L$L$D$Ѓt 1 ÃT$ B tZ B RBtZB BDtZDBD BtZB BtZB BtZB tZB tZ B t.B<tZ?4D$ËBu Z1ËJ uB$B@@Ћ\$T$ ΃\$T$ u ^$b?4D$ËB u Z 1ËJ uB $B @@Ћ\$T$ ΃L$ Au"`$?4D$L$ AËA ^\$T$ u $?4D$sËC@T% u $?4D$IËBu Z1ËJ uB$B@@Ћ\$T$ ΋tVÃT$$tI-u\$@4D$1É$L$L$L$ L$D$ "ùH@4 $u1É$L$L$fLuUL$ $wu1ÉD$$L$ L$8 T$ÉD$ t؃É$B@Ћ\$$L$ L$ ՃT$ B4} \$P@4D$J4B4J0ÃT$B @J I 9uJ $FT$|%-J AAJ I-1øÃ\$d@4D$^Ã$T$(D$$L$L$B@Ѓ} $Ã} $ËL$ $D$D$5D$u $VL$ $L$L$D$6ƒ=VuD$ VL$ $D$D$zg D$ u+W$~@4D$mD$$D$$ËD$$\$ T$(B @J I 9uJ $\$ T$(|J AAJ I1$ t $É$C@D$@ |$u$tu$0D$ @O$# D$ &5T$B @J I 9uJ $T$|$D$ J AAJ IL$ 1øà |$t$119}3‰ C9| ÃL$ $L$L$$h T$ÉD$ u ËB @J I 9uJ $I\$ T$|J AAJ I1 t É$C@T$$L$ L$L$B<Ѓ} ËL$ $L$ L$L$ÃT$$L$ L$L$B<Ѓ} ËL$ $L$ L$L$ÃT$$L$ L$L$B<Ѓ} ËL$ $L$ L$L$à T$$D$ $L$L$B@Ѓ} Ã} ËL$ $D$cD$u ËL$ $L$L$D$c D$uD$$[D$ ËD$$G\$T$$B @J I 9uJ $Q\$T$$|J AAJ I1 t É$C@ T$$$L$L$L$(L$B<Ѓ} ËL$ $L$(L$\$$} \$@4D$ Ã$< T$$Ã\$u ËB @J I 9uJ $YT$$\$|J AAJ I1 t É$C@$L$L$D$(D$C<Ѓ} ËL$ $L$(L$L$L$ @D T$$6(T$,D$$L$L$B@Ѓ} (Ã} v(ËL$ $D$ D$u (ËD$$D$ D$WD$藷\$ \9\$ u u6D$  D$ @D$ $^ D$$uD$$D$(ËD$$\$$T$,B @J I 9uJ $誖\$$T$,|J AAJ I1( t (É$C@W$@4D$[T$ $L$ L$L$B<Ѓ} ËD$ $D$J \$\9\$uD$$] T$ ÃD$u ËB @J I 9uJ $襕T$ \$|J AAJ I1 t É$C@Ã(T$,D$$L$L$B@Ѓ} (Ã} (ËL$ $D$ D$蟡\$ D$u (Ã~T$@ I~D$"~ D$'t,D$$yW$@4D$(ËT$@'uċT$@T$B$\$D$D$ D$ D$$D$$L$\$$T$,t>B @J I 9uJ $\$$T$,|J AAJ I1ɉȃ( t (É$C@T$@"T$@T$B,KT$$L$ L$L$B<Ѓ} ËL$ $L$y\$} \$@4D$É$L$ L$D$D$C<Ѓ} ËL$ $L$L$ T$ÉD$u ËB @J I 9uJ $谒\$T$|J AAJ I1 t É$C@T$$L$ L$L$B<Ћ\$} ËD$ ‰$L$ L$ʈT$ɉL$C<Ѓ} ËL$ $L$L$ T$ÉD$u ËB @J I 9uJ $軑\$T$|J AAJ I1 t É$C@T$$L$ L$B@Ѓ} Ã} 7ËL$ $IL$D$贿T$ÉD$u ËB @J I 9uJ $\$T$|J AAJ I1 t É$C@T$$L$ L$L$B<Ѓ} ËL$ $L$\$} \$$A4D$贽É$L$ L$D$D$C<Ѓ} ËL$ $L$L$D$跞T$ÉD$u ËB @J I 9uJ $͏T$\$|J AAJ I1 t É$C@L$ $} ËL$I $D$贏T$ÉD$ u ËB @J I 9uJ $$T$\$ |J AAJ I1 t É$C@L$ $ |$l$ƃD$ u O|$|AE @M IAM Iu ÍX O|$}E @M I 9uM $Mt$ l$|M AAM I01t É4$F@\$NA4D$Y|$t$ l$1W$軰 T$ ÉD$u ËB @J I 9uJ $蛍\$T$ |J AAJ I1 t É$C@-T$ ÉD$u ËB @J I 9uJ $\$T$ |J AAJ I1 t É$C@L$ $} ËL$I $D$_T$ÉD$ u ËB @J I 9uJ $q\$ T$|J AAJ I1 t É$C@$L$( $sD$} $ËD$(@ @D$k,t$(ljD$ u $Ë\$C;\$}dF @hF @\$ <$l$D$:|$ t$(\$ }t $É<$G@;\$|F $D$D$ϊ\$ T$(B @J I 9uJ $:\$ T$(|J AAJ I1$ t $É$C@$\$(T$,C=4?$޽D$$D$D$D$D$jT$u- $T$L$(L$L$,L$ R D$ t|$u*D$ D$D$$D$D$D$D$腶1$ËL$ uɋD$$D$@@봃uLL$( $ tWL$Y ƒu&L$( $D$$t)L$( $L$,L$D$$É$B@ʉ$T$$ÃD$ L$ $} ËL$I $AL$襉\$ʼnD$u ËC @K IAK It-T$$l$l$\$T$D$ MEt}|$ u ËC @K I 9uK $襈\$|K AAK IL$ 1ËL$ t ËD$ $D$ @@,$E@Ћ\$o$B@Ћl$\$L\$^A4D$yl$\$1,D$$D$ L$0 $9T$0D$} ,É$L$ L$B@Ѓ} ,Ã} ,ËL$ $IL$ T$0D$u ,É$L$ L$B@Ѓ|Z} I,ËL$ $IL$j t4L$ $D$D$L$0ILL$T$D$$ >L$ |$$u ,ËL$0I $L$L$-l$$\$ t+,$D$(D$l$$T$(ÉD$ MEtu ,ËD$0@ @L$0I I 9uL$0I $X\$ |"L$0I AAL$0I I1, t ,É$C@,$E@Ћ\$ m$B@Ћl$$\$ JD$$D$@@$B@5\l$ 1|$E @M IAM IuCu$u u<$G@ uӉ$C@Ћ|$‰\$C@T%u4$~A4D$耲|$\$뎋E @TM IAM I8|$^G@T%u4$A4D$%|$\$0u4$A4D$|$\$<$\$D$ЋT$ |$\$ŃD$  tcB @J I 9uJ $#T$ l$ |J AAJ I(1MEt É,$E@<$G@ЋT$ l$ 눉$C@ЋT$ |$l$ c4$A4D$5\\$14$nA4D$|$5\l$ 1 T$$D$$L$ L$B@Ѓ} Ã}  ËL$ $IL$= T$$D$u É$L$ L$B@Ћ\$|t} t É$C@L$ $IL$ \$t4$D$D$L$$ILL$T$\$D$  |$u ËD$$@ @L$$I I 9uL$$I $-|&L$$I AAL$$I IL$1 ËL$ t ËD$$D$@@$C@c$B@Ћ\$BT$B($L$ L$B@Ѓ} Ã} iËL$ $IL$ T$ÃD$u ËB(@@T%J( $\$表 \$T$} t É$C@u ËB @J I 9uJ $΀\$T$|J AAJ I1 t É$C@B $襗 \$T$B tqBOJ( $JL$D$T$ÉD$BJ t BB$B@@Ћ\$T$ى$C@Ћ\$T$wB@ u BX aJI uB@ $B@ @@Ћ\$T$ŋ\$A4D$լà \\$C(C @K IAK I(l$ u ËC(@@T%K( $l$m l$ \$}!MEt É,$E@C @K I 9uK $~l$ \$|K AAK I(1MEt É,$E@C ${ l$ \$CMEtvCtAK( $KL$D$\$ʼnD$ C~K tCËC$C@@Ћl$ \$̉,$E@Ћl$ \$rC@ u Ch \KI uC@ $C@ @@Ћl$ \$ʼn $]B4D$說\$1 $mB4D$莪Ãl$ E pE4~E4M0@9t^~PNM I t E p1ËE @$E @t$@@Ћt$l$ {M4뽃 L$ $} ËD$@ $L${1 à \$C P { ËC @hl$EC @K I 9uK $|l$\$|K AAK I(1 MEt É,$E@T$ $L$ L$B@Ѓ} Ã} ËL$ $IL$论 u ËL$ I $D$D$(l$T$ ÃD$u>^$l$Tl$D$MEtD$É,$E@B @J I 9uJ $zl$\$T$ | J AAJ ID$딸à T$$$L$L$L$B<Ѓ} ËD$ʉ $d u ËL$$I $D$D$'l$T$$ÃD$u>^$l$Gl$D$ MEtD$ É,$E@B @J I 9uJ $yl$\$T$$| J AAJ ID$ 딸 Ã$T$($L$L$L$B<Ѓ} $ËD$‰‹D$@ ‹D$@ ‹D$@ ‰$ u $ËL$(I $D$ D$]&l$ T$(ÃD$u>^$l$l$ D$ MEtD$ $É,$E@B @J I 9uJ $xl$ \$T$(| J AAJ ID$ 딸$Ã(T$,$L$$L$L$0L$B<Ѓ} (ËL$$ $L$0L$Z \$B4D$t(ÉD$ $ u (Ë [ $D$D$!%\$,T$ŃD$tl tNC @K I 9uK $wl$\$,|EK AAK I(1(ø(É$B@Ћl$\$,띋 h\ $T$$T$Ãu> t(W$B4D$D$ D$(É$B@ˋ@@T%t\$$Y L$T$t> t(W$C4D$D$ D$詫(É$B@ˋi E@T%tYC@T%t,$\$L$,ILL$T$u t (É$B@ [ $T$D$D$>%l$,T$\$D$ |$ } t (É$C@E @M I 9uM $ul$,\$|M AAM I1( t (É$C@$B@Ћl$,\$a T$$$L$ L$B@Љƒ} Ã}  ËD$$@ @D$u Xt ËL$ $IL$ \$$Ńu ËC @L$@K $l$l$D$#T$D$ tD$ É$B@ T$$$L$L$L$B<Ѓ} ËD$$@ @D$  s ËD$ʉ $ \$$Ńu ËC @L$ @K $l$l$D$$#T$D$ tD$ É$B@$T$($L$L$L$B<Ѓ} $ËD$(@ @D$ u r$ËD$‰‹D$@ ‹D$@ ‹D$@ ‰$( \$(Ńu $ËC @L$ @K $l$ l$D$-"T$ D$ tD$ $É$B@,l$0\$4E H9L$9u1,ËE @PT$$B@T%tdM $\$7sl$$Ãu ,ËE,$D$D$\$\$  T$D$ tD$,É$B@$ YL$f \$0D$ u ,ËD$4D$D$;D$ C @L$T$(D$C^ $ T$(\$0C= CtDL$ $KL$D$"\$0D$C~K C|$uEC $D$@D$pT$ D$0@ L$4H t ,É$B@L$ tDD$D$;D$C L$4HL$ t1,ËD$ $D$ @@D$$D$@@Ћ\$0룋C$C@@Ћ\$0)$B@Ћ\$0C@ u CP KI uC@ $C@ @@ЋT$(\$0ho,ÃT$ $J IIL$ à L$ $?D$L$ $L$L$ Ã$t$(D$ F @D$;D$,|$,F @L$,@D$\$,C;\$}DF @hF @\$L$ $l$D$'t$(\$}#D$ F $D$,D$nD$ $Ãen$ÃT$ $J IL$*à L$ $:D$L$ $L$L$ Ã4\$8D$C @} m4ËC @K IAK IL$0u 4ËC @K I@D$,$ 8TL$ \$0T$8D$$|$$UD$B $E \$0T$8B Bt@L$$ $JL$D$|T$8D$B~J taBL$$ t8|$u 4ËL$ t14ËD$$D$@@D$$$D$$@@볋B$B@@ЋT$8눉$C@ЋT$83B@ u BX JI uB@ $B@ @@Ћ\$0T$8ŋ ` $Mu 4賟D$0@@T%tL$0 $ ED$(D$0=-vD$0@@T% uj\$IC4D$踙L$0 t1|$(uD$4ËL$( uD$($D$(@@֋D$0$D$0@@뺋L$, $ ]L$7 D$tD$L$0 $L$L$L$ L$L$L$ 1D$ D$ @=$1u D$ $\ L$ $L$ L$L$L$C})L$ D$ $D$ @@L$ XD$ $D$ @@@L$ |$(D$(@@T% u\$cC4D$7zD$L$( $L$L$L$ L$L$L$ t'L$, $L$ L$L$L$ $D$D$$D$@@HT$0B D$0BD$(D$0D$( $B@\$9C4D$c\$81n\$C4@K89|MS8C49S4BC0uNщT$  $\$ƒuߜÉS0L$ K8C4C4K0K I1ËK0 $щT$ L$螡\$멃\$D$C @UK IAK I(l$ u ËC @K IAK It-T$$l$T$l$ \$D$ MEt}|$u ËC @K I 9uK $h\$|K AAK IL$1ËL$ t ËD$$D$@@,$E@Ћ\$o$B@Ћl$ \$L\$C4D$[l$ \$1\$C4D$5\$1T$$L$ L$L$B<Ѓ} ËL$ $L$1ËW$C4D$L$XÃD$ @4D$ @ @tD$ @ $D$fL$ $L$L$L$D$ @<ЋT$ }f蛔UT$ t9u$1ËB @tJ IAJ IȃË\$C4D$1ߋD$P() *tptUt1\$C4D$C4D$D$D$ 'g1É$L$$%$$L$Bt(W$L$V$L$f7$L$aGtptLt($"L$ $(4L$$L$$L$~tRU$ɑ$L$Zm>$`W(G1ctK)t(..0$$D$$D2tF$$Bw$@aLmtUIt:JtK)$`1$?J$@4$MtN$$w$g}XTmtUQt:RtSI$"Q$ j;$T%$>UtV$$$8cmtU]t:atb$$y$c$|Mdte!$YX)$B$Y,qlmtUht:itj$8$$$|otpP$)X$qB$[,tRt:rts$0$@$uut}$$ L$ $} ËL$I $AL$^ ÃL$ $} ËD$@ $L$^T$$L$L$B@ЋT$} É$L$L$B@ЋT$} ËB @J I 9uJ $^T$|%-J AAJ I-1øà \$C @K IAK Iu C @K IAK Iu tRC @K I 9uK $^\$|%-K AAK I-1 ø É$B@Ћ\$띋\$C4D$!\$1d$B@Ћ\$-\$C4D$\$1 T$$L$L$B@ЋT$} É$L$L$B@ЋT$} ËB @J I 9uJ $]T$|%-J AAJ I-1 ø ÃL$ A @} \ËA $A @D$\T$ B @J I 9uJ $\T$ |%-J AAJ I-1øÃL$ A @} [ËA $A @HD$[1ÃT$$L$ L$L$L$B<ЋT$} ËB @J I 9uJ $[T$|%-J AAJ I-1øÃT$ J $J IIL$Zà L$ $込} ËL$I $D$Z ÃT$ J $J IL$Zà L$ $g} ËL$I $D$aZ ÃL$ A4A $D$ut}$L$lL$ $!ÃL$ $pà ^6 $2u1 @ D$@RT$B B(B,B0B4B8BDBBBLN T$\$Bu t1 É$B@B tZ C=+K $+L$L \$T$C XI9u'BnJIl$@|$,D$(|$ 9D$,|$,dL$< $uRl$@:D$@$D$,D$L$PJ l$@D$,릉$B@Ћt$4l$@\$0ME,$E@1*W$x<D$&RP DŽ$L D$@D$D$X@9tD$X$\$J l$$,$/D$d$MD$XĠÃt $uEt|E;D$XH)كuLL$X $t$\l$$},$/D$d$M1ĠË\$X 3MD$XH)s ȉEuDŽ$osЉEE)‰T$`W,$.D$ $D$d$LL$X t 1ĠËD$X$D$X@@;W$_ <D$4D$d$.L1ĠÁD$PD$D$$ $ <L$L$XL${u 1ČÃ|$`u D$X$K < $YG Č$ L$E D$L|$LuD$X$K1ČËD$$D$0D$T$L$X |$`bD$`BBL$`)L$TL$LJL$LIJ$D$D$t?$^L$L tD$X$J1ČËD$L$D$L@@%)T$D$ BD$$d D$D$@+D$D$PD$ $5)L$\$PT$Tl$u>D$L@9tD$L$\$ l$,$o!D$X$LJD$LČÃtK,$K!D$$D$X$JL$L t 1ČËD$L$D$L@@EuruV,$ W$ <D$.2D$X$IL$L t 1ČËD$L$D$L@@ЉEE)‰T$TED$LH)كuLL$L $t$Pl$},$S D$X$0I1ČË\$L 3MD$LH)s ȉE3nu" $跼 }ù`44 $衼 }ù7- $苼 }ù < $!L$.L$D$ L$FD$uùX,( $C D$D$$ <D$D$D$Uu"D$$ <D$u"D$U`44D$$ <D$`44D$U7-D$$ <D$7-D$oUÃ`D$ D$L$h $T$L$L$,L$Vu1`ËL$,\$4AL$(?K\$$D$ D$A t$l$(\$ T$uD$,$8G1`ÉD$D$$|$ ~n\E t  ȗ ȉƃ|(ى%L$$D$$ٸH!L$ JE|$ J~kE t`t t tЋtY$k$D$.D$,$_FT$ t1`É$B@D$,$3FD$`Ã% r`w?߈ÇtY$^$D$P.D$,$ET$ t1`É$B@1\D$D$L$d $|$L$L$(L$Cu1\ËD$(D$ D$0-~)tY$$D$-D$($EE1\$D$ÉD$ VUUU‰ыD$L$.? |$ l$T$D$uD$($D1\Ë\$C? gubC L$ $+L$L$H }L$ tD$D$(${DD$\ËD$$D$@@σ~IL$  ȉŃ|'у?ވÇރCȖ }OD$ Fƒ|$t$\$ ~tʃ $ƒwuCOʃuNdD$$D$D$ L$l $$L$L$0L$;u1dËD$0D$,L$8~D$0$QC1dÉȉL$@$D$L= |$ t$,\$$D$uD$0$C1dËD$D$(1l$|$~%w  L$F|$ۃtKD$0$BtY$$D$+L$ t1dËD$$D$@@~SL$ $l$ }L$ tD$D$0$4BD$dËD$$D$@@ϋL$ t$ $D$< D$믋D$$D$@@  =uO|$ u6t$,4$L$L$L$|$ t$,l$\$$=1 $€GD$ ȉD$\$$fًD$%L$(D$(El$ى\$$H!D$0\D$D$L$d $$L$L$(L$u1\ËD$(D$ D$0=?~)tY$·$D$(D$($@1\$D$ ɃL$: |$ t$l$D$uD$($H@1\Ë\$~HL$  ȉƃ|&?C Lp;}OD$  Lp;CC=C=C L$ $+L$L$L }L$ tD$D$($?D$\ËD$$D$@@σuC Lp;C=|dD$$D$D$L$l $$L$L$0L$u1dËD$0D$,D$8=~D$0$>-d$D$L$8 |$l$\$$D$uD$0$>1dËt$~'L$,  6ƒ~ OD$,كt |$L$ $+L$L$ }L$ txD$|$tW*$ $L$L$L$L$ID$ D$0$=L$ tD$ dËD$$D$@@D$0$=1dËD$$D$@@p,\$$D$%D$0$t=L$ t1dËD$$D$@@ƒ}uKtY$$D$%D$0$!=L$ t1dËD$$D$@@ƒu D$ ȉŃ`ى%FٸH!<\L$d $-$L$L$(L$Gu1\ËD$(D$$D$0=?~D$($^<*\$D$ ɃL$c6 D$uD$($%<1\Ë\$1;t$ }/L$$߈Ç߇Ç=uoCCF;t$ |эL$ $+L$L$o }L$ tD$D$($;D$\ËD$$D$@@ωE;l$ }L$$ 8؇t9)~!CȗCC)NXCȗI9}E롃\D$D$L$d $<$L$L$(L$u1\ËD$(D$ D$0=?~D$($:)\$D$ ɃL$4 |$ t$\$D$uD$($:1\Ël$~HL$  ȉƃ|&ك?E lw8}OD$ t)E? lw8L$ $+L$L$ }L$ tD$D$($9D$\ËD$$D$@@σ\L$d $G$L$L$(L$Mu1\ËD$(D$$L$0u%D$($f9X$ $D$z3 \Á?~D$($99p'\ÉȉL$$D$D$=3 l$D$uD$($81\ÉT$L$D$}K,\$Y$D$1!L$ tD$($81\ËD$$D$@@ًD$$D$$ވÇއÇޖD$=sL$D$}K,\$Z$D$ L$ tD$($+81\ËD$$D$@@ًD$$D$$tKtY$[$D$M D$($7L$ t1\ËD$$D$@@K}s?~ %\ÍL$ $ɉL$, l$}4L$ tD$($c71\ËD$$D$@@ًT$*‰KB|$L$D$}K,\$v$D$kL$ tD$($61\ËD$$D$@@ًD$$D$$ވÇއÇޖD$=L$D$}K,\$w$D$L$ tD$($e61\ËD$$D$@@ًD$$D$$ވÇއÇރK}w?~ R$\ÍL$ $l$ɉL$ l$}4L$ tD$($51\ËD$$D$@@ًT$*‰KB|$uL$ $+L$L$) }L$ tD$D$($\5D$\ËD$$D$@@BD$ÇޖD$K}}?~ B#\ÍL$ $l$ɉL$ D$l$}4L$ tD$($41\ËD$$D$@@ًT$*‰KBL$PK}}?~ "\ÍL$ $l$ɉL$ D$l$}4L$ tD$($041\ËD$$D$@@ًT$*‰KBȖK}y?~ "\ÍL$ $ɉL$q D$l$}4L$ tD$($31\ËD$$D$@@ًT$*‰KBȖ6PL$X $x$L$L$L$L$L$ u1PËl$\$$K~9D$%L$E1э Mh) 1ȉD$KǍD$$2$ $L$L$O>PÃTD$L$\ $$L$L$ L$L$L$ Uu1TË\$ T$(D$ЉD$J~1CL$1%0(L$1ȉD$JϋD$D$D$ $)2L$ $ \ TÃ\L$d $$L$L$(L$u1\ËD$(D$$D$0=?~D$($1 \$D$ ɉL$+ |$$uD$($11\ÉD$1ۉ;\$ }\;ʃ ~bƒW‰Eʈ;ʃ ~1ƒW‰EʈC;\$ |D$($1D$\ƒ0ƒ0뜋T$ /tЃÉсɋ ;tс #ƒa|f~ÉЃÃ`L$h $$L$L$,L$=u1`ËD$,D$(D$4Ù1)Ѓt)D$,$L0^$$D$1`$ى\$$L$7* uD$,$/1`ÉD$ D$1l$;l$$}wT$(l$ ɉ $D$T$\$( Iɉ $T$l$t9t4ȋL$D$T$ʈ;l$$|D$,$]/D$ `Ë^$$D$D$,$2/T$ t1`É$B@lD$L$t $L$xL$$L${8L$ L$,L$L$L$ u1lËD$,D$(D$4D$ $e uD$,$.1lÉD$$$D$D$ D$薱|$$l$(1ۉ;\$ }+=C;\$ |S<$t$m( D$uD$,$/.D$$$e 1lÍD$,$.D$$$e D$l+  + +=uF=C`+A+F@ArJ@Fw<+X((D$cC+X((D$cCFL$c@ar@fv@0r@9vF=+ar +fK+0r+95+ t;\$ } + u;\$ WCQCރ|$t +_t+>CF0F C l$ D$ƒ $Mƒ $M1ÁD$@D$8D$4D$0D$,D$$$ $$L$%$L$0|8L$ L$PL$L$0L$L$4L$L$,L$u 1ČËT$PD$XT$L$ L$D$DD$ϯ|$8t$@l$Lt91;\$D}=+~w +=Lr1|$$C;\$D|Ét$@4$Tb uD$P$%+\1ČÉD$H$D$D$@D$|$Ht$L1ۉ\$8;\$D3~w 3=D$8Lr-E=|$$t E E D$8E=$3$ꉬ$:D$|$Ht$L$$CD$8;\$D[<$l$Y$ D$<u!D$P$*D$H$a 1ČÍD$P$)D$H$na D$<ČÃ|$,t 3_3.u |$8 |$4u3 3 3 3 3!s 3 h|$4t*$3 @;D$D} 3 @;D$Dt @ u>D$8|$,t 3 tEȉC  E_CD$8@LrE=|$$t E E D$8뉍@ dD$8t\/@ t /@ uD/@Í/@=É$ꉬ$:D$|$Ht$L$$|$$t E E 3 uC3 |$0|$0u3 h3 [@;D$D3@ @ @"|$,t +_+.u Y|$4u+ + + +  +!s + |$4t+ tZ@;D$D} + t:@;D$Dt@ uGFC4@Lr1|$$t݉@ u1t@ t@ u|$$t+ uCF+ ?|$0|$0)+ + @;D$D@ w@ e@Sl@ #D$$ $ $-L$D$D$ L$#u É$ ` D$4 $ D$$$D$L$L$o T$ɉ$ $D$D$TD$$؉$D$ tYL$$ މ$ $D$D$D$$$D$ ,\L$ s$B@ct$\$C9|C9Sȉŋ{ KQT$1t$9D$C@D$v&1ƒu6ÉS sk1ÉD$C@D$v1뾉<$D$C@l$‹D$t,D$C@D$L$t$l$\$t1hC s1ÃT$ R \$  $L$T ÃL$ $b-L$L$L$_\$u Ã|D$L$I  1ÃL$ I T$ =|$L ÃL$ $b-L$L$L$ W\$u D$} $c-D$ D$~ $4c-D$ Ã|D$L$I  1ÃL$ I T$ $K ÃL$ $Xc-L$L$L$.\$u Ã|D$L$I  1ÃL$ I T$ $L$ÃL$$ $uc-L$L$L$L$L$ T$ u Ã|$t ^$c-D$ Ã|D$@ L$ 1ÃL$I T$ Q $J ÃL$ $c-L$L$L$T$u Ã|D$@ PL$f1ÃL$I T$ Q $gJ ÃL$ $c-L$L$ L$ WT$u Ã|$ } $c-D$Á|$ ~ $ d-D$lÃ|D$@ PL$ f1ÃL$I T$ $I ÃL$ $Gd-L$L$ L$T$u Ã|D$@ L$ 1ÃL$I T$ $~ ÃT$ B@T%tl$w ÃD$u\$uBv W$d-D$hÃ|$|D$@ L$1øÉ$dd-L$L$ L$u Ã|$ } W$d-D$Ë\$ ^L$I T$ $JH ÃL$ $d-L$L$ L$T$u Ã|D$@ L$ 1ÃL$I T$ $} ÃT$ B@T%tl$ ÃD$up\$uBv W$%e-D$Ã|$|D$@ L$1øÉ$d-L$L$ L$u Ã|$ } W$e-D$Ë\$ ^L$ I T$ $ ÃL$ $Ke-L$L$ L$-T$u Ã|D$ D$@ 1ÃL$ I T$ $肟 ÃL$ $fe-L$L$ L$T$u Ã|D$ D$@ 1ÃT$ l$\$}e-$D$ 1ËBËRT$D$ 1t$9t ( É,$D$Ћl$\$ ƒu1ËL$ Hh@D$h B ЃÁv,1B B u t É$B@v1ʃtى $ T$뵹 D$$L$L$@@Ѓ Ã\$ T$BD$ ue-$D$ É$L$\$B@ Ѓ} ËL$ $L$ AL$+t$l$ \$u Ë~ } }19~9tEAVRʍ$NIˉD$)؉\$NID$舝t$\$4$\$L$ L$F@ ЃÃL$At $L$A tA $ L$ $AЃÃ41l$(D$$D$8@=ho2t0L$8I $ho2L$h0 l$(u(=+(=+4ËD$<@=ho2t!L$C9}7u$T$AL$l$ 6É$T$l$C@ ЃË^$.f-D$à L$ $L$L$L$L$o ÃL$ $PD$|$u ËL$ $QT$tz$JL$D$ D$T$ tA t+L$ t ËD$$D$@@$B@ u$B@qL$ t't 1ËD$$D$@@҃l$\$E=ho2t%M $ho2L$$ l$\$HCM9t ^$Rf-D$[ËCM)9KQT$|$KU9sM΋C D$ KIΉt$vd1C C uL$ K ËCKIK  $E D$EMID$ڐ\$T$SS1ËKI΁v1뉋K $SRփtKIΉL$-l$\$VÉ$l$à T$B=ho2tJ $ho2L$c# T$t'L$ $T$0L$u1 ȃ Ë^$zf-D$B@ D$G1 Ã|$$\$ C~g}1s C@tKQT$|$K95CKIŃu)4$\$ C CC؃ø9~ Éρ1D$|$u ËT$L$ 9|$$}?T$$D$D$l$l$T$L$ |$$l$\$ AL$ 9|$$|L$K CljCKKMρv1i4$l$׉|$$tωL$|$$l$\$ 5à L$ $L$L$L$L$t1 -- ÃD$1D$ @9}]L$ $l$l$D$$L$$L$L$! l$T$ÉD$ t0~ D$ED$ @9|L$ $4 Ã}1É$B@Ћl$\$ 뻃1ۋD$@9}pL$ $\$\$~D$$L$ L$L$B! \$T$ʼnD$ tE~ $c3 Ã}1CD$@9|W$f-D$1É$B@Ћl$ \$릃11ۃu D$@9|؃ËL$ $l$l$D$ $L$ L$L$ l$T$ ÉD$ tE량$B@Ћl$\$1ҋD$ @9L$ $T$T$KD$$L$$L$L$ \$T$ʼnD$ tv~9L$ $T$AL$D$ t1--Ã}1BD$ @9_W$f-D$J1É$C@Ћl$T$rD$L$ $f-L$L$L$Z ^T$u1ËBu $f-D$1Ã|$}BD$|$|mB9D$}d$L$L$D$L$ $L$L$L$AL$D$ T$t t1É$B@ЃÉ $g-D$=1ÃL$ $L$L$ju1--ÃL$ $g-L$L$L$L$L$ 4u1ËL$ $L$L$L$L$à $p D$u1ËL$ I $r L$A L$ I $/ T$BЃà T$$JL$L$L$! ÃL$A@t_$$g-D$1ËQ YK|iD$ B߈ÇBވÇB݈ÇJ JJJJJJȕJȖJȗJL$ JK}--ËQ YK|ވÇB݈ÇJ JJȕJȖJŋQ YK|݈ÇJ ȕJށ$EPE] EH‹M 9ˉ$ D$ $$\$$T$߇$$$ D$$D$躇$ $D$ D$$D$蘇$ $$)9ˉ$ o--Ã0L$8 $Og-L$L$,L$L$(L$ Wu10ËL$, $} \$4D$$|$$u^$[g-D$10Ã|$(D{ CpKL$(~&1t$9u1u F10ÉC L$(KKKS+T$(։D$  $t$L$(L$L$$L$ Wl$\$4;D$(L$())KḰvU1C KKL$$ $t Y$D$$$ٱ10ËU$rg-D$Ḱv1뛋L$ $SՃtK͉L$V\$4q--0Áv1<$tL$t$\$4 =PtC W $g-L$L$(}1 ËL$ $L$L$ 1كL$ $[ T$Ãu^$g-D$1ËB~OJ $JIL$JL$\$\$ JL$I9t Y$D$$W1--à =PtC W $g-L$L$'}1 ËL$ $L$L$ 1ك T$(D$$@@D$B@T%u^$h-D$1 É$ l$\$$ƃC Ḱ1u :1 ÉD$C sKK19t$L$( $\$\$d l$$,$ML$+L$L$D$E@ Ћ|$t$l$$\$t)utM9_Mρv1E MM1 ËMρv1ߋL$ $U׃tMωL$fl$$븹P C9t$)-- ËḰv1$St$ՃtK͉L$t$\$$L$I $ \$D$|$u11ҋC9}[$T$T$*T$u t1É$B@$D$D$L$Y \$T$BC9|D$à D$$@@D$L$( $!h-L$L$L$L$L$ 蚤l$\$$u1 ËD$tW$/h-D$1 ËD$D$|$s C)9L$KL$9KL$́vY1u y1 ÉC L$KKKK+L$͍$D$D$D$ʼnD$蝀-- ËKL$́v1듉4$ST$Ճt KL$͉L$l$\$$a Ã\$ KQT$|$K9K $KSRʉL$ ÃL$$ $Yh-L$L$L$L$L$ \$ u1ËCutW$hh-D$_1Ã|$~rS C+L$9~ ËKL$vV1u 1ÉC L$KKKK+L$$D$D$D$D$--ËKL$v1떉$ST$tKL$L$m\$ hT$ ButW$h-D$^1ËJ $JL$Xà L$$ $h-L$ D$u) ` $*u1 -L$L$$ $D$l$$T$u t1 É$B@h- $ML$M L$D$D$ T$\$T$D$ t tD$ É$C@$B@Ћ\$у\$ CKI$h à D$@D$ L$ $L$ ÃL$II $r# Á$$(ZBu8D$$$D$j-D$D$ (L$$ $ $L$#c$D$s‰T$$3 T$D$u{D$$$D$j-D$D$#D$ L$$ $U D$D$$D$D$ )j- $0 D$ D$$D$ D$ D$$ x$B@huu$D$#0$D$@\$DT$HB@0tB@T%B=d-qC@D$$KL$L$ t(L$ t14ËD$ $D$ @@$B@ C;\$L|$(tdL$ $L$(L$PT$(u> t(L$ t14ËD$ $D$ @@$B@ tD$ 4É$B@$B@Ћ\$a|$,tD$,@@T%|$,BD$,@@T%*D$,@ÃL$ L$A $\$\$# t$l$Ãu%T$ t14É$B@E E$D$,@ D$t$oT$JJ $L$,L$ T$ u t14É$B@$D$D$\$‰D$ tJu(L$ t14ËD$ $D$ @@ $B@$C@ЋT$륋L$, $iT$$rW$ek-D$14ËD$,@@T%-D$,@@T%D$3uuD$,@@T%L$, $,D$(u14D$,14à T$B=ho2tJ $ho2L$b tEB# $ \$u1 X @KIHD$$荃D$ øk-$tD$1 Ã\$ CK I9}K $KCL$CЃ1ÃD$$舃T$B u $2ËJ uB $B @@ЋT$у T$B tJ $L$L$D$Ѓt 1 ÃH)lo2H)B#k- $b<L$l.L$D$ L$uho2D$$k-D$ho2D$ho2D$$k-D$ho2D$Á$ $jD$$ $jD$=v X$HS1D$1ÍD$$D$eS1D$$D$ $D$BX$D$D$뫁D$$D$lS1D$$ D$ $(D$$$D$$,D$X$D$D$F1Ã--à $ ƃD$u11}El$ ,$z t$l$ Ãut1É4$F@F E|4$ l$tMEt1É,$E@1ۃ}SE @)9t7X$S1D$[T$ t1É$B@C|MEt--É,$E@,D$(D$$B D$|$u ,1;T$0}HT$ $Q D$D$$D$D$D$D$qP T$ L$  B;T$0|L$ $L$(L$L$L$L$L$ S D$$D$@@$ u ,ËL$ $L$L$D$D$O T$} t ,É$B@ `$B@PL$ t0D$$;D$0t X$S1D$,1,ËD$$D$@@뻋D$$D$@@ЋT$ 1ҁ}$T$$MT$}1B|--Ã1t--ÉT$$ ƒD$ u"X$T1D$1ËD$t7X$6T1D$T$ t1É$B@$ T$ uT$ D$u7X$T1D$JT$ t1É$B@D$@<;I)t7X$T1D$T$ t1É$B@ t--É$B@JX$lT1D$T$ t1É$B@X$U1D$iÃ1 $ u"X$VU1D$/1ÉD$ $- D$u8Wt.T$ t--É$B@X$U1D$\$ T$u t1É$C@ uۉ$B@Ћ\$ ʃU1 $L$ L$Ã,D$( D$$D$D$(@9D$Q1/jD$$Él$D$|$HÉ\$ $4A uU1 $D$0Ѓ,ÉD$ $F T$ D$uT$ L$;L$ tV1 $D$0Ѓ, D$ D$$+@ u*V1 $D$0Ѓ,ÉD$ $D l$T$ D$ul$T$ L$?;L$tdV1 $D$0Ѓ, ED$d$$D$(@9D$ $? u{V1 $D$0Ѓ,ÉD$$ uV1 $D$0Ѓ,ÉD$$rE wi W $uV1 $D$0Ѓ,T$ L$( $> u3W1 $D$0Ѓ,ËL$ $D$D$T$ÉD$ uXW1 $D$0Ѓ,É$D t W $uW1 $D$0Ѓ,(L$ $L$L$"T$ÉD$  uW1 $D$0Ѓ,É$B  W $@uEX1 $D$0Ѓ,L$ $OT$ÉD$ buX1 $D$0Ѓ,É$L$L$T$ÉD$ D$uX1 $D$0Ѓ,É$B  W $wuY1 $D$0Ѓ,\$T$ tq1҉T$uLu1L$ t--,ËD$$D$@@ uƉ$B@ u$C@ЋT$뚉$B@Ћ\${X1 $D$0Ѓ,É$B@Ћ\$$B@Ћ\$X1 $D$0Ѓ,É$B@Ћ\$}W1 $D$0Ѓ,É$B@Ћ\$0$B@V1 $D$0Ѓ,É$B@Ћl$HV1 $D$0Ѓ,É$B@?U1 $D$0Ѓ,ËD$$ $=ÃNY1 $L$ L$<Ã@D$<@D$4D$8D$,D$<@9D$,1ۃYD$4D$D$8D$؉\$(D$|$HD$L$L$ $L$L$I u`Y1 $D$DЃ@ÍD$$L$0L$!M T$0D$uD$ uT$0D$;D$D$ ;D$} `D$D$ D$D$$L$ $L$$L$*H uY1 $D$DЃ@ÍD$$L$0L$PJ \$(T$0D$uD$uP\$(T$0D$;D$ D$;D$$ ~C~D$,D$4L$8L$8D$4D$<@9D$,J $89 uZ1 $D$DЃ@ÉD$($u-Z1 $D$DЃ@ÍD$$L$$L$K D$D$g W $u}Z1 $D$DЃ@|T$$ iL$< $y8 uZ1 $D$DЃ@ËL$( $D$ D$T$ ÉD$$ uZ1 $D$DЃ@ÍD$$\$J D$D$ W $Gu9[1 $D$DЃ@L$$ $L$(L$T$$ÉD$ =u[1 $D$DЃ@ÍD$$\$G D$D$ W $u[1 $D$DЃ@L$ $T$ ÉD$$ {u\1 $D$DЃ@É$L$(L$T$$ÉD$ )D$$u>\1 $D$DЃ@ÍD$$\$ G D$D$  W $u\1 $D$DЃ@\$$T$ tq1҉T$ uLu1L$( t--@ËD$($D$(@@ uƉ$B@ u$C@ЋT$ 뚉$B@Ћ\$${e\1 $D$DЃ@É$B@Ћ\$ $B@Ћ\$$q[1 $D$DЃ@É$B@Ћ\$ [1 $D$DЃ@É$B@Ћ\$$$B@TZ1 $D$DЃ@É$B@Ћ\$(nY1 $D$DЃ@ùY1 $D$DЃ@É$B@Y1 $D$DЃ@ùY1 $D$DЃ@ËD$4L$8؃D$L$q $5à \1 $D$L$Z u1 D$ D$$L$ L$6 T$D$ |$u蓽|$t\1 $ ]1L$ Ã|$ t*]1 $A]1L$ ù $3 D$u1 ù $3 T$u t1 É$B@$D$D$\$T$D$  D$u1 D$ D$$L$ L$5 T$D$ |$uxh|$t[]1 $r]1L$ Ã|$ t]1 $]1L$ ù]1 $D$L$X u1 D$ D$$L$ L$4 T$D$ |$uǻ|$t]1 $]1L$ Ã|$ t^1 $)^1L$ ù $1 D$u1 ù $1 T$u t1 É$B@$D$D$\$T$D$  D$u1 D$ D$$L$ L$3 T$D$ g|$u謺L|$tD^1 $[^1L$ Ã|$ tz^1 $^1L$ ù^1 $D$L$V u1 D$ D$$L$ L$3 T$D$ |$u|$t^1 $^1L$? Ã|$ t^1 $^1L$ ù_1 $D$L$4V u1 D$ D$$L$ L$Z2 T$D$ |$uG|$t_1 $,_1L$ Ã|$ tG_1 $^_1L$j ù $N/ u1 D$ D$$L$ L$1 T$D$ |$u褸|$t{_1 $_1L$ Ã|$ t_1 $_1L$ ù $. u1 D$ D$$L$ L$1 T$D$ tk|$u uT|$t_1 $_1L$M Ã|$ t`1 $.`1L$, -- 1 É$B@1 É$B@1 É$B@1 É$B@P1 É$B@$C@9$B@Ћ\$1 É$B@41 É$B@m$C@$B@Ћ\$1 É$B@$G`1 $D$L$;S u1$D$ D$$L$ L$D$ D$@ T$ D$uD$u=D$D$|$ t`1 $`1L$j$$D$s: D$ u1$ù $+, T$ u t1$É$B@$D$D$\$ T$D$  L$u1$D$ D$$L$ L$D$ D$? T$ D$uD$uaD$:D$-|$ t a1 $(a1L$@$ùBa1 $D$L$VQ u1$D$ D$$L$ L$D$ D$? T$ D$uD$uXvD$OD$B|$ ta1 $a1L$$$D$8 D$ u1$ù $F* T$ u t1$É$B@$D$D$2\$ T$D$  rL$u1$D$ D$$L$ L$D$ D$= T$ D$uD$u.D$D$|$ t b1 $%b1L$[$ù@b1 $D$L$qO u1$D$ D$$L$ L$D$ D$-= T$ 3D$uD$us D$=D$|$ tzb1 $b1L$$ùb1 $D$L$N u1$D$ D$$L$ L$D$ D$p< T$ FD$uD$u趱 D$=D$|$ tb1 $c1L$$$D$5 u1$D$ D$$L$ L$D$ D$; T$ cD$uD$u=D$D$=|$ tbc1 $~c1L$.$$D$75 u1$D$ D$$L$ L$D$ D$ ; T$ D$uD$u Pu^D$u;D$=u0|$ tc1 $c1L$$--$ùc1 $c1L$^$1$É$B@p#c1 $?c1L$.$1$É$B@b1 $b1L$$1$É$B@Cb1 $_b1L$$1$É$B@a1 $a1L$$1$É$B@$C@~$B@Ћ\$ ]\a1 $xa1L$J$1$É$B@T`1 $`1L$$1$É$B@i$C@$B@Ћ\$ ``1 $|`1L$$1$É$B@ $贗 D$u1ù* $u$ \$u1ÉD$C D$ D$$ d1L$L$ L$kT$}1ËD$ *D$ * $ \$u1ÉC D$ D$$Md1L$L$ L$1kT$}1ËD$ *u.D$u% t--É$B@[d1 $gd1L$gÉ$B@Hd1 $%d1L$=à L$( $d1L$L$L$L$L$ L$L$wju1 ùd1 $L$L$L$L$L$L$  Ã`D$8D$ ú1놃D$D$D$ pl$E1ɋT$\$ ˉT$\$N׋D$wu D$=wL$ $Ƹ ËL$ $L$L$2 ÃL$ $D$ÃL$ $D$7ÃD$$D$D$D$L$t $0z1L$ $L$ L$l$\$} ËUt-u(|$ | |$ ~,$D$JЋL$ |$ 1ÃL$ $L$L$t$ \$} ËVt)D$9r4$L$hJЋL$l$1ÃL$ $wu ÉD$ $L$L$L$D$ L$ T$ D$ tD$É$B@L$ $u ÉD$ $L$L$L$D$ D$ T$ D$ tD$É$B@D$ $U \$\9\$u tu D$$L$L$D$ pM Ëh[$c8D$wtÃD$ $ \$\9\$u tu D$$L$L$D$ O Ëh[$5c8D$ tÃL$ $ ƒ} ËD$ 1Ãt$1ҋ^l$K ȉƒF}NI! ‰$ Ã1ҋD$Xl$K ȉƒ=w $Ҵ É$y Ã|$ D$D$ot$M1ɋT$\$ ˉT$\$֋G}3OI }{1L$!ȋL$!؃ D$ T$D$%u D$=sL$ $L$L$h ËD$u D$=wҋL$ $ ú1놃D$D$D$ ht$M1ɋT$\$ ˉT$\$֋D$wu D$=wL$ $v ËL$ $L$L$ ÃL$ $L$ÃL$ $L$ÃL$ $L$ L$l$\$} ËUt-u(|$ | |$ ~,$D$ÉCL$ |$ J1ÃL$ $L$L$t$ \$} ËVt)D$9r4$L$VÉCL$l$J1ÃL$ $fu ÉD$ $L$L$L$L$ L$ T$ D$ tD$É$B@L$ $u ÉD$ $L$L$L$L$ D$ T$ D$ tD$É$B@D$ $B \$\9\$u ou!D$$L$L$L$ \H Ëh[$Vc8D$coÃD$ $ \$\9\$u zou!D$$L$L$L$ J Ëh[$wc8D$nà T$=Ot'!tt̃@u볃T$ L$t9uȃÃuh[$c8D$DL$H $L$0L$u1D$e? D$@u1D$J? D$<|$<u/|$@u1DËL$@ uD$@$D$@@@D$|$0D$0$L$(L$At|$(D$($L$ L$wL$ $bL$  $L$L$YB|$d7L$ $'L$>w D$ jL$  $L$L$.HT$ 1 $L$L$\$<u& $C@$D$dB \$<|ʼn$s T$<ÉD$8 cL$@ $\$#B T$8D$ F|$3$f= D$<|$<D$(D$(|$(lD$0D$0|$00|$<thD$<@L$< $s T$<ÉD$8 L$@ $\$kA T$8D$ tL|$L$@ $r T$@ÉD$8 tu1DÉ؃DÉ$B@Ћ\$8މ$B@막$B@Ћ\$8iL$< uD$<$D$<@@y$B@$B@Ћ\$8hDŽ$DŽ$DŽ$hDŽ$dDŽ$`DŽ$\DŽ$XB $$u 1İÉу $ L$$L$tU$$$$ $$uu 1҉Ёİ u$B@߹( $@@@ @@@@@ $@$$ $$hL$/$h $$h$$h$l$$A $l$$ $$dL$^$d $6$$$d$d$l$=u Bى$l $$J 9+$l$|$x$t$p$~t=u AX$ $$TL$$T $$T L$D$ $A$| $$BBH$x $$`L$%$` $ $`$P$$ L$$P@ $`$P$$L$$P@ $t $i$L$t $'$BBT$p $$\L$1$\ $$\ $$BB$\  $$XL$$X@$X $$X L$$BB $ $$XL$X^$X $$X L$s$L$A$%$ $|"L$T$ $L} $B@ Z$L$| $$ $|"L$$DD$^ $D} q$B@a $ $辁 $ $|"L$$@D$ $@} $B@ Q$ $$TL$ L$4 $L$|"L$$IL$ QL$4 $D$:Q y$ $|"L$$<D$* $<} =$B@- wL$4 $L$|"L$$I L$ PL$4 $D$P $ $|"L$$8D$ $8} $B@ L$4 $L$|"L$$IL$ WPDL$4 $D$O +$ $|"L$$4D$ $4} $B@ tDŽ$$B@$B@0$B@y$B@$B@%$B@BBD$ B D$$D$$$T$TD$,$T $T L$, $D$L$L$$lu0L$ $$L$$lu $؃$$DDŽ$DŽ$D$$ $|"L$$L$L$L$ au 1ĈË$ $D$A}8Z$|"D$;|$Xt D$X$TF$ĈÉ$pmD$0$D$PD$n$ $L$`L$&D$X|$XuZ$}"D$~;|L$X $L$`L$D$,$L$L$$D$,$$3Z$/}"D$;,D$(-D$$L$4 $H}"L$L$$L$L$0u1,ËAlA@(]L$$ $x T$0}1,Ãt`B@0}1$JI0L$L$\}"L$ L$,ËJI( $JI0L$L D$(D$(,ËB@(tJI( $JI0L$D$D$ L$T$0Ãt*JI( $JI0L$\$\$c \$T$0\$t]uXJI( $JI0L$D$$D$D$(D$$|$7D$$ &m D$(--,Á$A}--ËA u A, $" $u 1Ë$R " $L $‹$PC u7K, $K ‹$P $z $C؁ËK $$L$@L$t4$ t 1Ë$$$@@܍$ $r&$ $e}"L$L$Xu$ $/L$-q$d$m}"D$$D$I$d $D$\=$$r-D$$ $L$dL$L$R7D$D$$-$$hL$D dL$d $L$$L$L$L$ w}"L$D$1;L$}@$L$ $|}"L$m$u D$ u11pl$}P\$ I $x t$ l$Ãut1É4$F@X Epl$|L$ $蜜 t$ ÃtL$X ÃT$B@T%u^$'D$%1É$ =qtW$'D$}%11ہp}Qډ\$\$ I $/ \$ŃD$ u%l$ \$udT$HCp|ڋ\$ I $腠 ƒD$u@%T$uD$ --11Ã(L$0A@T%uA@T%[l$,l$ot$$4$e u1(ËL$0 $D$D$LT$ÉD$ u1(É$f t$$T$l$ljD$ uP$|$ t$$l$u}NS1p}@$ Cp|t$EeD$,ǀ p--(E1(É$B@Ћ|$ t$$l$F$B@Ћ\$^$ 'D$A@ D$*1(Ã(L$0 $1'L$L$$L$ u1(Ã|$$W$?'D$"1(ËD$$HD$$cq ǃD$u q(1(1t$ ;t$}`L$, $Y|$t$ Ń|$$ } +L$$핈> 7A 7A 7Al$$ t$ ;t$|<$L$L$L$D$  D$D$$q D$(ÃT$x$uh' $L$L$* T$ty$D$Ѓu1ÉD$ $L$L$v\$ ƒu t1É$C@t؃É$B@Ћ\$ 1Ãx$ $讬}ù' $D$@#L$D$ L$6ux$$'D$x$D$FÃD$${(t D$D$\$vV6(D$^3r;D$$D$(t D$D$D$$s+(\$u|?0\$sHD$L$\$D$\9$D$=B1|?0L$\$D$$D$\9\$|?0L$D$L$$D$\$D$$Ã(D$,$=\$D$,$5' D$,$D$'D$tn2sD$,(D$^3v.D$$D+(\$ D$ $D$,\$-(|?0\$sBD$,L$,B1$D$=B1|?0L$\$D$$ր\$ D$,L$,\$D$B1$B1|$D$\$D$$o\$ QD$,D$,(à D$$$&t D$$D$$ D$$$\$\$wV% D$tn2sD$$ 0\$vJD$D$\$D$L$d$D$$ 0\$D$$D$$\$, D$D$d$$ 0\$ăD$$I-sDD$$\$\$uD$D$$OD$\9L$D$$ւ\9ÃD$$襂('sD$ 8\$w \$sD$B1$~D$B1\$D$$~D$\9d$t$ÃD$$D$L$L$ L$D$\$ T$D$؃u.@BËD$ʉ\$ T$L$ D$ D$AÉi@B@Bt))à L$(I $ $^L$D$gT$(u B$&D$$@ ÉB#vqD$$L$L$訢 T$ tCt$D$(@$P&D$$@ ËL$$D$D$A É$B@밉L$ $蟸 \$ D$$D$ <\$}T$t L$$A=})tȃ ËA L$QtB@T%B=?1t!T$J $?1L$HT$ts$m ƒu 3T$$3L$T$t"3 $L$L$J L$5 ù3 $J L$o5 ú3럃뚋A D$L$I $- tZL$I $D$D$dl\$ƒD$uy t_t&$k8 T$ÉD$ t.t؃ 3 $L$I L$4 É$B@Ћ\$ $C@ЋT$냃 0 $""D$uD$H1 ËL$ $T$u"D$$Q#D$H1 ËL$ B BBBBB B$B(B,D$$T$D$ ÃL$  $L$L$ÃL$, $L$L$à ( $)!ƒuD$H1 ËL$@ @@@@@ @$D$,$T$T$D$ ÃD$ $"1ÃL$L$ A,$PD$D$T$ J t$!1ËB $B @@ЋT$ ۃD$@$eD$D$|L$AA tA $x!L$A AtQȋJH$R!L$AuAÃl$ \$T$jBB K JS E(CtBu"Ct$\$É$B@$D$D$l$\$T$u"$L$L$L$ L$\$T$tA$뉃0L$4AD$$L$|$4t$\$<|ESL$0K|$0u,u D$([18 u$B@Ћ\$<ًD$0̸8Ã3 $DJ=L$3L$D$ L$!uÉD$$^ D$8 $}ËD$$3D$8D$] =4[u,h<$x3D$W =$<>0D$A h<=D$$3D$h<D$]0D$$3D$=D$?0$$^4[Ãl$Eu$L 1+t +A $% t$D$u1ýEl$ 3 $K Ãu5u(L$ t1ËD$$D$@@D$ËL$ $L$L$D$ D$ t$\$ l$t t1둉$C@2u2fGC$uu$É$ $d;L$# $t$[ $$  $k;L$ ƒ$t$[ ‰$$u ?11ҁ}' /t D$CȈB|ٍL$ $\$ $ƒu$Ãt# $q;D$$T$虴 $$t*$${;D$$T$e $ n11ҁ}' /t D$CȈB|ٍL$ $\$ $ƒu$Ãt# $;D$$T$س $$t*$$;D$$T$褳 $ 11ҁ}' /t D$CȈB|ٍL$ $\$1 $ƒu$Ãt# $;D$$T$ $ t$É$B@$B@S$B@$à D$L$( $;L$L$L$L$L$ u1 Ã|$tqL$ $L$L$u[$;D$~1 É$ D$u1 Ã|$t|$t L$ȃ uL$ $D$u[$ʮ;D$ 1 É$. 뱃x D$u1D$ $ \$ƒD$ u@u!u1 u$B@ u։$C@ЋT$ ʼn$ޮ;D$T$I T$ gL$I $ \$ƒD$ t$;D$T$ T$  L$I $-\$ƒD$ <$;D$T$Ű T$ L$I $ \$ƒD$ $;D$T$聰 T$ HL$I $ \$ƒD$ $;D$T$= T$ L$I $t \$ƒD$ p$#;D$T$ T$ L$I $0 \$ƒD$ ,$5;D$T$赯 T$ %L$I $\$ƒD$ $G;D$T$q T$ L$I $ \$ƒD$ $T;D$T$- T$ cL$I$ $d \$ƒD$ `$b;D$T$ T$ L$I( $sD \$ƒD$ $p;D$T$褮 T$ L$I) $.D \$ƒD$ $;D$T$_ T$ >L$I* $C \$ƒD$ $;D$T$ T$ L$I+ $C \$ƒD$ L$;D$T$խ T$ zL$I, $_C \$ƒD$ $;D$T$萭 T$ L$I- $C \$ƒD$ $;D$T$K T$ L$I. $B \$ƒD$ }$Ư;D$T$ T$ u_L$I/ $B \$ƒD$ <$ү;D$T$Ŭ T$ uD$ u$B@ u$B@ =$B@- $B@ y$B@i $B@ $B@ S$B@C $B@ $B@ /$B@ $B@ m$B@]  $B@ $B@ J$B@: $B@ $B@|L$$ $ޯ;L$L$L$L$L$ ׼u1ËL$ $L$L$wD$L$ $@ à L$( $;L$L$L$脼u1 ËL$ $ @D$$L u  ÉD$$L$L$L$L$'h@;D$v>L$ $D$D$L u  ÉD$$D$D$D$D$gL$ $ D$ D$$L D$ à ; $+L$D$D$ L$uu É$O D$ $> D$$ ;D$L$L$ T$ $> D$$);D$L$L$ڨ T$: $g> D$$1;D$L$L$表 T$ $.> D$$<;D$L$L$h T$ $= D$$H;D$L$L$/ T$8$= D$$S;D$L$L$ T$ $= D$$Z;D$L$L$辧 T$c; $D$D$D$$p;D$ [L$s ; $ D$$v;D$L$L$G T$u u$B@ f$B@V $B@ $B@ e$B@U $B@ $B@ c$B@SL$ $> T$ u u 1ÃL$ $M< Ãt$L$ D$C\ m[F 1  % ƉCu  #Cʈ #Cʈ #CʈCȉ #C\Cu  #Cʈ #Cʈ #CʈCȉ #؃ÉCnCtCb։Cfʃ t("t\C몉C띉Cr둃4T$8JB D$ʃL$,ID$$$T$(T$ t$(D$|$u14ËL$1C"1;|$,|$0T$ r ~$l$l$\$|$0t$(l$É)؉\$ }F;L$$~L$$9t4ʍL$ $T$(T$ʛ |$0t$(\$ u14Ël$G;|$,gC"L$ $\$臛 u14ËD$4Ã\J"ACU4|$8w|$19}z; r ~9}b:vR<$t$(#L$u14ÉD$ $ET$ D$ tD$ 4É$B@E9|\$09lt$,$T$(T$ T$0D$ |$ u14ËL$ "@D$$ȉL$@$D$D$T$P|$,t$l$(\$$D$09L$T$0 ƒ r ~$t$t$\$|$,t$l$(É)؉\$$}J9~ ōL$ $l$(l$ƙ |$,l$(\$$u14Ët$ D$0D$09[C"L$ $\$~ u14ËD$ 4Ã\A"8CLt$,\ "C `uI/# $Nu ÉD$$<#L$E' T$É` tvu É$C#L$L$$L$L$(L$ L$L$,L$ At#W$L$L$T$ t É$B@$B@Ћ`ttSuT$D$u1ÉD$ $J#L$b& T$ ÉtS t'u1É$L$L$D$ DÉ$B@ЋtSƃ |$u1 ËL$ $v5 T$D$u t1 É$B@ $l$\$u8 tMEt1 É,$E@$C@Ћl$щh X Ã4L$8AD$,D$ $l$$)L$ 7D$$L$@L$D$T$ÉD$ L$ $\$ T$|$ l$$t $B@ `E|$"uTl$ȃ D$E9t$<|D$%=1ۉ;D$,|##$D$8D$D$E\~Euk9t$<}m:B5t82t-0t(1t#-#$D$8D$D$Zȃ E9t$<|%=t#C#$D$8D$D$D$( ف$ D$B3t4j닃8t6{7Om9dA8ȃ Vb3t%EtCtDփFtуaȃ ctdtetfڸ#$D$8D$D$4D$%=m[#$D$8D$D$34867h9}AQȃ D$ob5t%EtCt߃D'ԃFtσaȃ D$5ctdtetf؉$B@Ћ|$ l$$$B@Ћ\$ #$D$8D$D$(D$d#$D$8D$l$W$O#D$i4L$8AD$,D$L$ $D$D$f T$|$ l$$t  $B@ PE|$"uUl$ctdtetf؉$B@Ћ|$ l$$#$D$8D$D$(D$e#$D$8D$l$GW$r#D$W+4D$$D$ D$L$< $#L$L$0L$L$ L$(L$L$ L$L$L$u14Ã|$ u #D$ D$0@@T%tBL$0 $L$(L$L$ L$L$L$ L$$L$‰$L$$L$4ËD$0@@T%t(L$0 $L$(L$L$L$L$$L$ 밋^$#D$D$0@@ D$14à T$B@T%t $ ËB@T%t ${ Ë^$#D$B@ D$Z1 ÃD$$VL$ $AЃÃT$Bt%T$ J $L$L$D$ЋT$ tËB t%T$ J $L$L$D$ЋT$ tËBt%T$ J $L$L$D$ЋT$ tËBt%T$ J $L$L$D$ЋT$ tËBt%T$ J $L$L$D$ЋT$ tËBt%T$ J $L$L$D$ЋT$ tËB tJ $L$L$D$Ѓt1à T$BtZT$B 3B tZ T$B BtZT$B BtZT$B BtZT$B t^BtZT$B t.B tZ B t1 É$C@$C@ЋT$$C@ЋT$둉$C@ЋT$^$C@ЋT$'$C@ЋT$$C@ЋT$@L$HT$DȃD$E9}.9}eet EuOE9}-t +uE90v+@0|+@9Mڋ\$8  $l$ +L$8L$T$0Ãu1,Ã|$B=@M-tSJ $\$\$D$D$L$ tD$E9} <-t<+uE9 <0@0r@9T$4 $l$+L$4L$迉T$,Ãu1(Ã|$twB=@M-tSJ $\$\$D$D$L$ tD$8L$D$(ËD$$D$@@ى\$$D$f D$벋J $D$D$D$yD$D$&<9E@0@9D$9<0<9E$u1(E9[<0Q<9GE$|$4\$0l$,D$,p9|,`$$1$+[."-ItkNt L$( $L$,L$\$|$ $É؃9}׉@auɉ@NuL$( $|#L$\$|$ $É؃9}@nu@fq@i_@nM@i;@t)@yL$( $#L$\$|$ ;$É؃9@I@n@f@i@n@i}@tk@yYL$( $#L$\$|$ }$ËL$(I $A D$L$, $L$0AL$L$(IL$L$L$ L$4L$!$Ë YA A ;U~L# $|$4\$0u0L$( $L$,L$AL$|$ YH ȃ$1$Ãf-nttm{j YA A ;U~# $|$4\$0u0L$( $L$,L$AL$|$ BYH ȃ$1$É؃9@r@u@e(4ك(4$É؃9@u@l|@lj-ك-$É؃9G@a5@l#@s@e"ك"$à |$0\$,D$(h D$(p9|,`$1 É[y"- ItiNt L$$ $L$(L$\$|$ É؃9}׉@auʉ@NuL$$ $#L$\$|$ i É؃9}@nu@fu@ id@nS@iB@t1@y L$$ $#L$\$|$ É؃9@I@n@ f@i@n@i@t{@ yjL$$ $#L$\$|$  ËL$$I $ D$L$( $L$,AL$L$L$L$0L$ ? Ë YA A ;U~# $)|$0\$,u0L$$ $L$(L$AL$|$ {YH ȃ 1 Ãf'nttm{ YA A ;U~# $襼|$0\$,u0L$$ $L$(L$AL$|$ }YH ȃ 1 É؃9@r@u@ e(4ك(4 É؃9@u@l@ l-ك- É؃9l@a[@lJ@ s9@e("ك" Ã0D$ D$4D$L$8 $L$ ËJ uB$B@@ЋT$у D$@tIL$I $D$u-诇D$D$@$D$D$$͇D$$D$ D$L$At A$ à L$I $xu1 ÉD$ $D$D$BD$ ÃXD$$D$\D$#D$@D$D$$D$D$L$ $L$L$蝢XÃlD$$$D$pD$D$(@D$D$$$D$,D$$L$ɉL$Mu1lÉD$ $ǃu(L$ t1lËD$ $D$ @@1;\$s4|$_$@0D$\$D,D$AH|$\$C;\$r1҉;\$szD,ވÇޖȖ ~sÇރWވÇމBȖȖD,݈Çݕȕ ~/Ç݃W݈Ç݉BȕȕC;\$rD$ lÇÇ݃0χÇރ0닃DL$L $@0L$L$L$MT$Hu1DËBu|$BtsD$ D$H@$D$ D$H$D$D$D$D$1D$H@$D$ $D$$M --DÉ$D$D$D$D$BT$HBZD$ @@$ ÃD$ @@$ Ã|$I $D$D$$dD$@0D$D$D$ $D$~L$ $#|Ã|$u |$ L$ $T$ u1ÃD$ $T$ L$(|$$tuD$Á|3qD$ D$$D$$D$D$(D$D$ $苃뽋D$$D$$D$L$룉D$ $D$D$L$(wW$A0D$1Ã\D$XD$XD$$D$$D$$|$$uD$$L$d $L$hL$;A0L$/L$ L$XL$L$$L$Hu1\ËL$X $DA0L$L$L$ZJu^$FA0D$O1\ËL$ $hL$X $D$D$L$$L$ L$,L$%D$ D$$$蜣 D$ \ÃLD$LD$D$D$|$uD$L$T $\A0L$L$L$ Ju1LË _ $D$ [L$L$L$ L$ L$D$D$$ D$LÃLD$LD$D$D$|$uD$L$T $dA0L$L$L$tIu1LË _ $D$ 8\L$L$L$ L$ L$D$D$$j D$LÃLD$LD$D$D$|$uD$L$T $lA0L$L$L$Hu1LË Z $D$ _L$L$L$ L$ L$ZD$D$$ѡ D$LÃLD$LD$D$D$|$uD$L$T $uA0L$L$L$BHu1LË ^ $D$ pUL$L$L$ L$ L$D$D$$8 D$LÃLD$LD$D$D$|$uD$L$T $A0L$L$L$Gu1LË Z $D$ `L$L$L$ L$ L$(D$D$$蟠 D$LÃLD$LD$D$D$|$uD$L$T $A0L$L$L$Gu1LË <` $D$ TL$L$L$ L$ L$D$D$$ D$LÃLD$LD$D$D$|$uD$L$T $A0L$L$L$wFu1LË T $D$ ]L$L$L$ L$ L$D$D$$m D$LÃH)// $*}ùC0 $"L$D$D$ L$xuùC0 $蔚_C0 $}t2t=[C0 $`D$[$D$D$C0 $=_C0 $&t2d=8\C0 $ D$8\$D$D$lC0 $ZC0 $t2f<_C0 $D$_$D$D$D0 $菙^ D0 $xt2h<pUD0 $[D$pU$D$D$D0 $8ZD0 $!t2<`&D0 $D$`$D$D$g-D0 $<`4D0 $t2X<T;D0 $D$T$D$D$BD0 $芘TID0 $st2x<]PD0 $VD$]$D$D$Ã0D$$L$8 $0y7L$L$L$ L$(L$L$,L$L$$L$ǁu10Ã|$$tD$$L$, $ D$ uF^$7y7D$|$$u10ËL$$ uD$$$D$$@@ع $nƒuluQ|$$u(L$ t10ËD$ $D$ @@L$$ uˋD$$$D$$@@ u$B@뙉T$8~)  $xm‰D$8`L$ $ T$8D$upƃT$85 tH|$$u^$]y7D$JL$ tD$$0ËD$ $D$ @@$B@뫃|$$u D$$3$D$D$$D$nD$8$D$D$D$nL$( $L$8L$D$T$8D$$e$B@L$A}^$y7D$f1ËA D$$F T$u^$y7D$11É$D$ЋT$u1ÉD$ PL$ $L$L$u\$ T$ B B u#B t1É$B@tG$ T$ BBu t1É$B@BBЃù-J-܃D$$s2T$Bt $6T$BB uhBu=Bu$BЃËJ uB$B@@ЋT$ˋJ uB$B@@ЋT$렋J uB $B @@ЋT$rJ ZB$B@@ЋT$@L$$l$\$ E @$ډ\$E=-uk˃u`M $T$\$ \$W \$T$ D$ t#uD$ u$B@$C@ЋT$ 뜋M $ t$$l$T$Ãu t1É$B@Y\$ $t$L$ l$\$ T$+ t t1É$C@$B@Ћ\$ ӋCuU T$E M $\$ L$$l$ƒD$1à T$Bt!J $L$L$D$ЋT$t ËB t!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 ËT$Bu# T$BBu1ËBBà ^L$\$u$z7D$} ËC@T% u$z7D$} ËQYu1 u$B@\$ z7 $KL$KL$KL$ K L$KL$StKL$-ù-(L$0 $z7L$L$$L$L$ L$ L$L$L$L$;T$,u1(ËBB BBuWL$$JL$ J L$JD$=-t.L$JD$D$$D$ D$--(B֋J uB$B@@ЋT$,놋J nB$B@@ЋT$,TJ 8B $B @@ЋT$,J B$B@@ЋT$,(!D$D$/{7 $}6L$z-L$D$ L$wD$ u(1Ƀ|thL$$L $}(ËT$$LI $.L$9\$$‹DD$ $@D$DD$CL$$A|u(Ã=x\u_$!D$z1ù $dl$\$u1Eh X x\ $D$ D$ T$ D$ tD$É$B@T$ B3J $D$D$f u1ÉD$$!L$覬 T$D$u t1É$B@ $cu1ËL$ H L$ $D$D$ \$T$D$ t@ t*L$ tD$ ËD$$D$@@$C@ɉ$B@Ћ\$믋B \$  t؃É$B@Ћ\$ t! $;É$B@ $> \$ T$BBu Ãu-BB@B@BJH 1Ãl$ M 1E@9}MI t \$T$B-tC$\$xT$}$茏 1 ËB@B@BJH D$L$J--J --JЃ û-uT$Bu$D$T$BHL$B@9~zȃ ȃËB@ J9tNJI $ى\$L$菐 ƒuF|ËD$@P D$@L$H1Éى\$ $莌 T$tD$ $B@ D$B@D$DT$ 럸S>L$ $L$l$\$ } EC@KI (C@1ÃD$ @-u$ t! ƒu1ËD$ @ЃÉ$B@҃D$ @ ƒt)B=$u$ƒu1ËD$ P ЃÃD$ @ƒt)B=$u$ƒu1ËD$ PЃà D$L$( $!L$L$L$\4L$ L$L$2u1 Ã|$uX|$,uQ--D$L$ $L$L$D$L$ tD$ ËD$$D$@@|$t=L$ $/ D$|$u1 Ã|$,tD$$D$,D$8 z ȃ,D$L$4 $!L$o8L$L$$L$ L$ L$\4L$L$L$1u1,Ã|$|$8--D$L$ $L$L$D$(L$ t?L$$ $L$(L$@T$(} t1,É$B@Ѓ,ËD$$D$@@묃|$tAL$ $ D$|$u1,Ã|$8XD$$D$8D$ ? ăT$Bt $T$J tdJ t8J t $胊 ËB$B@@ЋT$׋B $B @@ЋT$뫋B$B@@ЋT$녃L$ $!L$o8L$L$L$ /u1ËL$ $L$L$}1--ÃL$ $!L$/T$ u1ËBt$T$ B-J tQ-J -J t-J--ËB$B@@ЋT$ ̋B $B @@ЋT$ 뒃L$ $!L$.\$u1ËK $SHK L$T$ƃu1ËH J N F N JNFBt$4$JIL$|$t$}t1É4$F@1G@9}.G@ F@ OI EG@9|ҋFOIHËF$t$F@@ЋT$t$3F $t$F @@ЋT$t$-0L$8 $!L$L$L$U-u10ËL$4I $L$L$\$4ƒD$$u10ËCK $L$L$T$$Ãu t10É$B@$\$ \$\$ T$$D$(  |$(u10ËL$4I $L$L$^t$(ƒD$ut10É4$F@N ЃL$4I  ȉF L$4I $L$L$|$4t$(ƒD$tN ЃO ȉFG4$OIL$|$4t$(D1G@9}SOI l$, $L$L$h|$4t$(l$,Ãu FhF@ EG@9|FOIH<$蛮 t$(L$ $D$D$t$ T$t$(D$, t|$,0É$B@Ћt$(ދF$F@@ЋT$|$4t$(F $F @@ЋT$t$(a$C@$B@Ћ\$ -- |$G@T%t]_ 1ҋG9}<{u1BG9|1 Ã<}ut T$D$ tD$É$B@ L$ $!L$!u1 Ã=XUu_$!D$c1 ù $jM\$u1 X XU $D$D$蘮 T$D$ tD$ É$B@ l$\$Ct}^$!D$c1 ËC@9}ًC@ C@  à L$( $!L$L$L$o8L$ L$L$ T$$u1 ËBu$D$T$$|$}B@D$|$}D$B@9D$~ B@D$$L$Lt$$}1 ËFh;l$~F@ NI IM;l$D$F@ L$L$F@-- ÃL$ $!L$T$ u1ËBtB=-tJ $ $W ÃL$ $ !L$T$ u1ËBtB=-tJ $% $V ËL$Au1ËA@ÃL$$ $!L$L$L$L$L$ u1ËL$ $ D$|$u1ËL$ $L$L$D$L$ tD$ËD$$D$@@L$ $!L$u1Ã=0Uu_$+!D$E`1ËL$ $L$L$ND$ H! $ 0UL$L$ L$ÃL$ $M!L$o8L$L$L$ t$u1ËFuW$W!D$_11F@9}F@ ;D$F@9uW$u!D$e_1ËNI tAFHF@9}"F@ NI IEF@9|--ËF@ $F@ l$@@Ћt$l$됋NI l$ $L$L$脊 t$l$%EL$I $`} u1ù! $D$ L$L$L$yT$ D$ tD$É$B@L$$ $!L$L$L$L$L$ ;T$ u1ËBu$D$T$ $>u1É$L$L$L$L$ }1--Ãt$ \$l$Et} ^$!D$u]ËE@9}֋E@ 8t)E@ 0t1É<$G@EHދE@9}ҋE@ MI IF܃uu u$C@ u؉$B@Ћ\$NjL$ I, $\!L$\$T$T$ i \$ƒu; t%L$ uD$$D$@@o$C@u$B@Ћ\$뫁$($D$ D$1ҁ} TB|L$ $L$$$L$_!L$ $(Ńu 1Ë@=t!MEt 1É,$E@u 1ہ}<t3C|MEt É,$E@ʃ$D$D$L$, $L$0L$w!L$/L$ L$L$L$L$<-u1$ù41 $V D$ u1$ T$ BBu$S 1$׭ T$ BBuB$R D$ $R 1$øc< <:<L$ $<L$!L$:T$ BBu1B$qR D$ @$bR D$ $VR ?1$Ã|$T$ D$|$u;B$dDD$ @$R D$ @$R D$ $Q 1$ËL$J L$ $!L$Bl L$ AL$ $!L$&l L$ AL$ $!L$ l L$ A L$ $!L$k L$ A$L$ $!L$k L$ A(L$ $!L$k L$ A,L$ $!L$k L$ A0>L$ A$L$ED$ @$V D$ D$0FD$ @$ʞ D$FD$ @$C D$+FL$ A(tA$ D$#FL$ A,tA$ D$EL$ A$ D$D$FD$ $ËD$YD$@${BT$B0B,B(IB$B BBuuJ tRJ t/J t $O ËB$B@@ЋT$݋B$B@@ЋT$뺋B $B @@ЋT$뗋J {B$B@@ЋT$aJ IB$B@@ЋT$/J B $B @@ЋT$J$ B$$B$@@ЋT$J( B($B(@@ЋT$J, qB,$B,@@ЋT$WJ0 ;B0$B0@@ЋT$!L$ I $L$$L$L$(L$L$,L$ ZED$46t1Ã|$ukL$ I $KD$L$ $;ND$L$ I $pLD$L$ I $LD$ D$$D$D$D$ D$1--ÃL$ $!L$ku1ËL$ $!L$D$L$ \$ƒu1ËC @=N#u) tK $É$B@Ћ\$C0t2 tK0 $!L$W É$B@Ћ\$׉ЃÃL$ $!L$L$L$L$L$ u1ËL$ $L$L$L$L$D$ à L$( $!L$L$L$8u1 ËL$ $!L$f D$|$u1 ËL$ $!L$L$r \$ƒu t1 É$C@@=$1BL$$ $уL$T$JL$D$ >\$‰D$ tJu(L$ t1 ËD$$D$@@ ,$B@$C@ЋT$  tmL$$ $!L$D$L$ ƒtD$$@ @=N#tЃ tL$$I $* É$B@$C@놉$B@Ћ\$i,-D$L$4 $!L$$L$L$ L$ L$L$4L$0u1,ËA @=N#t^$!D$11,ËQ D$ B fL$ J B$%B$B(B(B,B,B0bT$$B0D$=-u# ! $DL$$A(--,ËD$@@T%u^$Q!D$11,D$(D$@9D$(}_L$(T$H A@T%tȉL$D$$$!L$UT$u)D$$P$D$(D$@9D$(|--,ËL$ $*!L$T$$u:D$B(u L$J(뫋J( uB($B(@@ЋT$$ԋL$ $.!L$趨T$$u^D$B,u-L$J,D$0@$ D$ D$.>/J, uNjB,$B,@@ЋT$$밋L$ $7!L$:T$$u^D$B0u-L$J0D$0@$ D$ D$=J0 uNjB0$B0@@ЋT$$밋W$>!D$D$D$61,ËJ0 B0$T$$B0@@ЋT$$pJ, MB,$T$$B,@@ЋT$$/J(  B($T$$B(@@ЋT$$J$ B$$T$$B$@@ЋT$$J B $T$$B @@ЋT$$l|$- $$L$$L$蕎 t|3$ $!L$|u$Hȃ|Ë$ $!L$Mu $H ϋ$ $!L$$u?D$$!D$D$D$ D$~L$ $z@|Ë`$$D$.-1|Ã$H)N#o8H)41! $,!L$D$D$ L$BD$ u$ӟ D$u$yD$D$$!D$D$D$q !$L$L$L$D$ D$p u$ËL$ $D!L$ tUL$ $P!L$ 0Up"tA= ȹ\!L$ $g!L$o x\L$ $p!L$T ,$O)%D$!ËAt A 8A 8u&$} ËD$@ƒ tƒ u5$} L$u1L$AƒtËAu-$ʉL$} ËD$@`,$6)%D$A D$A D$ É$ʉL$m} ËD$@ ƒu $ʉL$6} ËD$@T$Bu?$[ T$BBu B BB$1ËJ uB$B@@뢃D$L$ $|T$ }1ËJ $r ƒumT$ u2B uBu"B @t0T$)%D$ 1É$T$ |BD$BD$ËD$ @(T$$=D$L$ $<\$|$IL$D$D$ƒu2 t0T$)%D$q$C@׋L$ $ʉL$L$\$} 7$C@' t2L$ $D$T$ Bz$C@ t1É$C@D$$T$B uyBuNBu#BtB$e T$$QËJ uыB$B@@ЋT$뺋J uB$B@@ЋT$돋J wB $B @@ЋT$] T$B t!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 ÃT$ B tZ B tZBtZB t.BtZB t1É$C@$C@ЋT$ $C@ЋT$ 땃$D$x' $u1$@ @@@@@(D$$T$} t1$É$B@L$, $)%L$L$L$ L$ L$L$L$+T$u t1$É$B@L$ $Wm T$BBu7^$*%D$T$ t1$É$B@L$ $L$0L$T$B B u t1$É$B@$:D$$ËL$AAà D$$@ D$H $8\$D$|$u ËD$$pt$D$$@~|$4tC L$$IFt$|$4tD$0D$L$(T$ ݈Ç1|$Ç݃uu|$u|$,u3D$0t|$4t|$4tC L$$IF ÃCu 0T$E*%D$ ËD$0C 8ÇtC8ÇCuot?Cu 0T$*%D$ Ã|$4tCL$$IF|$4tÇ݋L$$IFt$D$C 8ÇuCt.|$4tC L$$IFcD$0TC 8Ç0L$ $ȕD$ɉL$5|$t$D$\$H|$4tC L$$IFt$ L$\$C9~]Cu^șCCtC$_ \$K $7_ T$BBu A1 ø ËCD$șCK $KL$_ T$BBuD$$)_ T$1 ÃL$ $L$ L$L$(L$L$$L$ D$}1ËL$ $D$u1ËL$ $L$ L$L$(L$L$$L$ L$1T$BBÃL$I I $w4\$u1É$KD$L$Gu1ËL$I I $`4\$ƒu1ËCKȉ$T$D$D$ϩD$L$HÃ,D$0@ D$(L$4 $H u 0T $n*%L$8,ËL$4 $I D$$}1,ËD$0$D$ D$ ;D$$L$4 $L$ L$M ƒu1,ËD$(@; D$B@T%L$0 $щT$L$L$L$|$$L$ T$D$ t`|$u1,D$ D$ ;D$$EL$0 $+T$0u1,ËJ $*%L$JL$JL$ Z ,É$B@1rT$-uVL$0 $*%L$L$L$|$$u3L$ T$D$ >$B@.1΋B=@M-J $@M-L$.;T$$- \$‰D$ tau1,ËL$0 $уL$L$L$|$$u3L$ iT$D$ $B@1Ή$C@ЋT$뎉$* \$‰D$nT$$' T$uD$1D$L$ $7e Ńu^$*%D$ 1Él$,$e T$t}L$ $D$ D$l$\$ ‰D$ t=uMEt1É,$E@ u$B@Ћl$냉$C@Ћl$T$ tZ t1--É$B@ԃD$$T$B uNBu#BtB$Y T$$虽ËJ uыB$B@@ЋT$뺋J uB $B @@ЋT$돃 T$B t!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 Ã\$ C tS C t.CtSC t1É$B@$B@Ћ\$ $D$Є" $詻u1$@ @@@@D$@L$, $*%L$L$L$ L$ L$L$L$T$u t1$É$B@L$ $*%L$x; T$BBt_J $H tOL$ $L$0L$T$B B u t1$É$B@$LD$$Ë^$*%D$\T$ t1$É$B@ X $ Ã$D$L$, $+%L$L$L$ L$ L$L$L$u1$ËD$ @=P-t!L$ I $P-L$6L$ $L$0L$u1$Ë X $L$ L$D$D$1 T$} t1$É$B@ t--$É$B@^$+%D$ 1$à X $L$L$O } 0T $*+%L$k--ÃL$ $]ÃD$ UD$L$$ $:+%L$D$L$ L$L$mu1Ã|$tCD$@@T%u^$K+%D$ 1ËL$ $H  UL$ $G Ãx% $k}ùx' $U}ùЄ" $?}ù+% $T'L$L;L$D$ L$uÉD$$+%L$+%L$,uex XuËL$ $+%L$D$m*túx~7Bt5L$ $JL$T$ L$H+T$uÃBux%L$ $+%L$x%L$)tù+% $D$D$ 0TuËD$$+%D$L$)à Y|$|W$.D$E1 Ãt!JYhg<L$ L$JЃ ù $R ƒu 1 ÃYL$ } hg<BYÉ $R T$$D$ЃD$u1$D$D$T$u t1É$B@BB BBBB B$BЃÃ\$Cu^$.D$1ËCK @D$ KKC CuCuCCD$ ËC D$C $\$T$BS C=Ƀ\$Cu^$.D$l1ËCK@D$ CKC C>uCuCCD$ ËC@D$C$\$T$SCɃ\$C C=u;K $D$KL$]\$ƒu1ËC PS CD$CCCK L$HCt CK9--É$D$u։$B@Ƀ\$C Cu:$KL$KL$\$ƒu1ËCSC>D$CKCKL$HCt CK9--É$D$u։$B@ɃL$ $Z ƒtu$B@׋L$ tt1--ËD$ $D$ @@̃T$$D$ 9uM$`E u1ËL$ $D$ D$T$ D$ tD$É$B@$%Y D$|$u1ËD$ @uL$ $ËL$ $Y \$ ʼnD$C C=uyK $D$KL$l$\$ ƒu@MEt(L$ t1ËD$$D$@@,$E@ˋC PS CCCCK hC?CK91$D$&$B@L$ tt1--ËD$$D$@@̃T$$D$ 9uM$C u1ËL$ $D$ D$T$ D$ tD$É$B@$UW D$|$u1ËD$ @uL$ $6ËL$ $W \$ ʼnD$C Cux$KL$KL$l$\$ ƒu@MEt(L$ t1ËD$$D$@@,$E@ˋCSC>CKCKhC@CK92$D$$B@L$ tt1--ËD$$D$@@̃ L$ $L$L$JƒuЃ tD$D$ É$B@\$ CD$D$|$1ËD$$99D$$C |$$Cu>$KL$L$L$d\$ ƒu ËCSC>l$$C@9~kEC9~kC)K$C)K  D$l$D$薖T$\$ )S)S)T$$CBC D$ C $5T$ \$ BS C=|$$|$$C=u?K $D$L$L$n\$ ƒu ËC PS Cl$$ؕC>)9~ C>)ŋC=)9~ C=)ŋCK  $CKD$l$D$腕T$\$ SST$$C>'C@D$ C$#T$ \$ SC|$$1ËD$$|$T$$D$$9~ D$)D$$9D$$D$D$$D$ L$ $.L$L$ L$買u1ËL$ $L$ L$/u--1ÃL$ AD$y qiA=D$D$D$;D$}8T$@$T$ IH $HF>u(D$@u--ËD$@D$1Mut׋?=D$눃,L$0YQAD$ D$A D$1l$;l$ }tT$$\$(@$L$4L$L$' l$\$(T$$~WD$D$0@ 9D$t_$.D$1,B>uCuL$ $: ,Ë[1Eg}1,ËD$@à T$$BD$1ɉL$;L$BJ@$L$(L$L$& T$$B;D$t^$9.D$t1 Ã~V$D$t.L$$ $L$L$u1 -- É$B@Ń}$D$D$1 É$D$T$$L$AL$;L$W$X.D$1 à D$@t6L$ $D$duՉ$B@ЋD$@uʃ ÃL$ l$˃E9u}]@ËEH9u}] EC!‰։ș>׋E9}]Nt[M]IC!‰)] Iv^$x.D$1à L$ $L$ىL$9u ËL$ $D$tL$ $L$L$ É$B@ۃ t$$\$(~@D$ \$9|$,u4$\$V ËFøC!‰Չؙ>T$(D$;D$ R^Mt [MuD$,L$(hL$(L$,HMEt1 É,$E@NˉIC!‰)^ It^$.D$ ÃD$$O--ÃD$$L$A$t $iL$At $ D$@$L$AA $AЃà t$$VntbN 9uaFD$ ;\$ B\$l$@t&$L$,L$D$(Ћt$$l$\$t C;\$ ~1ҋmu1 ø=뛃T$Bu$J $.L$T$D$ ? ËJ $.L$T$JL$ D$Z? à L$$ $.L$)% D$uL$$ $7 \$T$$Ńu!u1 u$C@Bus. $JL$l$l$D$|$u*L$ tD$ ËD$$D$@@L$ uɋD$$D$@@봹. $JL$l$l$JL$ D$넋Bu2. $JL$l$l$-L$ \$cD$J. $JL$l$l$JL$ \$3D$L$ $L@ t}1ù. $4ËL$ $D6 T$D$u$@ 1ËB. $JL$" \$ƒu( tD$$@ 1É$C@T$ $\$\$T$ D$ t* tD$$G@ D$É$C@߉$B@Ћ\$Ź. $I\$[$.D$.D$L$( $? t9}$D$ .$D$,D$%D$ $1$ËL$( $I D$ u $D$ .$D$,D$ױD$ $L$ $I D$<D$ D$$D$,D$蕱D$ $^D$D$L$ $L$,L$D$ T$tM t7L$ tD$($> $ËD$ $D$ @@։$B@ 7$B@'D$($}> T$ tit $PT$(L$,D$ Bu# .$L$蜰D$ $e1$É $ .D$BD$ԉ$B@늃,l$4\$0D$$D$ C= /t0K $ /L$+l$4\$0u(=+(=+,ËE= /t!M $ /L$l$4\$0tƋSM|$8u&9u(4(4,9t"",Ã|$8u&9u"",9t(4(4,É$yF D$(|$(|$(u[|$$u2|$ u(4(4,Ã|$ u"",1,ËL$$ uD$$$D$$@@묋L$( uD$($D$(@@냋L$4 $E D$$|$$aL$( $F D$ u>L$$ $lF \$ ‰D$$T$L$H \$T$ D$|$uW$\$L$8L$! \$T$ D$ t $C@$B@Ћ\$ t& t|$z$C@$B@Ћ\$ɃT$ L$/D$8otWt;t9uD$ 1uD$ 1tD$ 19tD$ 1t uD$ 1tD$ 1 )$B@ $C@ЋT$4D$0D$,D$(.D$%.D$ D$$L$< $L$@L$,.L$L$L$ L$0L$L$,L$T$(u 4Ã|$,t D$,=-uZD$8PD$8$|$0t-L$8 $L$0L$bƒu 4t14É$B@L$, $- ƒD$(uT$(u)xW$6.D$4ø4à t$(N^ك=C!‰ʼn,$|o ÃT$Bu--ËJ $* Ã8)9 $諚\$ u1ËKH KHXK HKHD$$&D$à T$BtJ $L$L$D$Ѓt 1 ÃT$Bu $ËJ uB$B@@ЋT$у \$C@ K9t$C_$ .D$1 ËCu1 ËCK PCKC>uCЃ ËK IK CL$I $( Ãn; $S\$ u1ËK H KHXK HKHD$$ΗD$à \$Cu1 ËC@ K9t$C_$T .D$1 ËCK PKKCuCЃ ËK K C=D$P|tp-th$D$D$PTuËL$ $L$ L$D$D$ T$} t1É$B@Ѓù $L$ L$Ju1Ë W$L$ L$mT$ t1É$B@T$B|u$J $-L$T$D$ 5 ËJ $J|L$T$D$ 5 Ã$T$(B|B|=- $J|L$}L$ u1$ËL$( $ .L$ .L$D2 T$ u t1$É$B@ $L$(IL$T$-L$ -L$D$D$\$ T$D$ t tD$$É$C@$B@Ћ\$ $!\$ C|tS|C| t$\4ЃÉ$B@Ћ\$ D$ D$$ .D$ܦD$ $L$A|D$ D$$ .D$袦D$ $vD$ D$$ .D$xD$ $L$ $L$L$D$\4ЉD$)D$ D$$ .D$+D$ $JD$ËA|$D$D$D$ aL$ $\4ЋT$ D$u1ËB| . $T$Ãu t1É$B@ . $ى\$L$уL$\$T$D$ t tD$É$C@$B@Ћ\$ыJ| $=1 T$tN} t1É$B@ . $ D$D$ @|$1 \$T$L$ I| $z D$σT$B|t!J| $L$L$D$ЋT$tÉ$L$L$L$L$\4ЃÃ\$ C|tS|C| t$\4ЃÉ$B@Ћ\$ $T$,L$(L$ A|D$D$ B@T%Z\$ ~+B D$$ \$ T$,uD$=-$L$\$ \$ƒu $ÃuoD$ X|L$( $T$T$L$0L$0]4Ћ\$T$D$ t#uD$$ u$C@$B@Ћ\$덋^$3 .D$$$\$Ck . $D$C#L$D$ L$D$uù / $j} /D$$x .D$ /D$\4q4(q4 $j}(q4D$$~ .D$(q4D$I8)9 $xj}ùn; $bj}ÃÃl$(|$$} W$ {3D$ÃuL$ $/ Ń} ËD$$9D$$l$(L$ $D$D$ u ËL$ $D$D$D$w l$(T$ÉD$ t5} Ãtl$D$$9|D$$ËD$@D$$^$B@Ћl$(\$ 붃4D$(D$$L$< $L$@L$.{3L$l-L$ L$0L$L$,L$L$(L$L$$L$u14ËL$0 $L$,L$L$(L$L$$L$ r}14É$S 4Ã8D$(D$$L$@ $L$DL$K{3L$-L$ L$4L$L$0L$L$(L$L$$L$u18ËL$4 $L$0L$L$(L$L$$L$ ƒ}18ËD$4@=$u2L$4 $T$L$0L$ }18--8ËL$4 $^{3L$e{3L$T$ L$0L$) ƒu18u$B@뤃l$(|$$} W$h{3D$ÃuL$ $h Ń} ËD$$9D$$l$(L$ $D$D$R u ÉD$$L$ L$D$ l$(T$ÉD$ t9} ÃtD$@D$$D$$9wD$$Ël$Z$B@Ћl$(\$ 벃4D$(D$$L$< $L$@L${3L$D~7L$ L$0L$L$,L$L$(L$L$$L$u14ËL$0 $L$,L$L$(L$L$$L$ n}14É$ 4Ã8D$(D$$L$@ $L$DL${3L$X~7L$ L$4L$L$0L$L$(L$L$$L$7u18ËL$4 $L$0L$L$(L$L$$L$ ƒ}18ËD$4@=$u2L$4 $T$L$0L$ }18--8ËL$4 ${3L${3L$T$ L$0L$& ƒu18u$B@뤃|3$3D$l!D$D$ D$ÃT$-u É$H#L$H#L$L$ L$ ;& u ÉD$$ T$D$ tD$É$B@=]uH# $N]u1SDD$$ ]L$z tRtML$ $ ]L$X D$ $L$L$4 u1ËL$ $L$L$ 1ÃH# $N]ÃD$ut1Ë] t ]؃É$B@Ћ\$H# $YÃD$ut1ËY t Y؃É$B@Ћ\$@I# $_ÃD$4Ut1@Ë_@@T%uW$I#D$1@1ҋ_@9_@ T$8L$TD$0$L$0t%W$1I#D$D$8D$ 1@ËA D$,QAD$$AD$ AD$$L$HL$&D$L$ $L$PL$D$ L$D $L$$L$^- D$L$ $1 T$8|$t|$ u1@Ã|$tD$uT$8L$u؃|$t|$uEB_@9t $@ËW$\I#D$r1@Ã|$ ttD$L9uL$, $@ t _2$B@Ћ\$4T$u ËL$ $T$T t$ tÃ|$ t!L$ $L$L$(4L$V 1ÃL$ $ u1Ãu~I# $ËL$ $D$u1ËL$ $}1Ã|-D$\$  $I#L$L$Dt L$ ȃËL$ $L$L$߃D$|$,$` u ù $L$$L$L$(L$D$D$ ‹L$ $T$T$L$h\$T$D$u#uD$ u$C@ uԉ$B@Ћ\$ù $L$$L$L$(L$qD$$D$I#D$$D$ h$ $I#L$i $uĜùI# $#u:h"$I#D$袕$ tĜÉ$B@싄$$$L$D$ D$$$D$ $$$D$D$ I#$$D$s $$$D$D$~ I#$$D$8 $$t\$ t uA t $$D$ I#$$D$ ĜË$$$D$$D$D$  Z$B@J$@@*D t#J# $YT$($@@̋ $D$L$( $1\$ŃD$}\$l$|@.t D$(ډ I $1puۋT$\$ I $g1yuT$\$ I $K1ctT$\$ I $/1ouL$ $L$IL$T$(;BD$$H L$,MR  L$ $ `VL$G T$u1 ÃuRD$PT$$ `VL$ u1 ÃuW$J#D$]1 ËD$ Ãu^먃0L$< $L$,L$L$L$L$(L$ L$$L$Iu10ËL$8 $L$4L$L$,L$L$L$ L$(L$L$$L$D$D$ L$, tLL$$ t*L$( tD$ 0ËD$($D$(@@D$$$D$$@@D$,$D$,@@럃(D$ D$L$0 $L$4L$ K#L$l`-L$ L$$L$L$ L$L$L$+u1(ËL$$ $L$ L$D$ |$ u1(ËL$$ $L$ L$L$L${(Ã`D$LD$HD$DL$h $L$lL$jK#L$)L$ L$\L$L$XL$L$TL$L$PL$L$LL$ L$HL$$L$DL$(bu1`Ã|$D=UuK# $Uu1`Ã=WuK# $蹈Wu1`ËL$D $K#L$Oo D$@L$D $K#L$6o T$@tD$L$, $K#L$T7 Wu.u K# $jWu1$ÉL$ K#$L=PQ=\D $ʳ D$D$u1Ã=Pu =\ 8Z $ L#L$L$D$T$R  a $L#L$-PL$D$T$R ~fL# P $T$t$l$FU 19s0E uMEt1É,$E@C9rЉÃtL#듺%L#댋 W $L#L$>L$D$T$R ,L# $bL$51L$D$ L$D$uP_uL$ $6L#L$D$}/ ]uL$ $>L#L$D$}ùLL# $wYuËL$ $TL#L$D$[}ÃÃD$ $6mT$ YtAT2| $h ÃL$tATBuVB u+$nL$tITAXtċATv 뵋J uɋB $B @@ЋT$ 벋J uB$B@@ЋT$ 뇃 T$Bt!J $L$L$D$ЋT$t ËB tJ $L$L$D$Ѓt 1 Ã\$ CtSC t,C tS C tÉ$B@$B@Ћ\$ à T$L$t&B=@)t)$YD$1 ÃtߋA=v6uչ@) $fll$\$ƒt5u:ju.Z T$K$ډ\$l$ IL$l$\$T$rCtE뺋D$$h1ۃuC19$ډ\$l$ IL$Tl$\$T$CtE뺉$)1 ùH! $#HT$ÉXtT$B u7Bu $9ËJ uB$B@@ЋT$ыJ uB $B @@ЋT$릃L$ $ u1ËL$I $D$ D$ \$ ƒD$t" tЃÉ$C@ЋT$ W$q!D$_\$ T$뿃 L$I $L$L$! u1 Ë@  Ã\$T$$L$ ȃ%ȃt>T$!D$؃D$uL$A8$A,D$t1ù $4 u1ËL$ $L$L$D$ D$M T$ } t1É$B@ tnL$0 $L$L$-L$ T$$}1Ãt$L$L$ u ËL$$ $L$L$Z }1É$B@녉ȃF $I u1ËL$ $L$L$D$ D$b T$ } t1É$B@ tiL$( $L$L$-L$ }1ËL$0 $L$L$ tL$0 $L$L$} }1øÉ$B@늃t$\$ \$3|$0tL$0 $\$ D$@$tL$Q( ӉY( $ u1ËL$ $L$L$D$ D$) T$ } t1É$B@ t É$B@ $ u1ËL$ $L$L$D$ D$ T$ } t1É$B@ t É$B@ $ u1ËL$ $L$L$D$ D$9 T$ } t1É$B@ tHL$Q( ӉY(L$, $L$L$-L$ }1øÉ$B@뫃(D$D$ $V D$u1(ËL$, $L$L$L$$L$L$ L$  D$ @uNjL$0 $L$$L$] tL$, $L$$L$L$L$ }*L$ tD$(ËD$$D$@@L$0 $L$$L$t u|;1D$렁D$HBuB u DËB(uB(tۋJ(ň!B tptwtfD$$,D$!D$BD$ L$͑T$D$D$9|$HA8$A0D$Ή1DøDÍD$$,D$D!D$BD$ L$[댍D$$,D$ !D$BD$ L$-[!0D$L$4 $L$L$L$,L$L$(L$ D$(@D$L$8 $L$,L$/ T$@ ‰$踼 u10ËL$4 $L$,L$D$$D$ T$$} t10É$B@ G$B@7 $B D$u10D$L$@ $L$L$L$,L$L$(L$ VL$4 $L$,L$M |$Dt@GtA $迻 u(L$ t10ËD$$D$@@L$4 $L$,L$D$D$ T$}> t(L$ t10ËD$$D$@@$B@ $B@L$< $L$,L$a L$4 $L$,L$L$L$ L$ t10ËD$$D$@@L$ t 0ËD$$D$@@TD$DD$@D$<D$8D$4D$,D$( D$H|$H)|$H|$D|$@|$<ua|$8u8|$4u|$,uD$,TËL$4 uD$4$D$4@@ϋL$8 uD$8$D$8@@릋L$< uD$<$D$<@@zL$@ bD$@$D$@@@JL$D .D$D$D$D@@L$H D$H$D$H@@ D$D|$Dt D$<|$<` D$@|$@L D$8|$8D$X@u?L$< $L$dL$V T$\ZtL$@ $T$4 1E@9}|E@ t$0D$ $L$@L$L$8L$L$s1(Ã~} :n1҃uZ19}[щ$$ꉬ$ @$D$$0$ $$$,u 1(BtE9|n1҃uW19щ$$ꉬ$ @$D$F$ $$$,u 1(BtE릋n1҃uZ19}[щ$$ꉬ$ @$D$$0$ $$$,u 1(BtE9|n 1҃uZ19}[щ$$ꉬ$ @$D$y$0$ $$$,u 1(BtE9|n1҃uW19щ$$ꉬ$ @$D$]$ $$$,u 1(BtE릉$NL$$0u 1(ËB$, $JL$1(Ãn1҃uZ19}[щ$$ꉬ$ @$D$B$0$ $$$,u 1(BtE9|C@ IC@0:CNH0,n1҃uZ19}[щ$$ꉬ$ @$D$$0$ $$$,u 1(BtE9|C@ C@0CNH0$NL$H$0$,u 1(ËB@0u BKH0Ct_BH $KL$$0u 1(ËB $, $J L$1(ËBH t*$NL$y1(Ën1҃19щ$$ꉬ$ @ƒ$$$T$6$} 1(à tcȃD$$D$%!D$T$ rq$, $L$L$$0IL$u 1(Ë$, $$L$L$ $ $$$,u 1(BED$$D$\!D$T$ pNLC> l$$\$( q0tJt  É,$KL$u1 ËL$$ $L$(I L$u1 Ë[1҃u=19}T$\$@,$D$M\$T$l$$u1 BtË,$KL$X1 ÃtkD,$KL$u1 ËL$$ $L$(IL$u1 ËL$$ $L$(I L$1 Ã=4\=4\u1 ËC@ tTCp 1҃uA19}AT$t$@,$D$Jt$T$l$$\$(u1 Bt9|,$ 4\L$D$\$ KL$;u1 ËL$$ $L$(IL$\$(T$$u$\$}1 É$KL$\$(T$$u$\$O1 É$\$=1 ù! $^l$$\$(4\s1҃uA19}AT$t$@,$D$!t$T$l$$\$(u1 Bt9|[1҃uA19*T$\$@,$D$\$T$l$$u1 Bt뽃 tv,$KL$u1 ËD$(X1҃uA19T$\$@L$$ $D$x \$T$u1 Bt뽋[1҃uA19QT$\$@,$D$\$T$l$$u1 Bt뽉,$\$q1 à t$ ,$\$ 1 É,$\$1 ËCt,$KL$\l$$u1 ËMQ( ӉY(E@(cT$!D$3VD$$$D$(@D$c1 à ),$KL$u1 ËD$(X1҃u=19}=T$\$@L$$ $D$m\$T$u1 BtË9|ËD$(X 1҃u=19}=T$\$@L$$ $D$\$T$u1 BtË9|ËD$(@t"L$$ $L$(IL$u1 ËD$(@L$$ $L$(IL$1 É,$KL$u1 ËD$(X 1҃uA19T$\$@L$$ $D$I\$T$u1 Bt뽉,$KL$X1 ÃI@;,$KL$#1 ÃtX[1҃uA19T$\$@,$D$\$T$l$$u1 Bt뽋[1҃uA19T$\$@,$D$<\$T$l$$u1 Bt뽉,$KL$SuL$61 ù,$KL$u1 ËL$$ $L$(IL$1 Ã! $L$L$ nu1ËL$ $D$ D$L$T$ u t1É$B@ t É$B@l$1ۃuN19}O\$PugL$ $JL$L$vl$\$u1CtE9||$ uL$ $l$zu1øËu*|$ tL$ $\$l$\$u1ËT$!D$vQL$$A@,D$_1Ã\$1uE19}El$Pu(L$ $JL$D$l$\$tEt9|1à t$l$Et)4$ML$L$yt$l$EtD4$ML$L$t$l$u1 ËNQ( ӉY(EtD4$ML$L$t$l$u1 ËNQ( ӉY(Et4$ML$t  1 1 ÃT$Bt"L$ $JL$T$u1ËBt"L$ $JL$tT$u1ËZ 1҃u=19}=T$\$ @L$ $D$$\$ T$u1BtË9|øà T$(J.D$D$$.L$\$$)ىL$`D$u1 ËL$ $!L$^\$$T$t;$T$@L$T$D$ tD$ É$B@C@tDC@,$!L$D$V\$$T$u t1 É$B@CH  t  É$B@L$L$BL$ $L$ L$u1ËL$ $L$IL$u1ËD$X1҃u=19}=T$\$ @L$ $D$N\$ T$u1BtË9|øÃL$ $L$IL$ u1øÃl$T$ttxt(t É,$JL$u1ËZ1҃u=19}͉T$\$ @,$D$l$\$ T$u1BtËBt",$JL$Rl$T$u1ËBt",$JL$(l$T$u1ËB 2,$J L$1ÁD$$D$!D$$IA4A4D$ \aL$ $u 1Ë$ $D$D$L$T$u 1 t É$B@,D$4 tD$([D$$D$<@L$0 $D$ HL$T$8u1,ÃL$0 $T$D$L$4L$ D$l$0M\$(Q( ӉY(,$D$T$0u$D$4D$&1,Ã|$$t$lT$0h$L$ L$8l$0u,$D$4D$1,ËD$ X1҃uM19}MT$\$@,$D$l$0\$T$u,$D$4D$1,Bt9|\$<uM19}MT$\$@,$D$l$0\$T$u,$D$4D$#1,Bt9||$Dt/,$L$DL$@l$0u,$D$4D$1,É,$L$@L$\$4T$0u$\$1,É$\$,É$D$4D$1,1,11 ]T$$t8ȉD$L$ $T$L$L$JL$ JL$D$-ù! $X T$$]뱃 D\T$$t8ȉD$L$ $T$L$L$JL$ JL$D$ù! $ T$$D\뱃 \T$$t7ȉD$L$ $T$L$L$J L$ JL$JL$hù$! $ T$$\벃p$ $D$jMD$|$} |$$b2|$~>L$ $L$L$L$L$^G} =V tԃ$$2D$$xL$)L$롃|$ 1 =D$ $ $D$LD$D$ $&=|$} [$$D$F<T$ D$ L$ $L$L$T$FT$ } =V tԃL$pD$ $<L$I}#`$MD$$wË_$$D$D$ D$MʋD$$w1L$)ʃT$ Hx|$t$\$ 19s"iCÞ&%2E9rރÃT$} W$$D$8MÃu1ËL$ $T$Oà <D$D$=$Zt $Z= H$FD$$4@? {:0 $f˹ B  ( @-$ ' à =hZu m-$%/=u1 ÉD$$mAuD$$?1 ÉD$$ED$ L$Aխ L$A- $-L$ӭD$tW$T$BBu; D$$1AD$$[ED$$hDD$$?1 ËB- $-L$]|$tun:uD$ É$XT$B B qB D$D$$脪L$A $-D$AD$ f=<_u뀃L$ AD$; Yt-$_$L$ At-$F$L$ D$@9u4u-kD$$-<$'DD$$=ø-$#ċL$tuÉ |Z|ZËD$YÃ\` YutȃÃt1D- $WO- $xƒD$uX-$g#T$$ˊD$$u-L$ u=- $D$ tAL$ $-L$D$ T$ uu u$B@減-$"T$ ΃- $rƒu, $u$B@T$uä-L$ $T$T$$l$\$T$$t/$l$T$;D$|$ t D$$HD$É$l$L$ L$T$ Ã|$$uD$ D$$D$ Ǥ- $;u7Ϥ- $-JD$D$ˤ-$D$D$褈T$Ԥ- $u3ܤ- $ID$D$ؤ-$D$D$[T$u'L$ $L$ L$L$$L$> u1 uЉ$B@ q$B@aD-D$(-D$$D$ - $6D$8t$#WƒD$87v;- $D$4t$VƒD$4D;$Fl$4T$8uEu&u DMEu,$E@ uщ$B@Ћl$4L$H $L$LL$L$L$(L$ L$$L$L$PL$L$ L$D$,D$y\$4T$8D$0 |$0u/D$,$E|$ uk: DDù- $臨uD$,$EDÉ$܆L$0 $L$LL$D$D$ L$PL$L$,L$D$8D$,$`ET$8uD tt91DÉ$B@ $C@ $B@Ћ\$4@@T%$YD$$@@T%$XD$(L$( $-L$L$( $-L$|$,g%D$D$L$ $uLL$ $L$L$L$ L$ uD$L$ ;D$tD$ $ND$D$1øà D$@DÍD$ $1D1J1+117L\$d)  ȋ ȉD$$L$P $L$TL$@-L$L$XL$ L$\L$L$`L$L$(L$L$$L${ T$dÃuD$DD$DƒtDL$$ \$ $T$L$TL$L$lL$ D$HD$ $ D$HLÍD$($L$htȋL$(1L1)1 11@L$D $L$HL$@-L$L$LL$ D$D$L$$L$L$PL$jz D$ uD$$$L$ ȃ@Ã4L$8 $@-L$L$$|$ |$@D$謤D$ $0D$D$ D$`st0t0t1BE%FT$ -+ ɋ ;tBB.t ɋ ;tBt BuBA0u IA0tA.uI $\$)؉D$踣Bd01D$$T$4-+T$t ɋ ;+D$D$,.UT$Jɋ ;\$(tL$4 $D$(@;D$8|$$L$ȃ$ȉL$@D$D$,D$ɢl$,T$B.@‹D$4D$8)Ѓu10É$D$D$N1L$IL$ |;D$}D$4$D$4010ËL$4 $/\$D$4)@D$ T$($\$D$ D$(D$$D$ D$D$(D$[BT$I1D$ T$eED$,;D$ t!MEt 14É,$E@$B@Ћ$$ ME$@tN$@ $ƒtS$, $S-L$$(T$ $(u$ t$04É$B@u 14 u$B@,$E@Y$B@Ћ$$$ W$S-D$$$ t 14É$B@D`$8D`Kl$T$11Ƀ 9u؃)WtR#:tt t tuCBŋ@Y$S-D$Ã&t؃(u̓uCAIǃ]t,t:t[u܃{t׃}uك$D$|$4}1$X D$ u1$D$D$;D$4L$( $L$,L$L$8L$D$uD$--D$L$( $L$,L$L$8L$pƒuD$--L$ $L$L$T$T$f \$T$D$  |$ |$D$D$;D$4#|$ tD$(;D$0u|$0tD$(D$ $ËL$ t!D$ @Y$S-D$KʋD$ $D$ @@ʋL$ t1$ËD$ $D$ @@$C@1$B@Ћ\$T$,D$}1É$J|$ ŃD$u11t$;t$,}Q<$L$$L$L$0L$|$ t$l$ÃuD$--E Ft$;t$,||$tMEt1É,$E@;D$(t5MEt@Y$S-D$1É,$E@փ|$(tÃ1ҋL$ t BuЃÃT$,D$}1É$j|$ ʼnD$u11t$;t$,}Q<$L$$L$L$0L$|$ t$l$ÃuD$--X Ft$;t$,||$tMEt1É,$E@;D$(t5MEt@Y$T-D$1É,$E@փ|$(tÃ(t$4T$,\$0[EH,vtԃ tσ tʃ(t@Y$pT-D$V1(Ë $)L$D$L$, $L$0L$)L$L$L$ L$4L$M(Ã:WBt!Du3v<$? (à I $L" (à I $8" (ÃNItDKt$L"J $JL$Ne(ÃJ $JL$df(Ã@D$$d! 9D$$vL$$ $lW(ËL$$ $! (Ë&uhX$Ճ(ÃHL$$t@Ntȃ(L$$u@Y$LT-D$L$$σOtS3y $]L$#D$L$, $L$0L$]L$L$L$ L$4L$o(ÃktnfRtb_ctd A$y (Ã@D$'L$' $L$(Ãhir@D$$ 9D$$vL$$ $U(ËL$$ $* (Ãu9lns h#u{tePu -ȃ(Ã}6l$ ,$wl$ =vW$*T-D$1(ɉ,$T$믃P뙺뒃 I $X (Ãh#uWtAPu -ȃ(Ã}l$ ,$l$ ‰,$T$舚ӃP뽺붃z{ $}L$D$L$, $L$0L$}L$L$L$ L$4L$J(ÃD$L$ $D$D$oÃD$L$ $D$L$Kà L$ $L$L$D$( à L$ $L$L$L$ à D$$D$L$ $D$\$,‹D$(D$}1 Ãu-- ÃuL$ $L$L$\$Y ÍL$ $L$L$D$T$ \$) ÃD$$L$ $D$ u1ËL$ $D$D$D$IT$D$ tD$ É$B@L$ $L$$L$D$u1ÍD$,L$( $D$T$u t1É$B@$D$D$D$I\$T$D$ t tD$ É$C@$B@Ћ\$уT$B=?1t!J $?1L$ T$|$ u*u^$T-D$kÉ$,u8L$ $,D$ @Y$T-D$D$ D$É$L$L$L$ L$ T$ t  t1É$B@^$T-D$ÃL$ $+ u ËL$ $L$L$D$ D$T$ u1 t É$B@L$ $pu ËL$ $L$L$D$ D$RT$ u1 t É$B@T$B uËJ $T$ =~ ËL$ $\$\$|\$tC1ɉKËK T$  CK T$ CCCL$΃\$T$t#$D$D$D$D$ L$D$|t=@ I 9r \$$D$\$T$C뾋 AA BJ9t BB ׉\$$T$\$T$뺃T$ \$@ I 9%$D$莱T$ \$tC@ I 9r%$D$VÉ%JBCK9t%KCȉ%$\$뭋 AAсfCK9tCCсG%$\$T$ \$$l$ \$ @ I 9%$D$jl$ \$q@ I 9F%$D$*l$ \$@ I 9%$D$l$ \$tC@ I 9r%$D$貯É%JBCK9t%KCȉ%$\$>뭉%JBdCK9t%KCC%$\$l$ \$%JBCK9t%KC%$\$l$ \$} AA&CK9tCC%$\$0l$ \$t$ \$$b@ I 9@l$D$ t$ \$$Fu$\$AËNF؉ʼnL$HEu~KCËN$\$1ۋD$H9}W\$T$ P 1ɃL$}4ЉT$%$D$$D$}\$T$L$AL$|CD$H9|L$T$ HȉL$%$D$$D$1L$uكÉPF AAlCK9tCCll$\$t$ \$$4l$8\$@ I 9r t$D$l$8\$@ I 9r#?$D$\$$D$9l$8,$ T$CK9tCC>>$\$l$8t:@ I 9r<$D$l$8 AA.t,W$fF1D$1ɋ$dHȁ` . .$d $|=$P$苟$\$\u11퉬$T;$P}Y$d $$TÃuc轵u^$iE1D$Y$\ tDŽ$\$\"$\$$\@@΋$\X E]W$>E1D$1U$C1D$ϴ11$d $?=$Pr$L<S$*$\$\u1GDŽ$T$T;$P}P$d $-ucku^$F1D$$\ tDŽ$\$\$\$$\@@΋$\ $$XD$[$XuU$\ t# t DŽ$\덉$B@拄$\$$\@@Ћ$X t $T$B@$W$E1D$1""Rt4ItN--$d $$d $6ƒ|?$d@@9}.$d@@ $\$\$\EW$D1D$>1'StT(4(4 ,` ,`$d $=$P$X$\$\u11퉬$T;$P}Y$d $$TÃucбu^$E1D$l$\ tDŽ$\$\5$\$$\@@΋$\@ E[W$E1D$1sfgncLf$d $d I $dR9$d $蘎L$H $$PD$$dL$$P9uYD HD$H$D$D$\$@\9\$@u \uD$@$J 1U$C1D$ޯ1$d A A %7$dI$dR9s$dAA t_$+F1D$c1LDŽ$0DŽ$,DŽ$(DŽ$$DŽ$ DŽ$DŽ$DŽ$DŽ$\$d $$D$d $o$@$d $Y$<$d $C$8$d $$4$42$4$0$,r$(2$$$ $uv$uA$u $\$ u䋄$$$@@ɋ$ u$$$@@딋$ v$$$@@X$  :$ $$ @@$$ $$$$$@@$( $($$(@@$, z$,$$,@@\$0 :$0$$0@@$4 $4$$4@@$d $<$0$0$d $$,$,$d $$($(b$d $$$$$>$d $$ $ $d $$$$d $d$$$d $$$d $*$$$D $$@L$$<L$$8L$ $4L$$0L$$,L$$(L$$$L$ $ L$$$L$($L$,$L$0$L$4觱 $\$@ $L$$dL$tU$C1D$,1$@$D$ ݜ$8\9ܜ$8u 6u݄$8$fD 1itl$d $$d $4D$4L$4 $ r$d $=$$PD$$\$\u1 $\ $$PL$$dL$R;$PtI$\ tU$D1D$ب1$\$$\@@ǃ$Ltu8$\$0l$dI $$\L$蕢}1d$\XW$|D1D$Q1:x=tu$d $ƒ==1u $D$$PT$$dL$ $P$D9t&$U$E1D$萧1y$\$D$È$\$D$ɱ$\C=v1N$Pt $*$P,W$D1D$1$d :$d I $dR9$d $τL$H $$PD$$dL$$P9D HD$H$D$D$M\$8\9\$8u菦K$d $d I $dR9$d $L$H $$PD$$dL$$P9uaD HD$H$D$D$葘\$@\9\$@u ӥu<$t$8ԁ [1TU$D1D$M16$d A A %/$dI$dR9s$dAA1U$D1D$դ1$d A A %$dI$dR9s$dAAy{@o $\$\u1<$d $=$DuLtt$\ tDŽ$\$\$\$$\@@΋$d $$Dƒ$@t%$\$\$T$m% $D$@ t&> 1$B@!$C@Ћ$@ƍ$@ $L$$dL$tU$>D1D$1$@$D$ւ ݜ$0\9ܜ$0u$$@ $L$$dL$tU$]D1D$蔢1}$@$D$P ݜ$8\9ܜ$8u 螢u<$$0~ #11$d A A %R$dI$dR9s$dAA% th"$F1D$d1 ËL$ $D$|$u աtD$ Ë^$F1D$i߃$D$(D$D$1D$D$L$ $$Ã$D$(D$D$1D$D$L$ $$Ã,L$4 $]dD$L$ $L$ L$tD$0@,ËL$0D$D$A,Ã$D$$D$(D$D$ u D$wL$( $$ËD$ u D$=wڋL$vT1tljD$$L$L$L$L$(L$ UaL$ $D$D$D$$xD$$ËT$uT$ u1ۉ$닋T$\$ (D$,D$$FD$ D$1D$D$L$ $D$L$ tD$(ËD$ $D$ @@(L$,D$L$T$0 D$$̔D$ D$L$ $0D$L$ tD$(ËD$ $D$ @@ WD$ t&tt $F1D$՞蟤 $F1D$蹞,D$ $2L$WD$|$u1,ËD$D$L$ $T$4L$L$ D$D$T$(J D$$D$0$D$ D$|$$|$ttT$D$)=~?L$ tW$G1D$ݝ1,ËD$$D$@@΍L$ $L$)щL$At1,Ã|$t;|$uD$$1,ËL$ uD$$D$@@̋D$,ËL$$ *D$$$D$$@@1@D$L$H $:G1L$L$L$L$L$ L$L$E[u1@ËD$@=+t!L$I $+L$"L$ $<~ D$ D$,1D$4D$0D$$D$(|$~v D$8D$D$ D$$|$$D$$@=?1t!L$$I $?1L$XL$$ $&D$ dP/tQ=StH8$L$D$S L$D$ $L$D$-D$h> L$u8z3to=StH8$T$D$T$L$ $T$JL$= u-D$ $D$D$L$= T$uL$ $H8L$v= D$$|$$tkD$$@=?1tL$$I $?1L$!t@=St H8$FD$$$gD$$H8D$-D$T= D$0D$4L$ $L$4L$L$(L$L$$L$ [ D$$uȋD$(@@T%tD$$@=?1tL$$I $?1L$ZtD$(D$,$H8L$n dL$, $ I8L$P F=St I8$D$,D$4D$$$UD$$D$(D$-D$* D$0|$0D$4L$ $L$4L$L$(L$L$$L$ > D$(@@T%tD$$@=?1tL$$I $?1L$HtD$(D$,$I8L$\oL$, $*I8L$>Q=St.I8$D$,D$"D$$$CD$$D$(D$-D$ L$ $?I8L$: D$$|$$tkD$$@=?1tL$$I $?1L$nt@=St CI8$D$$$D$$RI8D$-D$: L$ $VI8L$8: D$$|$$tkD$$@=?1tL$$I $?1L$t@=St bI8$D$$$)D$$yI8D$-D$: D$$ \$T$C t,CtSC t8É$B@$B@Ћ\$Ë[Ã=_u _u1$L$ L$#9 ƒt+@=?1tFT$J $?1L$ֻT$u%@Y$I8D$D$ D$1É$u1É$8) u1Ë_$D$$D$L$ L$8 T$ tЃÉ$B@ЋT$ _u1É$L$ L$>8 D$u1ËL$ $ku1ÉD$$u1É$L$L$$ t1Ã=StI8$D$D$D$ D$D$ÃD$$L$L$7 ƒt1@=?1t!T$ J $?1L$OT$ tЃËL$ $u1ËL$ $L$L$D$ D$7 T$ t t1É$B@ tЃÉ$B@ЋT$ CD$$L$L$6 u ËL$ $L$L$7 } I8$u à L$ $L$L$D$ à D$L$$ $u1 É$D$$J8L$:6 u=kD$ L$ $J8L$L$ L$c6 tD$$$1 1҃|$,t L$, $芝ƒD$u ۏT$u D$(P0L$ $*J8L$T$T$5 T$t 螏T$ L$( $L$L$L$L$قƒTtDL$ $L$$L$A5 u%4_$3J8D$D$$D$.1 É$B@믉$B@oL$ $ #;D$v1ËD$$D$D$L$ L$e$l$ \$=`Tto+@؃øcL$$ $aJ8L$Lu1ÉD$$;[t0=StdJ8$D$$D$PD$$N1ËL$ $T\$$S;D$ t(txJ8$\$ D$$IN1ÃtJ8$\$D$D$D$ÃL$ $ju1ÉD$ @=;#t?4_$J8D$D$D$耏T$ t1É$B@ȃÃL$$ $x;[t%4_$J8D$D$ D$$1ËD$$$?L$ $L$$L$5ƒD$u1Ã=St!J8$D$D$D$ D$T$L$ $T$L$ L$ T$D$ tD$ É$B@0D$,Qu10D$$L$8 $L$4L$L$D$ D$L$$L$D$D$ D$jt$$L$4L$D$L$ L$ $D$,D$ $VD$,0ÃD$$7nL$ $L$L$L$}1É$J8L$XKÃD$ @f‹L$ $ʉL$u"=StJ8$D$D$UË[$L$L$D$$D$D$D$D$$D$D$D$&L$ $wIL$ $_JutD$$D$D$NED$$$D$D$D$D$$ID$$J=StK8$D$D$bÃ=St K8$D$D$@D$$}JD$$lÃL$ I0 $L$$L$\$ uËS0L$(K0C0 tYCD$D$@D$ 1;\$ };\$T$H A=;#u $D$$D$D$(D$w\$C;\$ |ŃÉ$B@Ћ\$ 떃L$I0 $D$L$ $L$L$Fu1ËL$ $Ŗ\$u ËK0$L$L$D$ D$\$ T$ t t É$C@$B@Ћ\$ ЃPL$\ $vFD$ L$ $L$0L$t%_$'K8D$D$XD$t1PËD$HD$ $軋u 艈PËL$X $D$(D$L$)D$$t!L$X $L$L$D$sL$X $L$\L$kÃD$ u-uD$($襌1P u$C@؃=St!lK8$D$TD$D$XD$\$ |$$tFK8 $ \$ uz1|u$$D$$D$D$0D$D$D$ \$ L$T $\$L$XL$T$ D$ tD$($݋D$PÉ$B@߉$d\$ wL$$ $D$,D$ D$ D$,$G\$ $L$XL$5\$ =St!KK8$D$TD$D$$D$}\$ D$$D$X r$ $tD$$$D$D$ $$tL8D$3 $$$lD$ $l$$D$ $l $^$lt.$$L$p $l${<-ĔË4_$vL8D$L$x$C@!$B@Ћ$$h-D_$L8D$ qOT$ $T$L$$L$L$(L$ L$,L$L$0L$L$4L$ËT$Jt Jt1øÃr\$$ t ,É$C@|$tsL$0 $?\$$tʼn$襼D$L$0 $/\$$tL$ $O8L$D$D$ T$\$$D$ tp|$ gL$0 $\$O8L$\$$ƒD$ ; t t ,É$B@$C@ЋT$ Љ$B@Ћ\$$|mO81H L$ $|u1 ÉD$$T$D$ tD$ É$B@u1É$L$L$ tn\$R8D$D$D$xf1 É$B@ΉЃ L$( $L$L$L$L$!ƒxT$ -hL$0 $|T$ t t1 É$B@D$0$D$D$D$D$J\$T$ D$0D$4$B@QȉA)$$L$L$-L$ Ã,L$0 $UR8L$ϐu ,D$(L$4 $L$(L$I ƒu' ^ $_tc,1,ÉD$$@@T%u7^$^R8D$:]T$$ t1,É$B@B* |$@t D$(IL$0 $R8L$ruab֋L$0 $D$D$L$8L$L$u t1,É$C@ $C@wu$T$B@Ћ\$$T$렃T$-u Ã|$u*L$$ $L$L$ T$D$u ËB=?1tIJ $?1L$KT$u,$L$ L$L$L$ }1øÉ$u1É$L$ L$L$L$c }1Ã8[D$4$L$DL$ T$<tȃ8D$(D$-D$, $cu _8L$D $L$@L$L$,L$D$$D$ L$L$L$L$(L$T$,ÉD$ !u9D$$$d 4_ $[u18_--8ËL$D $L$L$L$$L$KL$ L$(L$D$0|$(|$t D$$L$< $L$0L$L$DL$L$@L$ L$4L$T$0u uD$0D$$$LcL$0 uډ$B@͋L$( oD$($D$(@@W $B@Ћ\$ $R8L$D$,2]--8ÃTc@@D$LT$XD$HD$DD$@D$(|$LuR8$B1TÃt'B=?1t:J $?1L$7T$Xu^$R8D$W1TÉ$Ru1TËL$H $D$8D$ T$89D$Xt!4_$S8D$T$^1TËL$L $T$ tTËL$L $L$8L$L$XL$ }1TËL$8 $.L$V\$8\$4 $_T$Du$u \T u$B@L$8 $L$4L$T$D$0D$ L$L$(L$L$@L$TT$DÉD$,u@|$@uD$0$`1TËL$@ u܋D$@$D$@@@NjL$8 $L$(L$L$0L$KL$ L$@L$D$$|$@uO|$(t D$($|$$uD$H$D$8D$D$XD$ yD$0$`D$$TËL$@ uD$@$D$@@@ $B@Ћ\$,$D$4)ىL$ gu 1TËL$H $D$ D$ T$ ÃD$uE4_$+S8D$ЃD$\T$ t 1TÉ$B@ t,D$4$VS8L$JD$D1Z$B@Ћ\$Ã0D$(D$ =dUuc_S8 $.Wu10ùjS8 $HWu10ùwS8 ${S8L$wdUu10jD$,$ HWL$S[ l$(\$,ƒD$$uguDu%uD$ 0MEu,$E@ u҉$B@Ћl$( u$C@Ћl$(T$$랋B@T% $ WL$Z \$,T$$ŃD$(u$ W$WD$Rl$(\$,T$$l$(/,$S8L$L$4L$\$ \$ dUL$D$D$s l$(\$,T$$D$ $ WL$舆\$,T$$녹S8 $D$D$D$ D$u10ùS8 $ HWL$D$$D$6ul$(T$$ÃD$,S [%D$%D$ %D$ %D$ L$ $L$c Ã$?GD$|$u1Ë\S8 $ L$KL$\$KL$ mt\$u t1É$C@$D$D$TK\$T$}BL$ t t1É$B@D$$D$@@ЋT$ t @D$É$B@Ћ\$ك0D$ $Y\$8ƒu kV0-u1$L$4L$\$T$ T$ L$L$L$D$%l$ Ãu,$Z10Ã|$L$ $l$\$$KL$L$ =: l$ \$$ƒu,$YZ10ùS8 $T$,T$l$ L$ KL$KL$rT$,D$( tD$ $ ZD$(0É$B@ߺ-똃D$L$ $S8L$L$L$L$L$ t u1ËL$ $L$L$rÃL$ $S8L$L$L$1 u1ËL$ $}1Ãu--ËL$ $uȃL$ $S8L$L$L$ u1ËL$ $}1Ãu--ËL$ $)uȃL$ $S8L$L$ L$K u1ËL$ $ÃL$ $S8L$L$L$ u1ËL$ $UD$ L$ $IÃL$ $S8L$L$L$ u1ËL$ $5u1ɉ $P ËH \$T$u@UuT8L$ $T$vD$uY$_TL$ȃ É$. D$uW$T8D$LL$ʃ,D$ L$4 $T8L$L$(L$L$$L$ +L$L$ L$ u1,ËL$$ $L$ L$.T8L$u1,ËL$( $L$$L$D$D$D$|$ u D$$9D$,Ã,D$ L$4 $1T8L$L$(L$L$$L$ +L$L$ L$& u1,ËL$$ $L$ L$CT8L$hu1,ËL$( $L$$L$D$D$D$|$ u D$$D$,Ã@$L$D$XD$D$TD$ L$$L$,L$C9l$40$t#$  /t $L$,L$KË$(tՋ$|tƋ$:t$;t@Y$ى#D$D$l$0T$(\$$9t? t) # $L$DL$L$TL$L$XL$ @É$B@ʉA1EEu? t)B# $L$DL$L$TL$L$XL$ 6@É$B@ʋM $L$\L$ L$T$(t? t)Q# $L$DL$L$TL$L$XL$ @É$B@ʋD$0$ЃD$D$$@D$\$(NAv1BtA $.l$0T$(D$$D$@@Ћ|$Tt$Xl$(\$LT$DlD$<tu1 /# $T$|$t$ @Ãnif9h6@D$0$aT$Dt%ȋ# $T$L$TL$L$XL$ @É$fD$,|$,ud$|$,}@W$ދ#D$## $L$DL$L$TL$L$XL$ !@Á|$,~@W$#D$#@# $L$DL$L$TL$L$XL$ @ËD$0L$,fӋ# $L$DL$L$TL$L$XL$ @Ã@D$0$\$(q#t)*# $L$DL$L$TL$L$XL$ S@D$(D$03@D$0$T$Dt%a# $T$L$TL$L$XL$ @É$/eD$,|$,u"|$,~@W$w#D$h"# $L$DL$L$TL$L$XL$ @Á|$,}@W$#D$"͌# $L$DL$L$TL$L$XL$ M@ËD$0L$,-l# $L$DL$L$TL$L$XL$ @Ãklk@D$0$T$Dt%# $T$L$TL$L$XL$ @É$cD$,|$,u !uD$0L$,# $L$DL$L$TL$L$XL$ l@Ã@D$0B@T%t$eD$,D$0L$,$B@T%t$蔞D$,ӹ# $T$|$t$ @ÃustA@D$0BXPD$D$T%=.=pD$,9$t D$T% D$TD$PTD$T%=u(|$4tL$T9D$Pt~$t-D$P$D$(D$D$P\$P+$D$P$D$(D$wl$P\$P\$PuNjD$,;$D$T%D$TD$Pmk)ʉѸBD$T%6|$P+s$D$D$$\$p|?0\$h\$pT$TЁT$DD$P\$Hl$TPD$P$L$h\$XD$XD$P\$PD$T%=||$Lu|$HtID$TD$PD$$$FD$$:D$$.D$$"T$7D$$$ D$$D$$D$$D$$4D$TPL$TD$,;$c|$4XD$D9LD$p|$fD$ l$ \$ l$D$ D$ D$ l$p\$p$u|$Pt-0.\$pc@b-\$pJD$T%u-\$p(|$4tv%D$P$;L$h\$XD$XD$P\$P;\$prHD$p0$\$ l$ L$ wL$ D$ }<\$pt(D$p\$hD$h\$`)D$dD$`\$hcd$pԃ|$PuCD$T%u5\$pv0\$pd$p\$hG0L$p\$p|$Pu|$Tt\$p\9\$hD$,;$]0L$p\$pt D$p\$hd$p|$PuD$T%tl$,D$T%+D$4|ݍD$P$D$(D$0 0l$P\$P\$)Xډ1ۉ$-A_D$TP $$ډуtՠ'|$P\$P JȃtD$4j1҃~#ȃt\;L$P\$PB݃|$4tD$T%k)‰Љу\$Pg |)D$P5| D$Tpωу!D$T뽸!D$P밃$$')|$P\$P*B d$@9}\$| ȃЉD$@BA $CDŽ$+-ك0u CŃ0t9$\$x1Ƀ0|9~e+D$x MNwE$$t$؉$;\$x$$DŽ$N뵸 Cx1dDŽ$C/$t$$CI1C1DŽ$C\$1҉ȃ9w Bȃ9vT$$Xu1ËL$à L$ $t$\$Ńu1 ɉCtBt Ã\$ KC$Á$$$1D$|$P|$Dt D$D;D$@u@|$@tD$@$|$Pt<$|$t D$$E1ĸËD$D$|$P뮋D$(%ÃD$$\$4d$8L$8?D$XD$40; ,g8@1؉\$D$ 4\$D$|$ fD$l$\$l$ L$\$vȉL$D$\$}D$|| F$)HDŽ$D$lDŽ$L$h$L$l D$`~ D$`D$x$$$Y"  $|$P$D$|$T$T$| 1 $|$$T$t$\$p|$xtJ|$X$3$D$l $t\$pT$t|$PD$@|$@P~ |$lB$|$x~XL$@ $\$Q|$PD$@|$@L$@ $|$%D$LD$P$0\$p|$L|$P$)؃t<$D$ǃD$P $T$h|$PD$<|$<}~#L$< $T$|$PD$<|$<UD$d$|$xL$< $L$lL$$|$PD$tD$l~<$T$bǃD$P|$l~'L$< $L$lL$8|$PD$<|$<|$|<$L$1 \$T$|J t0 tD$D$;D$GD$ É$C@ى$B@Ћ\$뿃u> t(L$ t1 ËD$ $D$ @@$C@ u$B@Ћ\$먃4D$DD$0! D$u14ËL$8 $}K u14ÉD$$t(L$ t14ËD$$D$@@D$@D$(D$$D$$;D$(}OD$@ L$$L$8 $D$ D$- @ ;D$tكtԃtσPătt;1 ø ø Ã)9t. t !t( ø ø ø Ã*t+ ø ø ÃA:\tQ69t.3t 4t5 ø ø ø Ã7t8t 9U Ã>0t%;tL$ $ډ\$ IL$Y-\$l$u1CtËE9|¸D$L$ $L$ IL$Pu1ËL$ $ `L$L$5\$l$T1Ã$$`D$u ! $[ƒ$`u1$ËL$( $T$L$,L$D$ o @Yl$(T$,u1$Ët9t $!D$D$ 1$É $!D$\1$É,$JL$Nl$(u,$1$D$,$L$L$4qD$ D$($RD$ $EZ1҃uE19}T$\$@,$D$+l$(\$T$u,$1$Bt빉,$JL$l$(b,$1$Á$I $$L$$$I I $D$4$I I $ݳD$0$II $D$,$II $襳$D$(D$:$^D$!D$$D$ A@D$D$4D$D$D$0D$D$,D$ D$(D$$D$:$6$ȁĜÃT$ $T$JL$蚁u ËL$ $D$D$ T$ÉD$ tu ËCÉ$B@Ћ\$ ڃ8l$@\$L$ $ډ\$ IL$J\$l$u1 CtËE9|¸ Ãl$$M1D$1;\$EHL$b! $\$\$Ku1ËL$ $D$ D$L$k/T$ u t1É$B@ t;L$ $L$L$)Il$$\$u1C;\$KÉ$B@븋E\$u1D$ 1;T$D$ @T$@D$|$ $L$u1ËL$ $L$L$=u1ËL$ $L$u1ËL$ $IL$T$\$u1B;T$RD$ @ tH|$ t%$JL$Ru1øÉ$HL$-u1Ã|$ tԉ$L$ u1É$D$<u1ËL$ $GL$T$\$A1ËD$ @<(L$, $D$$u1(ËL$0I $h9T$0urB tMZ 1҃u=19}=T$\$@L$, $D$\$T$u1(BtË9|ËD$,$D$$D$(ÃuKZ1҃u=19}ΉT$\$@L$, $D$\$T$u1(BtËB fL$, $T$0D$ u1(ËL$, $JL$L;u1(ËL$, $rL$L$ L$L$ u1(ËD$0X1҃u=19}=T$\$@L$, $D$\$T$u1(BtË9|ËL$, $nL$L$$L$D$ u1(ËD$0@ D$,$D$ D$OD$0X 1҃uA19\T$\$@L$, $D$>\$T$u1(Bt뽋D$$D$ (L$, $#D$$L$, $D$ L$, $|$$tu1(Ã|$ tL$, $xL$D$D$D$ u1(ËL$, $D$L$$L$fDu1(ËL$, $L$0IL$U9u1(ËL$, $DL$au1(ËD$,$D$$D$L$, $]L$L$ L$D$ nu1(ËL$, $L$0IL$8u1(ËD$0X 1҃u=19}=T$\$@L$, $D$\$T$u1(BtË9|ËL$, $qL$L$$L$L$ u1(ËD$,$D$ D$L$, $WL$Eu1(ËD$,$D$D$$D$8CD$0X1҃u=19}=T$\$@L$, $D$\$T$u1(BtË9|ËD$,$D$D$q(Ã0D$ L$8I $}4T$8D$u^B tMZ 1҃u=19}=T$\$@L$4 $D$0\$T$u10BtË9|ø0ËL$4 $D$,L$4 $ D$$|$uL$4 $D$ u10Ã|$,V|$$KD$8@ .L$4 $D$(u10ËL$4 $xL$L$$L$D$ u10ËD$4$D$,D$L$4 $D$L$,L$ Au10Ã|$uSL$4 $L$8IL$5u10ËL$4 $rL$L$ L$L$ ?u10ËD$8X1҃u=19}=T$\$@L$4 $D$\$T$u10BtË9|ËL$4 $qL$L$,L$L$ u10Ã|$u4D$4$D$ D$L$4 $WL$1u10ËD$4$D$D$,D$$@|$(tQD$8X 1҃u=19}=T$\$@L$4 $D$\$T$u10BtË9|ËD$4$D$$D$V0D$(10Ãl$E@,u,$74L$?ËEX,KE؋@0t(t#t É,$t41L${?K|E؋@0uLu,$74L$M?É,$wL$M ًI4L$L$ u1ËE؋@0u,$t41L$>É,$qL$M ًI4L$L$ /1Ã$L$( $HD$ L$( $8|$  L$( $zL$D$D$D$ Uu1$ËD$($D$ D$L$( $L$L$ L$=u1$ËD$,X1҃u=19}=T$\$@L$( $D$h\$T$u1$BtË9|ËL$( $WL$Wu1$ËD$($D$D$ D$I=T$($dL$JIL$-L$ u1$ËD$($D$D$L$( $L$L$L$<u1$ËD$,X1҃u=19}=T$\$@L$( $D$k\$T$u1$BtË9|ËL$( $XL$Zu1$ËD$($D$D$D$L<$1$Ã8L$< $D$4L$< $D$,L$< $D$0L$< $T$,|$4tu18Ã|$0tD$(tL$< $yL$T$D$ u18ËD$<$D$4D$6L$< $L$L$4L$$;u18ËD$@X1҃u=19}=T$\$@L$< $D$ \$T$u18BtË9|ËL$< $WL$u18ËD$<$D$D$4D$:L$< $nL$L$0L$D$ T$@u18ËJ1D$ D$<$D$,D$&t$ l$<19D$@@\$$PBu H9EǀET$J,$D$,u18ËD$@L$< $L$u18ËL$< $L$IL$.u18ËL$< $kL$ L$su18ËL$< $rL$L$,L$L$ u18ËL$< $L$C\$u1(ø(É$lL$JI L$ XL$ Ul$,1(É$C@ЋT$,Z$B@L$0I $!L$pT$t$t/ tL$, $!L$0(É$B@ډ4$F@ЋT$D$,@ %@ $ܭ|$B% T$(=`Tt  Ã=$\u"! $0T$($\u1 ËBuJI13L$$ $JL$y$u1 ËL$$ $u1 ËL$$ $sL$D$D$L$ T$$u1 É$tL$JI L$ $\L$ 3T$(u1 ËBtGL$$ $JL$#u1 ËL$$ $L$L$u1 ËL$$ $L$L$u1 ËD$$$D$D$F ø! \ $D$L$$ L$L$$IL$ D$D$(T$(~1 ËB@b$T$,\$(CJCǀ /st3tt $É$T$m$É$T$$ËC@t$3!L$-$ËBt>$JL$<"u1$ËL$( $SL$Hu1$É$dL$KIL$-L$ u1$Ã.J1D$$JL$!L$u1$19H9É\$ }$L$( $L$\$ u1$ËL$( $L$,I IL$F!L$\$ u1$C떋Bhj1҃uE19tщT$l$@$D$ l$T$\$(u1$BtE븉$T$($à @t.t$T$$É$T$2$É$T$$à t $T$$É$T$$D$Bt~$JL$0 T$,\$(u1$D$BtP$JL$ T$,\$(u1$D$B t"$J L$\$(u1$D$$L$L$L$1$Ãzts@t. t$T$=$É$T$f$É$T$Y$Ãt$T$K$É$T$$É$JL$ \$,T$(u1$ËC$KL$\$(T$,u1$ËB t>$J L$u1$ËL$( $UL$1$É$L$u1$É$dL$JIL$-L$ {u1$ËL$( $L$Qs1$Ãi`WCtC~ZB9B+$JL$u1$ËL$( $L$1$É$JL$|u1$ËL$( $FL$1$Ãt$$É$(T$(u$M!L$($É$PL$(U1$à L$tKt=t/t!@Y$b!D$L$k1 ø ø ø ø à T$L$vtKt=t/t!@Y$!D$L$+k1 ø ø ø ËB tB % u  ø Ãtu ø ø> à +t t aB ø? øA à t 8 ø@ ËD$Dt<!ttt øø1Ãt uøøÃt!t t uøø øà T$L$vtKt=t/t!@Y$!D$L$i1 ø9 ø8 ø7 ËB tB % u : ø ÃtuC ø; øK à +t t aO øL øN à t 8 øM Ã(T$,B@ D$JI $L$0L$$u1(D$$D$L$,I $D$D$t$$-@Y\$4L$T$,}tc$L$L$L$L$T$ÉD$ t'}1(ËL$, $L$$L$\$ (É$B@Ћ\$ȃOtt;t)t,$q!D$`1(D$$[cD$$ZVD$$eI@u벃*tpt^t,$ !D$_1(ËT$!D$D$0D$gT$ t1(É$B@D$$D$${vSt;t)t,$O!D$_1(D$$bSD$$aFD$$t90u벃t+tytmt,$.!D$^1(þ~$t$JIL$L$L$ YT$u1( t (É$B@}뭾|릃tu{`B@O1HB@7B@ &tB@D$B@D$$D$,@D$oL$( $TD$ u1$ËD$,@D$|$1HD$1;\$}fL$( $ډ\$\$ IL$u1$ËL$( $L$L$L$ L$L$ &\$u1$C;\$|L$( $T$\$ IL$uu1$ËD$($D$ D$:$ËD$$JL$gu1$ËL$( $VL$s1$É$dL$KIL$-L$ Ju1$ÃGnt. tV$T$i$É$T$f$É$JL$u1$ËL$( $ L$¤1$Ãt:$dL$KIL$JL$ 荨1$É$dL$KIL$JL$ \1$ËB t"$JL$T$,\$(u1$ËB tSt@Y$!D$B1$É$`L$KI L$JL$ 1$É$_L$KI L$JL$ ԧ1$É$jL$KI L$JL$ 裧1$É$L$3T$,\$(u1$Ãt$L$T$,\$(E1$ÃtMt.t$T$I$É$T$P$É$JL$JL$k$ËB Z tkt@Y$!D${@1$É$JL$u1$ËL$( $L$,IL$L$ S1$É$JL$u1$ËL$( $L$,IL$L$  1$É$JL$u1$ËL$( $L$,IL$L$> 1$É$JL$;u1$ËL$( $L$,IL$L$ x1$Ãt$JL$L$ >1$à \$$D$(Pt#@Y$=!D$D$lF1 É$T$JL$L$au1 ËL$$ $L$(I L$?u1 ËL$$ $L$(IL$D$L$$ $L$L$1u1 ËL$$ $L$IL$L$ ËJ $JL$L$JL$ JL$K L$u1 ËL$$ $D$D$u1 ËL$$ $L$(I L$eu1 ËL$$ $L$(IL$9D$L$$ $L$L$WT$u1 B L$$ $T$u1 ø ËJ $JL$L$JL$ JL$K L$9u1 ËL$$ $D$D$u1 ËL$$ $L$(I L$u1 ËL$$ $L$(IL$TD$L$$ $L$L$rT$u1 B L$$ $T$ 1 à T$B@,|@Y$m!D$8<1 ËJA,A,J0L$L$H ÃD$@H,ÃD$ h1ۋE,9}ڋ@0u CE,9|1à T$$D$ $JL$K\$$ƒu --! $ L$KL$-L$ T$T$N^\$ƒD$ujL$ t@u!u1 u$C@ u։$B@Ћ\$ŋD$$D$@@Ћ\$T$룹! $L$(L$D$]T$ÃD$jT$\$N:\$T$KL$ D$t{uQL$ $cL$L$u1ËL$ $L$L$u1øÃuӋL$ $L$țu1D$=xD$<kD$^tP@Y$!D$D$D$L$ "A1Ã\$T$D$C$KL$T$u1ËD$@$L$IL$u1ËD$@ t&D$L$ $L$I L$u1ËL$ $L$L$L$脟u1øÉ$dL$JIL$-L$ wp1É$dL$JIL$-L$ DT$ 1ÃT$ D$1ɋBt6D$AL$ |$$t&L$ $JL$L$ T$ u1ËBt3D$AL$ |$$t"L$ $JL$L$ u1Ã|$$D$$ktbt]tQt@Y$!D$j71ú2L$ $L$L$%u1øú(Ϻȃtu뚋L$ $cL$L$踝Y1ËL$ $cL$L$苝,1ËL$ $L$舘1Ã|$$tVt-L$ $L$F1ËL$ $L$"1ËL$ $L$~1Ã\$T$tgtJtt@Y$!D$51É$KL$vu1øÉ$\$L$L$É$dL$JIL$ .L$ \u1à t$,l$$T$(ptpt#@Y$%!D$D$<1 ø!D$t",$JL$t$,l$$u1 É,$L$L$t$F ø!D$tڋJu}1D$1;\$}?B\$@,$D$t$t$,l$$\$T$(u1 C;\$|,$fL$L$L$t$,l$$[1 ËB{!D$B u,$T$t$ Ã,$T$t$ut$,l$$1 ø!D$,$dL$MIL$ .L$ 葙t$,l$$1 Ãt$ l$EtûU Ӊ]EtD$$ED$t$t$ l$1ҋE9}0T$M ȉu$uBE9|ЋFFN (ËD$$A D$t$Jt$ T$l$|$$t$(l$,GJG9?W Ӊ_w1ҋG9}iT$O H $D$HL$fT$|$$t$(l$,\$Ɖt$(9~t$,uQuGBG9|Gt!L$ $OL$t$l$ ,|$$1ۋW Ӊ_ÉC]uNL$ $K L$T$l$ T$L$|$$t$(ʼnD$,AqtAnbCzt Cyu9~똉Ãt$1ҋFh$t!1ۋU Ӊ]Emu߃u1É4$T$D$D$ 6à D$$D$ D$D$L$H$L$BT$u1 $L$ZB\$T$CCu1 Á?v G61 É $FT$B B u 61 ø ÃT$uBBuB t B $?HËJ u݋B$B@@ЋT$Ƌ u$@@ЋT$랋L$uËA=~øà \$D$1ҋC9}+T$ S щ $\$T$D$BC9|ՋD$ Ã$\$(sK)΋D$,xK)ω|$u >t$ ‰ՋKT$ QCP9|N? 9?ك $T$|$t$ l$\$(}1$ËCKȃ19}AAB9|))Ήt$ C‰ՋKT$ QCP9|N? 9?ك $T$@|$t$ l$\$(}1$ËSKʃBވމB1t$ 9}BBA9|))ω|$CCPC9|,ك $ɉL$|$t$ \$(}1$ËSKʃCt*BވމЇ߈ߋL$,IKKK$ÉBЇ߈21$É21$É$ÃD$D$D$ @D$ L$$ $|$T$ l$ \$$ƉD$t{|$D$Ct),$\$|$T$ t$l$ \$$E9|9?~1É,$ɉL$i|$t$l$ \$$}1ËUMʃuu'BBL$D$BBKtBш1Ã$D$D$D$(XK|7D$(@ \$ D$ $\$ ‹D$ L$HT$K}ɋD$D$D$D$,@X$toCD$1C9}Xt$ \$ K ȉD$$(t$ \$ T$D$t8J IJB=~D$FC9|uD$;D$$ËtҋB h+l$j뵃(D$L$, $$6D$$u1(ËL$, $L$L$L$ L$L$L$ M\$$t(D$HD$ @ D$ D$ +L$0L$ H 뫉؃(Ã\$C1ҋAtAuIA uA$tA(t A(tA(tC % ‰T$KI $} Ãu*L$II $} ÃuL$@D$ÃlD$dD$`D$\D$XD$TD$PD$LD$HD$DL$pII $D$E\$`yS|$\|$X|$T|$P|$LuZ|$Hu1|$DuD$dlËL$D uD$D$D$D@@֋L$H u‹D$H$D$H@@뭋L$L uD$L$D$L@@넋L$P lD$P$D$P@@TL$T 8D$T$D$T@@ L$X D$X$D$X@@L$\ D$\$D$\@@ $C@D$h$l T$hD$` 2L$pII $D$D$\L$pII $D$f\$`D$X|$\|$XL$pII $D$%\$`D$H|$HL$H $D$8L$pII $L$8L$\$`D$L|$LL$p $~9\$`D$T|$T|L$pII $D$@L$p $\$`T$tD$<E $\$L$\L$JL$ \$`D$D|$D$YQ\$`ƒD$h T$`L$p $;T$pD$8JI $L$@L$L$8L$L$?B]$ED$x$\$t\$  T$x|$t$D$| t8tL$|M|$|<$G@Ћ|$t$щ$B@Ћ|$t$밃]$ED$x$\$t\$L T$x|$t$D$| t8tL$|M|$|S%<$G@Ћ|$t$щ$B@Ћ|$t$밃]$ED$x$\$t\$ T$x|$t$D$| t8tL$|M|$|<$G@Ћ|$t$щ$B@Ћ|$t$밃I; & D=A;BCY]$ED$x$\$t\$-L$E T$x|$t$D$| t8tL$|M|$|<$G@Ћ|$t$щ$B@Ћ|$t$밃]$ED$x$\$t\$ T$x|$t$D$| t8tL$|M|$|a3<$G@Ћ|$t$щ$B@Ћ|$t$밃]$ED$x$\$t\$p T$x|$t$D$| t8tL$|M|$|<$G@Ћ|$t$щ$B@Ћ|$t$밋ED$x$?@ T$x|$t$D$| |$|L$|M$]H$@$I$$E$@@pЋ|$t$D$||$|$L$|$}uw$@$[Ã$$ED$xT$d4D$xT$d4$F@Ћ|$t$$\K$@$[Ã$$uF=W.u F9F=$uF9t~t$x4$\$ډ$ L$J|$tt$x$t;$ʼn$v4$F@Ћ|$t$[DŽ$ˋF D$8KtT$8<$|$t8ۉ D$8Kt#T$8<$|$t8Ku 4$F@Ћ|$t$|$t$t2 ,` $4|$t$|$t$$UT$| t$${$B@Ћ|$t$Ճ$+$B@Ћ|$t$FRG-H"|$hD$h=-|$ttS- $|$|$t$$$u<$D$|$t$tA|$hu D$hkL$h uD$h$D$h@@Ћ|$t$Ɖ<$G@Ћ|$t$맹q- $3$ǃD$t(_$x-D$f|$t$DŽ$$ED$x|$hD$h=-|$tt$<$D$|$t$7$u+L$x $|$L$l|$t$$$ujD$x@@T%t$xD$xXt#@%/<$D$|$t$u|L$x tO|$huD$h$L$h u؋D$h$D$h@@Ћ|$t$븋D$x$D$x@@Ћ|$t$w<$G@Ћ|$t$\@ G&D$x@@T%D$xp D$xXt"@=sG@\.u!<$D$|$t$@ Ή\$4t$8 I $t$8\$4|$t$u랉<$D$H|$t$ro- $|$|$t$$mX- $0$ǃD$tA_$_-D$J|$t$DŽ$$ED$x7- $<0$ǃD$tu5_$C-D$|$t$DŽ$D$|$u6 $L$xL$|$t$D$||$|u DŽ$$u><$L$|L$D$sL$ǃ|$tu DŽ$L$x t?|$|L$| D$|$D$|@@Ћ|$t$|D$x$D$x@@Ћ|$t$s<$|$tG@Ћ|$t$T}|$hPMQJ2KL$]$ED$x$\$t\$ T$x|$t$D$| t8tL$|M|$|<$G@Ћ|$t$щ$B@Ћ|$t$밃]$ED$x$\$t\$R T$x|$t$D$| t8tL$|M|$|5<$G@Ћ|$t$щ$B@Ћ|$t$밃$}|$h]$ED$x$\$t\$v T$x|$t$D$| t8tL$|M|$|a<$G@Ћ|$t$щ$B@Ћ|$t$밃NOL]$ED$x$\$t\$h T$x|$t$D$| t8tL$|M|$|<$G@Ћ|$t$щ$B@Ћ|$t$밃]$ED$x$\$t\$ T$x|$t$D$| t8tL$|M|$|]/<$G@Ћ|$t$щ$B@Ћ|$t$DŽ$n{i_  X|T1QRt*S$ED$\DŽ$J$@D$|tD$|$L$|t@Y$-D$|$t$$U-ED$8$U-ދL$8 $T$pT$\$x\$t$tt$ D$) |$t$D$|L$8 |$|D$p=-hL$| $|$t$$L$| $W$~RDŽ$-$-ML$p L$x sK$X$$UB@T%tYB$$t2$ t( $B@Ћ|$t$~$ED$\ŋB=4toB@T%t BT%@uRB@T%uBT$x-t@Y$-D$T$x|$t$DŽ$L]$M$\$t\$L$|$t$DŽ$<$G@Ћ|$t$D$x$D$x@@Ћ|$t$jD$p$D$p@@Ћ|$t$6D$|$D$|@@Ћ|$t$DŽ$D$8$D$8@@Ћ|$t$KB@T%tEBt$ tED$8$U-ED$8MM$Uً]uED$8U]$u$ED$x$$j$@D$|u'@Y$q-D$|$t$($L$xL$]$$$D$kT$x|$t$ t$$B@Ћ|$t$ՃUVtwW$ $(h|$t$D$8$@ )L$8I9$U uȉ$B@Ћ|$t$밃ED$\$h$DŽ$@au]E$$ $D$pD$\$x\$t$tt$ `\$xT$p|$t$$ tI t(<$G@Ћ|$t$$C@Ћ|$t$$B@Ћ\$x|$t$뛃\>YZ[OT$@P $@D$|tV$T$tT$ |$t$$\\$xT$p|$t$D$|L$|M tI t(<$G@Ћ|$t$$C@Ћ|$t$$B@Ћ\$x|$t$뛃]^u鉬$)$t$tt$|$t$$tO$C$qY$@$[ËL$D $+<$G@Ћ|$t$뙋T$@p ]E$\$x$t$tt$D$pD$B\$pT$x|$t$$ t4 t$u$C@Ћ|$t$Չ$B@Ћ\$p|$t$밃gcu`atsb9T$@@ $I $D$tD$Q|$t$$|$t$D$||$|u0$I $|$=|$t$D$||$|uD$|$L$|銼$$t$$؋L$D)ȉD$$@ )D$ rP|$t$=}|ytzt|T$dD$||$|tD$|$L$|L$TI$ $\${D$Z$-D$D$D$N|$t$}~1|$ttZtHt=t2@Y$-D$譼|$t$DŽ$Uu$}|$t<$t$T$R|$t$$ԷT$dD$||$|tCT$dL$dк ú$B@Ћ|$t$騺L$TI$ $\$7D$Z$-D$D$D$UM|$t$9l$8L$8 $\$+|$tD$|D$8Ń$L$||$|%s:ܺ$ED$x$$IL$&T$x|$t$D$| w|$|tM$EL$| $D$xD$)T$x|$t$t DŽ$ |$|t $$L$|$ $$$|$t$ƃu:L$| t D$|骵D$|$D$|@@Ћ|$t$K|$}|$tx K}L$| $t$xt$'T$x|$t$t DŽ$ $$B@Ћ|$t$ $B@Ћ|$t$$B@Ћ|$t$nUu$ED$p$t$xt$T$tT$.\$xT$p|$t$D$| t^ t=uL$|M|$|Vu<$G@Ћ|$t$ȉ$C@Ћ|$t$뫉$B@Ћ\$x|$t$13$ED$x$$IL$#T$x|$t$D$| |$|t $$L$|鋳$ $á$|$t$ƃu:L$| t D$|ID$|$D$|@@Ћ|$t$K|$}|$tx K}L$| $t$xt$f%T$x|$t$$ -$B@Ћ|$t$$B@Ћ|$t$T$`D$|D$|$L$||$|ftg$mT$` L$| $l$tl$(- |$t$;<$G@Ћ|$t$ T$`D$|$, $ǃD$tt$8DŽ$q$|$t$D$T@,@9}8D$T@,H Z$-D$L$jG|$t$ND$T@,@)ȋL$TI(H |$Tl$dD$8|$8uEtFD$8E9D$tEu|M4 $T$dD$^$-D$D$D$$t>?-D$ BD$JuO-D$D$tD$|D$SP-߸G-ED$<1;t$<}/T$pD$HD$HD$Ht$@F;t$<|ыEtjL$t+L$< $譐|$Tl$dD$D|$DMD$DM@\$<;\$t} T$p4+L$$u4-D$ T$u -D$D$,D$c!--B;T$4GD$<;D$4t$<+t$4;$dT$42u9$D$0D$0T$42t$@T$42L$0uF u$C@Ћt$@|$Tl$d1i4$F@Ћ|$Tl$dQCE91ۋE9}N\$(T$4t$04$D$L$|$Tt$0l$d\$(\4CE9||$84$D$$ L$dI4 $;D$L$$ $+D$^$t-D$D$D$D$D$ OT$$ $B@D$8$t$D$,D$@$|$Tl$d> $C@Ћ|$Tl$d <$C@Ћt$@|$Tl$d H$C@Ћ|$Tl$d0l$\$T$B=$u)u$l$hÉ$ L$É$l$\$lD$ uL$ tȃË`$D$D$$1ÃT$ B@T%tЃÉ$J-L$uÃ|$$t$(T$ZC,uEB4u--J4B4B8"B< J4K,J8K0J[-$D$$D$)e-$D$(D$ËL$ uD$$D$@@MEu,$E@y g$C@Ћl$ S6&B<B8\$Sk4s8t$ {<|$B,B0B4nJ,K4J0K8T$J4K<$s-$B,D$|-$D$@0D$-$D$@4D$L$Q,Y0\$ i4l$A,A0A4 t@u!uMEu,$E@ u։$C@Ћl$ʼn$B@Ћl$\$ '<$G@ЋT$4$F@Ћ|$T$ME,$E@Ћ|$t$ T$B4B0r|$uJYJ4-D$B8D$BD$@@T%@u*^$7-D$D$@@ D$D$=-t^$-D$CL$ t6D$D$L$I$uD$@D$D$)D$@D$$D$@@뵋T$D$@ D$D$ C$B@3D$ $D$ @@|$ D$ @=@)^$-D$hD$ D$D$mB4HD$L$ $ T$(ÃD$u^|$~ t/L$|$u1 u$C@$T$(@@Ћ\$T$(봋D$;D$$$ \$ƒuYؙ\$T$(kW$-D$D$D$|$u-D$ \$T$(/-D$(D$(D$D$;D$$w$H ƒu5S\$T$( t É$C@t$W$-D$軘\$T$($B@σ(D$$$D$ D$D$D$՝|$ u-D$ D$  $L$$L$L$ L$L$L$ 豅u D$$$D$ D$D$D$(ËL$, $L$0L$L$4L$L$ D$D$T$D$ |$u D$$$D$ D$D$D$莖(Ã|$$uR|$ u)|$tL$ uڋD$$D$@@ŋL$ uʋD$ $D$ @@뵋L$$ uD$$$D$$@@댉$B@N$D$ $D$D$D$D$bL$( $L$,L$L$0L$L$4L$ L$8L$u"D$ $D$D$D$D$蓕1$Ã|$ u[|$u2|$u $ËL$ uD$$D$@@ՋL$ uD$$D$@@묋L$ uD$ $D$ @@냃T$$J8At1AL$AL$ $T$L$(L$L$,L$ D$ЋT$ËJuJu1BJ؃ø P8BD$BD$BJuCJu;1T$BL$$ $L$(L$D$ \$L$KL$K ø$l$4T$01t$ Z@B t(L$, t10ËD$,$D$,@@$C@ˉ$B@Ћ\$$뱋L$, $L$ L$L$$L$> \$$T$ D$( tI t3|$(L$, t10ËD$,$D$,@@$C@$B@Ћ\$$릋D$,0É$ #T$4D$, <$B@,L$L$ $pl$ǃu1Ã|$t&1;\$}T$ p p C;\$|M|L$$X M}à L$ $!p|$\$ƃu1 K|(h K} Ã$T$4D$ D$D$$T$L$,L$L$(L$ D$|$uZ|$ u1|$uD$$ËL$ uD$$D$@@֋L$ u‹D$ $D$ @@뭋L$, $L$0L$\$(D$ |$ tC=})7YBtBu!$L$ L$L$L$D$>J $J L$T$JL$L$ \$t D$L$( $L$ L$L$L$h\$(T$D$B|$u+B$B D$BD$D$ \$@J $J L$JL$L$ \$ mL$ t D$SD$$D$@@މ$L$ L$L$L$; D$4D$0D$,D$(D$$D$ D$@uL$<D$$D$$@@T% N|$,uZ|$$u1|$(uD$ 4ËL$( uD$($D$(@@֋L$$ u‹D$$$D$$@@뭋L$, uD$,$D$,@@넉D$$L$$L$'\$$T$ tq ` $҄8L$8 $D$L$8 $D$^$-D$D$D$D$D$ D$$@@ D$$B@ T$$D$@L$<D$(D$(@@T%L$( $U T$(ÃD$uq ^ $WL$8 $D$L$8 $:D$^$3-D$D$D$D$D$ D$(@@ D$ \$(D$(@D$0|$H~3L$$ $L$HL$L$B@T%*B@0 - WT$$\$,t_tL$( $\$T$Ϩ É$L$(L$ }1 Ãut (4 ø"1$L$(L$ }1 ËD$(9u 1  bC@T%$e\$,D$1;l$}Tl$H A@T%tQ W $-L$L$Ʒl$\$,}1 E;l$|L$( $\$y =PtًA@T%uɋA@T%t AT%@u W $-L$L$?l$\$,{1 ËC@T%t-,$+-L$L$\$,E1 Ã=P2C@T%C@T%tCT%@,$W-L$L$菶\$,1 ËD$(9t 1L$ $L$L$,D$|$u ` $BzuD$ËL$ $\D$ 4_$-D$D$ D$ǃ(L$0 $-L$lD$$D$|$$ ` $yu (-}L$0 $-L$u< ` $yu (Ë4_$-D$Pw(ÉD$ $-L$D$ T$ D$$ |$$u (D$D$D$ L$$ $L$L$菵 ƒuL ^ $xu2D$ L$$ tD$ (ËD$$$D$$@@|σ|$tB@T%L$0 $T$T$?l$\$,ƒD$uSD$ MEt/u|$ jD$+ u$B@։,$E@ЋT$C=\4u$l$T$l$T$D$ 덉$l$T$'~ l$T$D$ lB_0 m$B@]$B@Y01ҋD$4@@T% tL$4 $-L$ ƒT$,T$,$L$D$\$蔬 T$pD$$ED$|/D$D$dD$ wh^$D$D$RD$x1;l$l}L$t<uE;l$l|D$t$ ]D$xĀË\$t uҋT$t$l$dT$t@@Ћl$d믋L$\ $L$[X \$hT$dt$l9~ÉD$hBD$p9$GD$xGD$d1ۉ\$XD$PD$|=-u |$l9L$l $;\$XʼnD$\u)L$x D$x$D$x@@1t$t|$`;|$l}2FZ--tX G|$`;|$l|΃u݃|$PuXMEt@D$d;D$hvL$x $L$dL$L$hL$D$ XI<,$E@볋D$|=-uuD$d;D$h|FL$x $T$TT$JT$TD$L t|$LD$d$B@ߋL$x $L$dL$T$dHNjL$| $l$\l$D$聾\$\‰D$T twP$C@ЋT$Tt$p $g |$`t$pl$\Ãt D$P]P|$`t$pl$\t(ME ,$E@--F21l$\v1t $Xt$l1$D$L$, $o3L$L$L$ L$ L$L$L$:Lu1$ËD$ @@T%tD$ @@pu+^$o3D$D$ @@ D$|V1$ËD$ @@p=tċL$ $D$ @@pЃt$Ã|$t6Nt ,` $Pu1$TD$D$$Nt1$Ë,`$:N1$Ã(L$0 $o3L$L$L$ L$$L$L$ L$L$L$Ku1(ËL$$ $L$ L$L$L$t1(--(à L$( $o3L$L$L$ L$L$L$L$Ju1 ËL$ $L$L$D$t1 -- ÃL$ $Cu1É$貎Ã\$CP0trBXtj$BXЉtA@T%tȃË^$o3D$L$ A@ D$`TT$ t1É$B@^$o3D$L1Ã,L$0 $L$4L$u,ÉD$($p3L$L$$L$ u1,ËD$$ D$$ .D$D$L$ $=p3L$u1贸D$L$ $Jp3L$L$L$t1,D$D$$$L$$ $L$L$L$L$L$ L$L$*T$(D$ tD$ ,É$B@D$$L$ $Wp3L$L$ L$X u1ËD$ @=$1t^$`p3D$K1ËD$ D$ $D$ à D$L$( $p3L$L$L$ L$L$L$L$Gu1 Ã|$uL$ $ ËL$ $ju^$p3D$YJ1 ËL$ $L$L$N ÃL$ $O ƒD$}dJT$u $!1Ãuȃ8D$|$Dp3D$L$< $4\$urW$p3D$D$D$NL$0 t1|$uD$$8ËL$ uD$$D$@@֋D$0$D$0@@ u$B@뗉$)L$@ $p3L$D$L$@ $L$u t^$p3D$D$D$M18É$L$L$L$L$ L$4L$BT$@C18øp3 L$ $L$L$D$ à L$ $L$L$L$ Ã\$t CP0u^$p3D$fE1ËBTtۉ$BTЉtA@T%tȃË^$q3D$L$ A@ D$LT$ t1É$B@ + $L$L$L$L$ ÃT$B@T%t9JuB$"Ë^$}q3D$L$L1ËB=V#tmJ $V#L$rT$uPB@T%tJuB $豅Ë^$Iq3D$B@ D$K1ËJ\JtB$dø`(-D$L$0 $q3L$L$L$ L$$L$L$ L$L$L$@u1(ËL$$ $L$ L$L$L$4l (Ã@D$4D$0D$,D$ =Su$,Su1@Ã=LWq3 $,VLWu1@ùq3 $VLWdYu+tLW t1@É$B@q3 $LWxWuZtLW t5=dYtdYdY t1@É$B@$B@뾹q3 $  LWÃ`tLW t`=dYtdYdY t+t` t1@É$C@$B@Ћ`‰ $A@Ћ`덋 S $L$LL$q3L$`"L$ L$4L$L$0L$L$,L$^3l$Hu1@Ã|$,D$,=-D$4=-LD$4D$0=-D$0|$ u@D$(,$+l$H\$(9}$@ @@T%uD$ |$ IxWD$<`D$8D$(,$+9D$(|$(~5|$4L$8 $L$,L$L$`t1@ËL$H $L$(L$f+D$L$ $L$,L$L$`l$Ht1@D$(,$*9D$(j|$0u9L$< $L$,L$L$P`t1@--@ËL$0 $L$,L$L$`ŋL$4 $L$,L$L$_LWD$<dYD$8C\$(Q|$07D$0@@T%t D$ D$0@@T%^$r3D$D$0@@ D$WF1@Ã|$4D$4@@T%t D$ D$4@@T%x^$q3D$D$4@@ D$E1@ùq3 $gl$HD$,D$,=---@à D$D$D$ D$L$$ $L$(L$i|1 ù $qD$|$|$ |$u[|$u2|$u ËL$ uD$$D$@@ՋL$ uD$$D$@@묋L$ uD$$D$@@냋L$ kD$ $D$ @@SL$ 7D$$D$@@L$( $L$$L$b D$L$ $L$L$db D$L$ $L$,L$d D$ L$ $L$L$b D$L$ $軷D$}<\$ T$t Ad  tnL$ tLL$ t*L$ tD$ ËD$$D$@@D$$D$@@D$$D$@@량$C@녉$B@Ћ\$ hT$B@T%B@T%B=@M-tJ $@M-L$iT$t/^$=r3D$D$ D$B@ D$ B1ËBX0tƋCHt$CHЉƒu1Ë@@T%uCB@T%u3 t^$kr3D$:1É$B@։ЃЃÃXD$TD$PD$LD$HD$@D$<D$8$ΰD$$u1XËL$` $r3L$L$L$ L$TL$L$PL$L$LL$6T$$u t1XÉ$B@|$PuD$TD$PD$TL$P $r3L$ D$D|$D|$H|$D|$@uzL$$ tX|$<u/|$8u1XËL$8 uD$8$D$8@@؋L$< uċD$<$D$<@@믋D$$$D$$@@듋L$@ uD$@$D$@@@]L$D ED$D$D$D@@-L$H D$H$D$H@@|$TD$$D$$D$H|$L $ݮD$@|$@L$@ $L$$L$L$(L$6= |$(uW$r3D$7f|$(L$H $L$DL$L$@L$ƒ9|T$,$-D$8|$8T$HT$<D$0D$0;D$,}i$Dm ÃD$8@ L$0L$< $L$@L$] ƒD$L$< T$w3L$@M-L$}1 ËL$ $Dw3L$1L$]}1 ËL$ $Nw3L$P/L$4}1 ËL$ $Ww3L$1L$ }1 ËL$ $[w3L$$L$}1 ËL$ $`w3L$Ў6L$}1 ËL$ $ew3L$D8L$}1 ËL$ $lw3L$-L$g}1 ËL$ $uw3L$@a#L$>}1 ËL$ $yw3L$d-L$}1 ËL$ $w3L$7L$}1 ËL$ $w3L$$1L$}1 ËL$ $w3L$ș)L$}1 ËL$ $w3L$W.L$q}1 ËL$ $w3L$H)L$H}1 ËL$ $w3L$T1L$}1 ËL$ $w3L$E+L$}1 Ã=`Tuw $o L$ $w3L$D$D$T$}!u1 u$B@uD$ u$B@1늃,L$4 $L$4u"A=W.uȃ,$"D$$D$(u1,1D$ D$$D$$;D$D$4@@4tD$4@@4@ u?^$w3D$L$( t1,ËD$($D$(@@L$4 $L$$L$D$4@@4@ ЉƒtD$0=-T$Ӊ\$$W\$T$D$ |$~^L$( $L$ D$ L$\$KD$$D$$;D$L$( $L$ L$}1,ËD$(, t |$뱉$C@$B@Ћ\$d $T$T$u)L$ D$$D$@@L$0 $D$ D$D$mT$ ÉD$ t2L$ OD$$D$@@7$B@Ћ\$뽃0L$8 $=L$8‰D$D$4=-uA=$1uȃ0$T$ T$)D$,u101D$$D$(D$(;D$ L$8 $L$(L$D$8@@4@ ЉÃu(L$, t10ËD$,$D$,@@D$4=- D$|$~c\$C@T%u4^$w3D$T$ u$B@rkulD$$D$$D$,KH tC|$CD$(D$(;D$  D$$;D$}D$,$D$$D$ǺD$,0É$C@밋L$$)9~ $C@l$+D$ 9~ $C@D$ ;L$( $C@y+T$(J;T$~{|$?~ t10É$C@D$9}T$ҍL$, $T$ T$ֹl$\$t t10É$C@D$ D$L$$T$, $؃D$l$y\$D$D$$f $\$\$u)L$ D$$D$@@zL$4 $D$D$D$߂T$ÉD$ tcu)L$ 5D$$D$@@$RT$ \$D$ ;$B@Ћ\$'$B@Ћ\$ 댃8L$@ $QL$@‰D$$D$<=-uA=E+uȃ8$T$(T$D$4u181t$,;|$(L$@ $|$0|$D$@@@4@ Ћ|$0t$,Ãu(L$4 t18ËD$4$D$4@@D$<=-D$|$~h\$ C@T%u4^$x3D$DT$ u$B@rkujFt$,L$4I K  t4|$>G;|$(;t$$}D$4$t$D$48É$C@Ћ|$0t$,뷋T$()J)9+L$(9~ t18É$C@D$(9|؋D$(l$)~;T$$D$$9},|$$?~ t18É$C@T$$ҍL$4 $T$ T$t$,l$\$ } ,$C@D$ D$$D$4@ $C D$D$ܬ|$0t$,\$ D$Ɖt$, $\$ \$\$ u $C@L$< $D$D$D$@l$ T$ÉD$ tiuMEU,$E@E$O|$0T$t$,\$ D$ [$B@Ћ|$0t$,\$ ?$B@Ћl$ \$낃 L$ $]tD$$L$L$ "L$ȃ Ã(39 $L$L$L$IL$B3u1ËT$L$ L$T$ t1É$B@0 T $ u0ÍD$,$D$(D$D$$D$#L$( $D$ u0ÉD$ L$( $L$D$L$ $RT$ ÃD$u t0É$B@L$( L$4 $\$vƒu --+39 $L$4L$L$L$-L$ T$T$1\$ T$ʼnD$ u t0É$C@ $\$l$\$T$ D$( tA t+|$(u0ËD$,$D$(D$D$$D$; 0É$C@ȉ$B@Ћ\$뮉$B@Ћl$\$ MD$($D$(@@Ћ\$ \ $L$$L$L$I L$L$ IL$ D$D$L}9t \ $u1ËD$ $D$$D$-à L$ $239L$uL$ $739L$ ËL$ $M39L$܅uL$ $W39L$ Ã=PtpL$ $r39L$蠅teL$ $w39L$膅tKL$ $39L$lu"L$ $L$L$39L$t  1 ËL$ $L$L$}39L$lu1 Á$=  ==tQ= t8D$$39D$D$CD$ ?D$$1ĜËK $ĜDŽ$1C9}E艬$hKȉ= u$@$$$EC9|$ĜËCu 1ĜËK $ĜËC=Ĝ=$=,CuK $ĜDŽ$CH9}8$ RSщ $y$$$BCH9|ȋ$ĜøĜÃ<ËBD$@$D$,$L$LL$jt$@ǃD$(|$,u4L$ $t$_|$(G<$L$LL$͒<1ۋF9}[NtЍL$ $\$8 [VщL$^|$(t$@\$8Ń_فh똸D$39D$=S$39D$D$Dt<!ttt1øøøÃt u øø Ã"tt !u øøÃ#t 0u øÁH$T$P1$D1҉$@ VFt7t2t-@Y$49D$D$CD$ 1HúV49tUD$$,D$59D$u0)59D$ T$F$X $L$L$EHø359΃tr1ۃue19}e$L $$<$D IL$l$$XL$ $D$T$<u 1HCt9|HÃt49 A4949 $tt4949 t _4949t49tJ.t" tPH49x49n49dZ LuE$L $$XL$KL$$D$T$P$@tk 1HÃt@t0Cu >49CtksksuE$L $$XL$KL$$D$T$P$@tkR1HÉk A D$HA/*`t@%t2&t$@Y$:59D$AD$ 1 ø ø ËA@*u  ø Ã+t-u ø ËA@/u ø Ãt ^t|Z ø ø ø ÃT$BRt@t2t$@Y$V59D$BD$ 1øøÉT$J $P59L$Xzu ËL$I $S59L$2zT$uøÃt t^øøËBBt1@Y$p59D$B@D$B@D$ 1ËJI $j59L$yu ËL$II $m59L$ayT$uË@Y$59D$BD$11ÃL$I $L$IL$#ct$ǃD$u11F9}WL$ $l$ iVщL$'|$t$l$Ãu1ÉXF9|Ã4D$<@=D$,$L$8IL$zbt$$u 1İË$ u狄$$$@@̋$$$@@맋$$$@@y$B@Y$$69D$Z<$@$$L$7$$ $JL$J L$$IL$ 4İÉ$ML$Au 1İË$@$$L$$$ $JL$J L$$IL$ YİËM $KL$D$u 1İÉ$L$KL$K L$ $IL$*İËjEu1$L$JL$J L$ KL$İE=Tu$l$İÉ$l$İà 8jEu0$D$JL$J L$ KL$1~İËEE@ E@=Pu$l$İËE~E@H=P$E@$$KL$ I$u 1İË$ $$IL$H$ǃ$u 1İ1F9$ $鉬$ iVщL$ $Ãu 1İÉ$X$ $ i$Rу0L$B $$$Ãu 1İÉXF94$ $|$$IL$$I L$ $IL$C|İÉ$l$!İÉ$E=$KL$eG$ǃ$u 1İ1F9}i$ $鉬$ iVщL$/ $$$Ãu 1İÉXF9|<$$IL$$I L$$IL$ {İÃ=Pt($T$69L$$$tR$JL$$u 1İÉ$KL$K L$$IL$ Z~İ1İËjE u1$L$JL$J L$ KL$.İËEtE@ t$l$İÉ$l$O$u 1İÉ$L$KL$K L$ $IL$貀İÃ(l$,\$0D$ D$1t$SuM $N(ËCu=0=0u1,$T$$T$ t$l$,\$0T$$D$ |$ u1( !C~9S=0u),$T$ t$l$,\$0D$|$u1(ËC@Kȃ=EusL$$A,79 $ML$ƒu1(ËD$$@$L$HL$H L$ L$,IL$~l$,ƃu1(ËL$ $L$L$t$ML$ *(ËQ=0u͉,$T$l$,ƃu1(ËCS0=0,$T$t$l$,\$0D$|$1(É,$T$Zu1(É$L$,IL$(ÃY\$ K $sD$L$ $Qu10-D$@$D$ @D$sL$4 $L$L$53D$D$$L$u10ËD$4@$L$%T$8L$ $JL$J L$L$4IL$ t0Ã(L$, $L$0IL$l$0ÃD$ u1(ËEu؃(þE9}t$$vMȉ=BE@M@=<uoL$, $M IUуL$\$0u1(ËL$ $L$D$KL$ K L$L$,IL$fmu1(ÉÉ؃(ËL$, $T$\$\$ t$$l$0u1(ËKHKHÉD$ F 0\$4T$8=7m=2tA=.?=04=1t$@Y$J79D$D$b10ËBR=7~=;7t=8t=9t=:uBuR[$T$ 0=<tx==ta=Tl1Bu+$T$8JL$I\$4T$8Ńu10É,$JL$J L$KL$ p0É$T$0ËBuR$T$M0ÉT$8J $KL$e9t$8D$,u101F9}WL$4 $l$( iVщL$@t$8l$(Ãu10ÉT$,XF9|NI $F79L$Nl$4\$,T$8u* $\$JL$J L$ ML$_j0ù $\$JL$J L$ ML$5j0ËB=At)B=/tB$T$0É$JL$0=3=4t=6mBuRT$8J $KL$8D$ u10ËL$8I $L$4IL$7t$8D$u10ûF9L$4 $\$( [VщL$dD$u10ËL$4 $L$( IT$8RуL$Gt$8\$(Ńu10ÉفT$ L$HفT$hF9WL$4 $NL$\$8u10É$L$ L$L$L$KL$ K L$L$4IL$m0ËBuR$T$8JL$u\$8u10ù $D$KL$K L$ L$4IL$h0ÃX\$`D$<D$81111ҋC9},RKȉ=Ku AFBC9|ԃt|$L=~$79D$d1XÉ $L$\IL$o5D$Du1XËL$L $L$\IL$I5D$@|$@u1XD$PD$L1D$`@9l$ThL$`Iȉ=KB|$LtB$79D$1XÃ|$<tB$79D$1XËL$\ $JL$l$TÃu1XËD$PD$PT$DXED$`@9GL$d $L$DL$L$@L$L$$\$(T$,BuT$L$0L$\$,u1$$D$D$KL$ K L$L$(IL$EQ$ËBuy$JL$D$ u1$ËL$( $L$0L$8\$,u1$ËL$ $D$D$KL$ K L$L$(IL$P$ËB$JHL$u1$ËL$( $D$D$L$L$,IHL$ }u1$ËL$( $L$,IL$D$u1$ËL$( $L$0L$X\$,u1$ËL$ $L$L$D$KL$ K L$L$(IL$O$Ë@Y$w:9D$BD$1$ÃD$ |$(u<ù $L$@IL$l$Dƒu1<ËL$ H$L$(L$ML$M L$ L$@IL$><É,$ RSуL$l$@\$DT$8D$,u1\$$\9\$$u 耥uD$$$?414É$D$D$A4øl$$L$(U9s %uhU$)ىL$D$ u1ÉD$$L$,L$D$xT$D$ tD$É$B@B넃<\$PT$HD$4t$;9L$T$Hul|$LtCL$D $T$D$>T$4D$8uD$8< u$B@L$D $T$D$跙T$4D$8뻁*v1<$ RɉL$ju1<ÉD$4$D$0ƉD$,L$DT$H D$(D$D;D$(D$D\uAFt$,L$DD$D D$D%t4$!;9D$=t$,t$,D$D%;L$@ $L$DL$L$(L$';9L$ u(L$4 t1<ËD$4$D$4@@D$$$D$ L$$ $t$,T$$l$ D$1;\$}x4$1;9D$+%D$@%D$ @%D$\$@%D$SZt$,T$$l$ \$ t$,;\$| $B@Ћt$,D$D;D$(v+T$0D$0D$DFt$,L$DD$D <0\$8%D$$D$4@D$ /w_n'T$(t "@C\$8$;t$4l$(\$8=vW$T;9D$$10J9tp;9$ D$I10ÃT$,r 9s|$F=^9t$$;9T$I\$8T$,1ʼnD$ |$$uU$\L$:l$ \$8T$,t3$T$D$L$L$ tL$4 L$m01tc$T$D$pu10ÉD$$L$4 L$D$fsT$D$ tD$0É$B@$T$臱0ËT$4$;9T$E\$8T$,4$\$T$L$$L$ L$0C9J9uJT$,ى\$89W;9$ D$p10øD;9$ D$T10Ãut@Ut;bt&Bt!rt RpCD$$]CD$CD$뵃L$ $L$ IIL$D$D$D$ @9D$L$ $L$ IT$ RыIL$ƒu/|$u1ËL$ uD$$D$@@؋D$@@T%tB@T%L$ $T$ T$T$ D$ tRL$ t0D$D$|$dD$D$ @9D$"D$ËD$$D$@@뻉$B@롍D$$T$UA|$ 뤃L$ƒ|u 1Ãt H=?wv ̢1ÃL$ $T$ T$'u 襢1ÉD$$D$D$ D$g7D$L$1oL$ƒ|u B1Ãt H=?wv #1ÃL$ $T$ T$~u 1ÉD$$D$D$ D$6D$L$1o4D$,D$(L$8I $)L$^L$,D$|$u CL$,|$tDL$ $,u1|$uD$(4ËL$ uD$$D$@@D$(D$<@D$<@9t`^$)D$D$8@@ D$u4D)D$ L$uR)D$蕢D$(ZS)E)D$0D$<@9D$0}}L$ $L$0L$nu D$(L$8 $D$D$T$0\$< I L$T$D$( |$(D$0D$<@9D$0||$@D$0L$@ $L$0L$L$$L$L$ L$ /zL$8 $L$$L$L$ L$D$(|$(O릉$B@gL$ $U)L$QƒD$ u ` $踛tl'T$ tB^) $L$IL$T$kT$ D$ tD$É$B@c) $L$IL$-1Ã0L$@ $ƃD$,u101;l$@}Kl$$\$< $t$,l$$Ãut10É4$F@X E;l$@|H) ${)L$L$4L$L$8L$ )L$t$)L$)L$T$,D$( tD$(0É$B@L$( $ ƃD$ u11;l$(}Kl$\$$ $@t$ l$Ãut1É4$F@X E;l$(|L$ $)L$t$T$ |'D$ tD$É$B@1ڃL$u~1D$ $ƃD$u11;l$ }Ql$\$ I $D$Ћt$l$Ãut1É4$F@F E;l$ |Ë뀋L$u-ÃL$ $RÃL$ $LÃT$ -u1҃tD$$T$ T$.T$ u D$1 T$B=$1t-u$L$L$L$L$ Ë^$)D$ϝ à T$B=$1t B=E+u$L$L$L$L$5 Ë^$͠)D$ߕ ÃT$B@T%uB@T%t6$$ƒD$uߕT$u D$1øÉ$>u ËW$)D$ȉL$ D$֜T$ t É$B@T$B=-t_$γu ËW$)D$ȉL$ D$fT$ t É$B@D$(4u 118< $} Ë<D$ $&~ƒt&L$ $3)L$T$T$@T$}$u  u$B@L$ $;)L$T$?T$| t1É$B@=^t #}1ùG) $8<L$D$D$ ULSu1É$D$D$ u1ùK) $ LSL$DVL$L$ Xu1ùR) $ LSL$\VL$L$ `u1ù^) $ LSL$\L$L$ Yu1ùi) $ LSL$ZL$L$ JHVu1ùo) $8<L$D$D$ Uu1É$h4L$L$u1ùt) $ UL$L;L$L$ Yu1ù) $ UL$@8L$L$ zVu1ù) $ UL$SL$L$ @Xu1ù) $ UL$0VL$L$ @`u1ù) $ UL$8)L$L$ Zu1ù) $ UL$x!L$L$ DTu1ù) $ UL$ <L$L$ X0Wu1ù) $ UL$0$L$L$ (_u1ù) $ UL$/(L$L$ au1ù) $ UL$Ԏ$L$L$ $_u1ù) $ UL$~)L$L$ p[u1ù) $ UL$"L$L$ 6XTu1ùơ) $ UL$)L$L$ Vu1ùС) $ UL$9)L$L$ @Zu1ùۡ) $ UL$}!L$L$ l[u1ù) $ UL$[L$L$ NUu1ù) $ UL$4"L$L$ ]u1ù) $ UL$3L$L$ 0_u1ù) $ UL$WL$L$ Zu1ù) $ UL$UL$L$ fPu1ù) $ UL$D$D$ .Yu1ù ) $ UL$D$D$ \u1ù) $ UL$D$D$ ]u1ù) $8<L$D$D$  Pu1É$\1L$L$:u1ù) $ PL$ج1L$L$ (X_u1ù%) $ PL$te3L$L$ [u1ù+) $ PL$X/L$L$ 4`u1ù3) $ PL$!9L$L$ z$Pu1ù:) $ PL$V#L$L$ @pYu1ù@) $ PL$3L$L$ Uu1ùE) $ PL$H\L$L$ 0Pu1ùI) $ PL$'L$L$ `u1ùR) $ PL$?.L$L$ X`u1ùZ) $ PL$X/L$L$ \u1ùc) $ PL$( +L$L$ l\u1ùp) $ PL$ZL$L$ \u1ùv) $ PL$;L$L$ pZu1ù~) $ PL$$L$L$ 6hVu1ù) $ PL$ZL$L$ Yu1ù) $ PL$X^L$L$ _u1ù) $ PL$TL$L$ Su1ù) $ PL$<$L$L$ N ^u1ù) $ PL$H"L$L$ `u1ù) $ PL$\%L$L$ Xu1ù) $ PL$|2-L$L$ [u1ù) $ PL$dn2L$L$ f4Uu1ù) $8<L$D$D$ /\u1É$D$D$u1ù) $ \L$D$D$  Vu1É$D$D$荮H^u1ùƢ) $ \L$D$D$ s]u1É$D$D$,|^u1ù̢) $ \L$D$D$ [u1É$D$D$˭T^u1ùТ) $ \L$D$D$ _u1É$D$D$jT_u1ùآ) $ \L$D$D$ P]u1É$D$D$ Su1ù) $ \L$D$D$  au1É$D$D$訬Su1ù) $8<L$D$D$ dSu1É$D$D$Du1ù) $ dSL$D$D$ 4X[u1ù) $ dSL$$$L$L$ Tu1ù) $ dSL$QL$L$ Xu1ù) $ dSL$[L$L$ xVu1ù ) $8<L$D$D$ O Ru1É$D$D$u1ù) $ RL$D$D$ Xu1É$D$D$譪[u1ù) $ RL$D$D$ p[u1É$D$D$L\u1ù) $8<L$D$D$ 3Zu1É$D$D$u1ù") $ ZL$D$D$ [u1É$D$D$葩H[u1ù&) $ ZL$D$D$ w]u1É$D$D$0[u1ù*) $ ZL$D$D$ Xu1É$D$D$Ϩ_u1ù/) $ ZL$D$D$ S=Su1ù) $ _L$D$D$ S=Su1Ë S $D$D$Ϡ^=^u1ù) $ _L$D$D$ W=Wu1Ë W $D$D$`Z=Zu1ù) $ _L$D$D$ BU=Uu1Ë U $D$D$W=Wu1ù) $ _L$D$D$ hX=hXu1Ë hX $D$D$肟`=`u1ù) $ _L$D$D$ dS=Su1Ë S $D$D$^=^u1ù) $ _L$D$D$ `=`u1Ë ` $D$D$褞W=Wu1ù) $8<L$L8L$L$ \=\u1ù) $8<L$D$D$ J``=``u1Ë `` $c3L$L$u1ùΣ) $ ``L$.L$L$ ^=^u1ùܣ) $8<L$lF+L$L$ Y=Yu1ù) $8<L$t/L$L$ gW=Wu1ù) $8<L$d$L$L$ *^=^u1^à L$ $L$_u1 L$H à L$ $L$+u1 L$H à |$uW$)D$t1 ËL$ $L$Ӆu1 L$H à L$ $L$蟅u1 L$H à W|$u $)D$t1 Ã|$u $A)D$s1 ËL$( $L$)u1 L$HL$HL$H L$HL$ HL$$H à |$uW$h)D$~s1 ËL$( $L$讄u1 L$HL$HL$H L$HL$ HL$$H à L$ $L$Wu1 L$HL$HL$H à L$ $L$u1 L$HL$HL$H à |$uW$)D$r1 ËL$ $L$诃u1 L$HL$HL$HL$H à W|$u $)D$r1 Ã|$u $֤)D$q1 Ã|$u $)D$q1 ËL$$ $L$u1 L$HL$HL$H L$HL$ H à L$$ $L$趂u1 L$HL$HL$H L$HL$ H à W|$u $)D$q1 Ã|$u $@)D$p1 ËL$( $L$$u1 L$HL$HL$H L$HL$ HL$$H à |$uW$_)D$yp1 ËL$$ $L$詁u1 L$HL$HL$H L$HL$ H à |$uW$)D$p1 ËL$$ $L$5u1 L$HL$HL$H L$HL$ H à |$uW$)D$o1 ËL$$ $L$u1 L$HL$HL$H L$HL$ H à L$$ $L$qu1 L$HL$HL$H L$HL$ H à L$$ $L$!u1 L$HL$HL$H L$HL$ H à L$ $L$u1 L$HL$HL$HL$H à |$uW$ƥ)D$4n1 ËL$ $L$du1 L$HL$HL$HL$H à L$ $L$u1 L$HL$HL$H à L$$ $L$~u1 L$HL$HL$H L$HL$ H à |$uW$)D$5m1 ËL$$ $L$e~u1 L$HL$HL$H L$HL$ H à L$ $L$~u1 L$HL$HL$H à |$uW$)D$l1 ËL$ $L$}u1 L$HL$HL$H à L$ $L$m}u1 L$HL$H à L$ $L$2}u1 L$HL$H à L$ $L$|u1 L$HL$H à |$uW$))D$hk1 ËL$ $ L$|u1 L$HL$HL$HL$H à W|$u $I)D$j1 Ã|$u $j)D$j1 Ã|$u $)D$j1 ËL$$ $ L${u1 L$HL$HL$H L$HL$ H à W|$u $)D$Kj1 Ã|$u $̦)D$-j1 ËL$ $ L$]{u1 L$HL$HL$HL$H à W|$u $)D$i1 Ã|$u $)D$i1 ËL$ $ L$zu1 L$HL$HL$HL$H à W|$u $6)D$5i1 Ã|$u $W)D$i1 Ã|$u $x)D$h1 ËL$$ $ L$)zu1 L$HL$HL$H L$HL$ H à L$ $ L$yu1 L$HL$HL$HL$H à L$ $ L$yu1 L$HL$HL$H à |$uW$)D$g1 ËL$ $ L$*yu1 L$HL$HL$HL$H à |$uW$)D$g1 ËL$ $ L$xu1 L$HL$HL$HL$H à W|$u $)D$ g1 Ã|$u $)D$g1 ËL$$ $ L$2xu1 L$HL$HL$H L$HL$ H à |$uW$()D$f1 ËL$ $ L$wu1 L$HL$HL$HL$H à L$ $ L$uwu1 L$HL$HL$H à |$uW$O)D$e1 ËL$$ $ L$wu1 L$HL$HL$H L$HL$ H à |$uW$r)D$ke1 ËL$, $ L$vu1 L$HL$HL$H L$HL$ HL$$HL$(H à |$uW$)D$d1 ËL$ $ L$vu1 L$HL$HL$H à |$uW$)D$d1 ËL$ $ L$uu1 L$HL$HL$H à |$uW$Ϩ)D$d1 ËL$ $ L$Muu1 L$HL$HL$H à W|$u $)D$c1 Ã|$u $)D$c1 Ã|$u $6)D${c1 ËL$$ $ L$tu1 L$HL$HL$H L$HL$ H à W|$u $Z)D$c1 Ã|$u $)D$b1 Ã|$u $)D$b1 ËL$$ $ L$su1 L$HL$HL$H L$HL$ H à W|$u $ʩ)D$Wb1 Ã|$u $)D$9b1 ËL$ $ L$isu1 L$HL$HL$HL$H à |$uW$)D$a1 ËL$ $ L$ru1 L$HL$HL$HL$H à |$uW$&)D$_a1 ËL$ $ L$ru1 L$HL$HL$HL$H à L$ $L$Fru1  à L$ $L$ru1 L$HL$HL$H à L$ $L$qu1 L$H à |$uW$F)D$O`1 ËL$ $L$qu1 L$H à W|$u $h)D$_1 Ã|$u $)D$_1 ËL$ $ L$ qu1 ËL$L$HL$H à L$$ $L$pu1 L$HL$HL$H L$HL$ H à L$ $L$~pu1 ËL$L$HL$HL$H à W|$u $)D$^1 Ã|$u $ު)D$^1 ËL$ $L$ou1 ËL$L$H à |$uW$)D$r^1 ËL$ $L$ou1 ËL$L$H ÃL$1D$ u--ÉL$5t؃Ë HV $D$D$脅T$ ÃD$u@u!u1 u$C@ u։$B@Ћ\$ŋL$I $L$\$ƒt$2)L$D$ D$蛐\$T$ s 3$B@Ћ\$ Y $D$D$詄T$ ÃD$!L$I $\$ƒ$-)L$D$ D$\$T$  $B@Ћ\$ ` $D$D$T$ ÃD$L$I $L$\$ƒ`$()L$D$ D$^\$T$ 6 $B@Ћ\$ X $D$D$lT$ ÃD$L$I $L$\$ƒ$#)L$D$ D$軎\$T$  S$B@Ћ\$?D$D$D$D$ |$u--ËD$ /1L$I $ƒuJu/|$u1ËL$ uD$$D$@@ uȉ$B@뻋L$ $)L$D$ D$薍T$ | tbL$I $CƒmL$ $)L$D$ D$MT$ C tD$É$B@$B@둋 V $D$D$UT$ D$|$L$I $}ƒL$ $U)L$D$ D$譌T$  7L$I $٢L$ƒsL$ $Z)L$D$ D$ST$ I L$I $L$;ƒL$ $`)L$D$ D$T$  tjL$I $٢L$ƒL$ $e)L$D$ D$裋T$  v$B@f$B@뉉$B@#$B@ Y $D$D$T$ D$|$L$I $ƒL$ $7)L$D$ D$T$  .L$I $:ƒL$ $<)L$D$ D$蓊T$  L$I $L${ƒYL$ $A)L$D$ D$9T$ / tjL$I $٢L$%ƒL$ $F)L$D$ D$T$  $B@$B@뉉$B@#$B@ X $D$D$}T$ D$|$^L$I $ƒDL$ $t)L$D$ D$$T$  $B@ Z $D$D$(}T$ D$|$L$I $٢L$蹽ƒL$ $)L$D$ D$wT$ m taL$I $ƒJL$ $)L$D$ D$*T$  $B@$B@뒋 @` $D$D$3|T$ D$|$L$I $٢L$ļƒL$ $z)L$D$ D$肇T$ x U$B@E DT $D$D${T$ D$|$*L$I $ƒL$ $)L$D$ D$T$  L$I $/ƒL$ $)L$D$ D$蟆T$  taL$I $ƒrL$ $)L$D$ D$RT$ H %$B@$B@뒉$B@5 ( (_ $D$D$*zT$ D$|$L$I $ƒL$ $)L$D$ D$肅T$ x .L$I $ƒQL$ $)L$D$ D$1T$ ' L$I $L$ƒL$ $)L$D$ D$ׄT$  tjL$I $L$ùƒL$ $)L$D$ D$聄T$ w T$B@D$B@뉉$B@#$B@ 0W $D$D$jxT$ D$|$L$I $YƒL$ $)L$D$ D$ƒT$  L$I $٢L$誸ƒL$ $)L$D$ D$hT$ ^ taL$I $ƒ;L$ $)L$D$ D$T$  $B@$B@뒉$B@, a $D$D$wT$ D$|$L$I $ƒL$ $ǫ)L$D$ D$lT$ b L$I $L$Tƒ2L$ $̫)L$D$ D$T$  tjL$I $L$ƒL$ $ѫ)L$D$ D$輁T$  $B@$B@뉉$B@# _ P [ $D$D$uT$ D$|$5L$I $ ƒL$ $)L$D$ D$T$  L$I $A ƒL$ $)L$D$ D$誀T$  tjL$I $L$薵ƒtL$ $)L$D$ D$TT$ J '$B@$B@뉉$B@, $_ $D$D$MtT$ D$|$L$I $< ƒL$ $ث)L$D$ D$T$  L$I $L$荴ƒkL$ $ݫ)L$D$ D$KT$ A tjL$I $L$7ƒL$ $)L$D$ D$~T$  $B@$B@뉉$B@# XT $D$D$rT$ D$|$L$I $ ƒfL$ $ )L$D$ D$F~T$ < L$I $ ƒL$ $)L$D$ D$}T$  taL$I $? ƒL$ $)L$D$ D$}T$  {$B@k$B@뒉$B@5vjx  @Z $D$D$qqT$ D$|$L$I $L$ƒL$ $.)L$D$ D$|T$  tjL$I $L$謱ƒL$ $3)L$D$ D$j|T$ ` =$B@-$B@뉋 V $D$D$spT$ D$|$L$I $L$ƒL$ $)L$D$ D${T$  L$I $L$誰ƒL$ $)L$D$ D$h{T$ ^ tjL$I $L$Tƒ2L$ $')L$D$ D${T$  $B@$B@뉉$B@# l[ $D$D$ oT$ D$|$L$I $ƒL$ $=)L$D$ D$czT$ Y taL$I $ƒ6L$ $B)L$D$ D$zT$  $B@$B@뒃_ ] $D$D$ nT$ D$|$L$I $5ƒL$ $L)L$D$ D$eyT$ [ L$I $L$Mƒ+L$ $S)L$D$ D$ yT$  taL$I $贮ƒL$ $Y)L$D$ D$xT$  $B@$B@뒉$B@, U $D$D$lT$ D$|$IL$I $L$Hƒ&L$ $F)L$D$ D$xT$  $B@ 0_ $D$D$lT$ D$|$L$I $ ƒL$ $_)L$D$ D$twT$ j L$I $ƒCL$ $d)L$D$ D$#wT$  taL$I $mƒL$ $l)L$D$ D$vT$  $B@$B@뒉$B@5{?[ P $D$D$jT$ D$|$@L$I $ƒ&L$ $y)L$D$ D$vT$  $B@ Z $D$D$jT$ D$|$L$I $ML$譪ƒL$ $s)L$D$ D$kuT$ a >$B@. Y $D$D$iT$ D$|$t? ] $D$D$=iT$ D$|$ \ $D$D$iT$ D$|$~ D$$D$D$D$|$u-- ËD$ x  Xb`L$I $کŃuLu/|$u1 ËL$ uD$$D$@@MEuƉ,$E@빋L$ $)L$D$D$sl$|MEtdL$I $GŃiL$ $)L$D$D$Qsl$?MEtD$ É,$E@,$E@돋 [ $D$D$Wgl$D$|$L$I $FŃL$ $)L$D$D$rl$MEL$I $rŃtL$ $)L$D$D$\rl$JMEtcL$I $Ń%L$ $)L$D$D$ rl$ME,$E@,$E@됉,$E@1 X_ $D$D$fl$D$|$L$I $(ŃtL$ $)L$D$D$\ql$JMEtlL$I $٢L$FŃL$ $)L$D$D$ql$ME,$E@,$E@뇋 4` $D$D$ el$D$|$L$I $Ń{L$ $)L$D$D$cpl$QMEtcL$I $Ń,L$ $)L$D$D$pl$ME,$E@,$E@됃\ pY $D$D$ dl$D$|$L$I $ŃyL$ $)L$D$D$aol$OMEL$I $Ń&L$ $ì)L$D$D$ol$MEtcL$I $VŃL$ $Ȭ)L$D$D$nl$ME,$E@x,$E@됉,$E@1 $P $D$D$bl$D$|$@L$I $Ń&L$ $)L$D$D$nl$MEtcL$I $VŃL$ $)L$D$D$ml$ME,$E@x,$E@됋 U $D$D$al$D$|$PL$I $٢L$WŃ-L$ $Ϭ)L$D$D$ml$MEtlL$I $٢L$ŃL$ $Ԭ)L$D$D$ll$ME,$E@v,$E@뇃 H ` $D$D$`l$D$|$-L$I $ŃL$ $)L$D$D$kl$MEtlL$I $L$ŃL$ $)L$D$D$kl$MEl,$E@\,$E@뇋 0P $D$D$_l$D$|$4L$I $٢L$;ŃL$ $۬)L$D$D$jl$ME,$E@ ` $D$D$ _l$D$|$L$I $Ń}L$ $)L$D$D$ejl$SMEtlL$I $L$OŃ%L$ $)L$D$D$ jl$ME,$E@,$E@뇃   l\ $D$D$^l$D$|$L$I $ŃrL$ $)L$D$D$Zil$HMEtlL$I $L$DŃL$ $)L$D$D$il$ME,$E@,$E@뇋 \ $D$D$ ]l$D$|$L$I $ŃyL$ $)L$D$D$ahl$OMEL$I $Ń&L$ $)L$D$D$hl$MEtlL$I $L$ŃL$ $)L$D$D$gl$ME,$E@o,$E@뇉,$E@( \ $D$D$[l$D$|$7L$I $ŃL$ $")L$D$D$gl$ME,$E@- 4 hV $D$D$Zl$D$|$sL$I $ŃYL$ $=)L$D$D$Afl$/MEL$I $٢L$'ŃL$ $B)L$D$D$el$ME+L$I $eL$˚ŃL$ $G)L$D$D$el$wMEL$I $ŃNL$ $P)L$D$D$6el$$MEtcL$I $~ŃL$ $Y)L$D$D$dl$ME,$E@,$E@됉,$E@1,$E@,$E@Y Z $D$D$Xl$D$|$HL$I $Ń.L$ $()L$D$D$dl$ME&L$I1D$ $&ŃD$1;t$ }0L$It$ I $Bt$l$M F;t$ |ЃL$ $-)L$l$scl$aMEtlL$I $٢L$]Ń3L$ $1)L$D$D$cl$ ME,$E@,$E@뇋D$@,$E@ Y $D$D$Wl$D$|$L$I $ŃtL$ $`)L$D$D$\bl$JME%,$E@ S $D$D$^Vl$D$|$L$I $膗ŃL$ $h)L$D$D$al$ME,$E@o _ $D$D$Ul$D$|$TL$I $Ń:L$ $f)L$D$D$"al$ME,$E@ ^ $D$D$6Ul$D$|$L$I $%ŃL$ $j)L$D$D$`l$|MEL$I $ ŃSL$ $p)L$D$D$;`l$)MEtcL$I $ŃL$ $u)L$D$D$_l$ME,$E@,$E@됉,$E@1d 4U $D$D$Sl$D$|$IL$I $٢L$PŃ&L$ $)L$D$D$_l$MEtcL$I $ŃL$ $)L$D$D$^l$ME,$E@x,$E@됋 [ $D$D$Rl$D$|$PL$I $٢L$WŃ-L$ $)L$D$D$^l$MEtcL$I $ŃL$ $)L$D$D$]l$ME,$E@,$E@됋 X $D$D$Ql$D$|$WL$I $Ń=L$ $)L$D$D$%]l$MEtcL$I $ŃL$ $)L$D$D$\l$ME,$E@,$E@됋 ` $D$D$Pl$D$|$gL$I $ŃML$ $y)L$D$D$5\l$#MEL$I $YŃL$ $)L$D$D$[l$MEtcL$I $qŃL$ $)L$D$D$[l$ME\,$E@L,$E@됉,$E@1=H^5|^-T^T_S SD$ OtEt8t+t@Y$)D$1/1E؃Ãt uȃЃÃL$1D$ u--ÉL$t؃Ë xV $D$D$NT$ ÃD$u@u!u1 u$C@ u։$B@Ћ\$ŋL$I $S\$ƒt$)L$D$ D$Y\$T$ t @$B@Ћ\$, X $D$D$MT$ ÃD$.L$I $L$c\$ƒ$)L$D$ D$!Y\$T$  $B@Ћ\$ T $D$D$/MT$ ÃD$L$I $\$ƒm$ϭ)L$D$ D$X\$T$ C L$I $\$ƒ$խ)L$D$ D$2X\$T$  tiL$I $x\$ƒ$ۭ)L$D$ D$W\$T$  ]$B@Ћ\$I$B@늉$B@) X[ $D$D$KT$ ÃD$.[ \D$ t*t@Y$)D$g+1ȃЃÃ=lU5]-H_T_ _D$ vtbtKt4t@Y$)D$*1Ë__Ë[[ËH[H[Ë[[ÃtuPPË`[`[à )tt PE؃à t )ȃЃÃ-\tT\Y `D$ tDt7t*t@Y$)D$)1ȃЃ؃EÃ=^5Z-W`^ WD$ _tKt4t@Y$-)D$G)1Ë^^Ë\\ËWWÃt uËSSÃt+t t iȃЃ؃EÃD$D$u--Ë \ $D$D$HD$u1ËL$ $|ƒuJu/|$u1ËL$ uD$$D$@@ uȉ$B@뻋L$ $A)L$D$ D$ST$ t L$I $ƒiL$ $H)L$D$ D$RST$ ? tkL$I $٢L$>ƒL$ $M)L$D$ D$RT$  tD$É$B@$B@눉$B@+\$D$D$ u--É\$K $=ƒuJu/|$u1ËL$ uD$$D$@@ uȉ$B@뻋L$ $`)L$D$ D$RT$ | tbL$I $讇ƒmL$ $g)L$D$ D$QT$ C tD$É$B@$B@둋 ^ $D$D$ET$ D$|$L$I $ƒL$ $Q)L$D$ D$QT$  L$I $^ƒ|L$ $V)L$D$ D$PT$ R trL$I $L$賅ƒ&L$ $[)L$D$ D$qP\$T$  $B@Ћ\$$B@끉$B@$D$D$u--Ë Y $D$D$CDD$u1ËL$ $٢L$لƒuJu/|$u1ËL$ uD$$D$@@ uȉ$B@뻋L$ $r)L$D$ D$QOT$ t &L$I $ԄƒiL$ $w)L$D$ D$OT$ ? L$I $胄ƒL$ $~)L$D$ D$NT$  tkL$I $٢L$蟃ƒL$ $)L$D$ D$]NT$  tD$É$B@$B@눉$B@+$B@D$D$u--Ë W $D$D$&BD$u1ËL$ $S\$ƒu@u!u1 u$C@ u։$B@Ћ\$ʼn$)L$D$ D$GM\$T$ t thL$I $\$ƒs$)L$D$ D$L\$T$ I t؃É$B@Ћ\$$B@닃D$D$u--Ë ^ $D$D$@D$u1ËL$ $ \$ƒu@u!u1 u$C@ u։$B@Ћ\$ʼn$)L$D$ D$K\$T$ t thL$I $聁\$ƒs$)L$D$ D$K\$T$ I t؃É$B@Ћ\$$B@닃(T$,-uD$01(É$ XL$zlT$,u (Ã$)L$JML$, $)L$5JÃu$u ( u$C@@@T%u+^$)D$\$$C@ D$\$$롉\$$CD$$L$4L$y\$$D$|$s1;l$}JK l$ $L$ L$L$4L$l$\$$6T$L$ HE;l$|u7D$$L$ $L$4L$kT$0\$$1( u$C@볋^$ޮ)D$O(É$ `L$jT$,u (Ãj$)L$I0L$, $ )L$HÃH@@T%u.^$)D$\$$C@ D$C\$$ \$$CD$$L$4L$Bx\$$D$|$1;l$}JK l$ $L$ L$L$4L$ql$\$$T$L$ HE;l$|u7D$$L$ $L$4L$T$0\$$T1( u$C@볋^$H)D$(É$ YL$/iT$,u (Ã$w)L$GL$, $|)L$FÃD$$$L$L$L$4L$<\$$u7D$$L$ $L$4L$:T$0\$$R1( u$C@볋^$)D$(É$ HVL$-hT$,u (Ãj$)L$F0L$, $)L$EÃ@@T%u.^$)D$\$$C@ D$\$$q\$$CD$$L$4L$u\$$D$|$C1;l$}JK l$ $L$ L$L$4L$l$\$$T$L$ HE;l$|u7D$$L$ $L$4L$T$0\$$1( u$C@볋^$)D$(É$0Ãl^$)D$؉\$$D$x\$$?LT$P-uD$T1LÉ$<)L$D9L$P $C)L$DÃu$u L u$C@D$H$L$@L$L$XL$k{\$HuV9L$P $t)L$,D9L$P $)L$CÃpD$H$L$ÃrD$H$L$8L$L$XL$Uu\$HIL$P $f)L$>L$P $l)L$%>Ã@@T%u.^$r)D$\$HC@ D$\$H\$HCD$$$L$XL$m\$HD$41;l$$}JK l$ $L$L$L$XL$Q3l$ \$H[T$4L$HE;l$$|L$P $Ӳ)L$=L$P $ز)L$"=Ã@@T%u.^$ݲ)D$\$HC@ D$\$H\$HCD$$$L$XL$l\$HD$01;l$$}JK l$ $L$L$L$XL$l$ \$HXT$0L$HE;l$$|L$P $<)L$<XL$P $K)L$<Ã@@T%u.^$Z)D$\$HC@ D$\$H\$HCD$$$L$XL$k\$HƃD$,1;l$$}JK l$ $L$L$L$XL$I1t$,l$ \$HOL$HE;l$$|u[D$HL$8 $L$4L$L$0L$t$ L$@L$L$T$T\$H1L u$C@Ћt$8룋^$)D$LÉ$ ZL$KYT$Pu LÃ-$J)L$7L$P $R)L$7Ã@@T%u.^$Z)D$\$HC@ D$ \$H\$HCD$,$L$XL$f\$HD$8y1;l$,}JK l$( $L$$L$L$XL$2,l$(\$H L$P $>)L$ÃD$H$L$0L$L$XL$K\$HYuWD$HL$8 $L$4L$L$0L$L$@L$ L$)L$L$P $D)L$KÃ(@@T%u.^$J)D$\$HC@ D$ \$H\$HCD$($L$XL$ C\$HD$41;l$(}JK l$$ $L$ L$L$XL$Xl$$\$HT$4L$ HE;l$(|D$HL$P $)L$L$P $)L$@ÃD$H$L$0L$L$XL$I\$HuWD$HL$8 $L$4L$L$0L$L$@L$ L$\$HƃD$81;l$0}JK l$, $L$(L$L$XL$Dt$8l$,\$HL$(HE;l$0|uCD$H4$L$@L$L$L$X $')L$ÃD$P$L$)D$軿T e$C@U^$)D$~T $C@^$)D$ATÉ$ l\L$T$Xu TÃ/$p)L$ L$X $t)L$sÃD$P$L$@L$L$`L$\$PaL$X $)L$HL$X $)L$Ã@@T%u.^$)D$\$PC@ D$\$P\$PCD$4$L$`L$ \$PƃD$<1;l$4}JK l$0 $L$,L$L$`L$)t$T$4\$( 1, u$C@D$ $C@D$ v$C@fD$ a$ XL$T$0u ,Ãj$K)L$)0L$0 $P)L$Ã+@@T%u.^$U)D$\$(C@ D$R\$(\$(CD$$L$8L$Q\$(ƃD$ 1;l$}JK l$ $L$L$L$8L$*t$ l$\$(~L$HE;l$|u3D$(4$L$8L$o=T$4\$(;1, uĉ$C@Ћt$ 볋^$)D$ǝ,É$ xVL$>T$0u ,Ã$)L$L$0 $)L$ÃD$($L$ L$L$8L$\$(ku7D$(L$ $L$8L$)D$8ÃL$ $)L$UL$ $)L$nƒu$u  u$B@D$$L$L$L$(L$T$uL$ $2)L${L$ $8)L$ƒpD$$L$L$L$(L$舰T$Gu(L$ $L$L$L$(L$(L$$1 uω$B@‹^$>)D$轇 )$B@^$)D$耇ÃL$ $j)L$q?L$ $o)L$عƒu$u  u$B@D$$L$L$L$(L$xT$uL$ $)L$L$ $)L$LƒpD$$L$L$L$(L$ T$Gu(L$ $L$L$L$(L$'L$$1 uω$B@D$ ?$B@/^$t)D$Ã%uù) $D$D$D$ L$赛uÉD$$D$$)L$8<L$a1}ËL$ $)L$L$觫}ËL$ $)L$)L$}ËL$ $)L$ LSL$0}ËL$ $)L$ XL$0}ËL$ $)L$ `L$0}ËL$ $)L$ YL$s0}ËL$ $)L$ HVL$K0}ËL$ $)L$ UL$#0}ËL$ $)L$ YL$/}ËL$ $ )L$ VL$/}ËL$ $)L$ XL$/}ËL$ $)L$ @`L$/}ËL$ $$)L$ ZL$[/}ËL$ $+)L$ DTL$3/}ËL$ $5)L$ 0WL$ /}ËL$ $;)L$ (_L$.}ËL$ $?)L$ aL$.}ËL$ $E)L$ $_L$.}ËL$ $H)L$ [L$k.}ËL$ $M)L$ XTL$C.}ËL$ $S)L$ VL$.}ËL$ $])L$ @ZL$-}ËL$ $h)L$ l[L$-}ËL$ $o)L$ UL$-}ËL$ $v)L$ ]L${-}ËL$ $)L$ 0_L$S-}ËL$ $)L$ ZL$+-}ËL$ $)L$ PL$-}ËL$ $)L$ YL$,}ËL$ $)L$ \L$,}ËL$ $)L$ ]L$,}ËL$ $)L$ PL$c,}ËL$ $)L$ X_L$;,}ËL$ $)L$ [L$,}ËL$ $)L$ 4`L$+}ËL$ $)L$ $PL$+}ËL$ $)L$ pYL$+}ËL$ $)L$ UL$s+}ËL$ $)L$ 0PL$K+}ËL$ $)L$ `L$#+}ËL$ $)L$ `L$*}ËL$ $)L$ \L$*}ËL$ $)L$ l\L$*}ËL$ $)L$ \L$*}ËL$ $)L$ ZL$[*}ËL$ $ )L$ hVL$3*}ËL$ $)L$ YL$ *}ËL$ $)L$ _L$)}ËL$ $)L$ SL$)}ËL$ $)L$ ^L$)}ËL$ $')L$ `L$k)}ËL$ $1)L$ XL$C)}ËL$ $6)L$ [L$)}ËL$ $;)L$ 4UL$(}ËL$ $A)L$ \L$(}ËL$ $N)L$ VL$(}ËL$ $S)L$ ]L${(}ËL$ $Y)L$ [L$S(}ËL$ $])L$ _L$+(}ËL$ $e)L$ ]L$(}ËL$ $n)L$ aL$'}ËL$ $t)L$ dSL$'}ËL$ $z)L$ X[L$'}ËL$ $)L$ TL$c'}ËL$ $)L$ XL$;'}ËL$ $)L$ xVL$'}ËL$ $)L$ RL$&}ËL$ $)L$ XL$&}ËL$ $)L$ p[L$&}ËL$ $)L$ ZL$s&}ËL$ $)L$ [L$K&}ËL$ $)L$ ]L$#&}ËL$ $)L$ XL$%}ËL$ $)L$ l$\$T$u1 ËJ ~B뼸-$l$\$T$u1 ËK ~CÉD$e-,$l$\$T$u1 ËM ~EʼnD$-$D$$D$/D$T$ J ~=B@@ D$J ~BD$~L$ $O|ĸø-ݸ-뿃 L$ $ \$u ËS~K $L$L$L$L$ٝ ù-݃\$ T$C="tdC=0/tZB="tB=0/t$T$CÉ$T$\$ u ËJ ~B-$I\$ T$u ËK ~CÉD$ p-\$ T$C="taC=0/tWB="tB=0/t$T$É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$ۍÉ$iT$\$ u1ËJ ~Bĸ-$6\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$譋É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$NÉ$ T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$ˌÉ$YT$\$ u1ËJ ~Bĸ-$&\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$HÉ$T$\$ u1ËJ ~Bĸ-$v\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v- l$\$T$E="E=0/C="tnC=0/tdtB="tB=0/t,$\$T$ É$ l$\$T$u1 ËJ ~B뼸-$l$\$T$u1 ËK ~CÉD$e-,$l$\$T$u1 ËM ~EʼnD$-T$B="tB=0/t $萏É$FT$u1ËJ ~B̸-T$B="tB=0/t $胏É$T$u1ËJ ~B̸-T$B="tB=0/t $迏É$T$u1ËJ ~B̸-T$B="tB=0/t $ É$DT$u1ËJ ~B̸-\$ T$C="taC=0/tWB="tB=0/t$T$?É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$輄É$"T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$貃É$rT$\$ u1ËJ ~Bĸ-$?\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$ՂÉ$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-T$B="tB=0/t $ďÉ$~T$u1ËJ ~B̸-T$B="tB=0/t $É$(T$u1ËJ ~B̸-T$B="tB=0/t $/É$T$u1ËJ ~B̸-\$ T$C="taC=0/tWB="tB=0/t$T$5É$`T$\$ u1ËJ ~Bĸ-$-\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$譅É$T$\$ u1ËJ ~Bĸ-$}\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$艆É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$胄É$PT$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$ É$T$\$ u1ËJ ~Bĸ-$m\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$菃É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$҄É$@T$\$ u1ËJ ~Bĸ-$ \$ T$u1ËK ~CÉD$ v- l$\$T$E="E=0/C="tnC=0/tdtB="tB=0/t,$\$T$/ É$gl$\$T$u1 ËJ ~B뼸-$0l$\$T$u1 ËK ~CÉD$e-,$l$\$T$u1 ËM ~EʼnD$-\$ T$C="taC=0/tWB="tB=0/t$T$É$qT$\$ u1ËJ ~Bĸ-$>\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$l~É$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$}É$aT$\$ u1ËJ ~Bĸ-$.\$ T$u1ËK ~CÉD$ v-\$ T$C="taC=0/tWB="tB=0/t$T$|É$T$\$ u1ËJ ~Bĸ-$~\$ T$u1ËK ~CÉD$ v-T$B="tB=0/t $ É$T$u1ËJ ~B̸-T$ J ~-BD$$u ËL$ $躏ø-σL$A t $L$ $D$$bà L$ $o\$u1 ËS~K $L$L$L$L$b ù-݃L$ $!\$u ËS~'K $L$L$L$L$L$ L$ Gù-ՃL$ $\$ u ËS~K $L$L$ù-L$ $\$u ËS~K $Uù-\$ T$C="taC=0/tWB="tB=0/t$T$kWÉ$T$\$ u1ËJ ~Bĸ-$\$ T$u1ËK ~CÉD$ v- L$ $t$l$\$u Ãu$S~K $l$X ù-S~K $l$t$W ù-L$ $\$u1ËS~K $Aù-L$ $\$u1ËS~K $Өù- T$B="t(B=0/t$/L$/L$› É$fT$u1 ËJ ~B뺸- \$$D$C@T@%C@hKIh D$$D$D$D$D$L$T$(-u1҃uL$tȃ ËL$$ $T$(T$D$tۋD$$D$D$D$D$\$T$|$(u;|$u$\$L$ t D$L$뀉$B@|$u3D$u$\$L$N$D$rL$9D$ˋ^$F/D$C@ D$aT1 à \$$D$C@T@LC@h=KIh D$$D$D$D$D$T$(L$-u1҃uL$tȃ ËL$$ $T$(T$9D$tۋL$$ $ L$ȹ0/HD$$D$D$D$D$T$|$(u_|$t! t L$t$B@L$u$D$D$4L$E$L$L$0|$uD$뾋D$ȹ"HT^$r/D$C@ D$R1 ÃT$ tSB=.tJ $.L$hyT$ tJ ~Bø-B="tދB=0/tԸ/$pD$R1ÃL$ $L$L$D$ ƒuD$$xUu$B@8\$<C@T@C@hqfKIh t@ D$0$D$,1JT$0D$(t D$$$D$ D$D$D$OT$0|$,uwB D$B $L$0T$t ~ $T$T$ t'|$(tD$$$D$ D$D$D$H8É$B@̋L$,ɉ $2\$0ŃD$u'|$(tD$$$D$ D$D$D$CN81t$;t$,}MCD$X K HC $t$l$\$Ft$;t$,|1;t$,}4Xt t$@ $\$t$l$F;t$,|ME,$E@K oC $\$0C @@Ћ\$0Q1,L$4$HL$4@ $!L$4/$D$N8øÃ|$ 11;l$}  E;l$|Ã|$t$ l$19}9u C9|1ÃT$\$C9uACtCtSC t C1É$B@Ћ\$; Pt~Cu C =rZC D$ K $L$`l$\$C C uL$ K oLËC kIK @M<9u@Y$ F6D$XFÃTl$ Pu )~ KÃӋT TYT$ B B9}$l$l$\$ |YE+KC uKD$ $]1ËC C kCC؃ËC $]l$\$ C 닉@$[l$\$ C mE+ $`D$ u1ËD$@$h[l$\$ C ?ȃÃT$ B=E+u =TY|LB $\T$ Bu$BЃËJ uB$B@@ЋT$ ˋB |B $\T$ B BBtBtZB t T TTYx$C@ЋT$ փL$\$uDF6$D$IKËtB@T%u_F6$D$KËuڃ|ՋB9T$; PtBuy$;\$T$u ÉD$ @ $B D$J9}>D$ T$ t L$ 1Ë$@@ЋT$ߋB뿉$\$ÃL$ $L$L$Ã\$T$ Pt=u*tȉ P$et݃u =rF$DT$u1Ãt"L$ A $T$D$D$ L$ ȃË @M<u. $\$ƒu1Ë@  @M<ЃÃ\$T$ P}@Y$zF6D$A1Ãu*tȉ P$bt݃u%=r$T$D$" ɋ@M<uB $\$ƒu1Ë@  ɉ ɉ@M<ЃÉ$u1Ãà L$ $ =vW$F6D$@1 ËL$ $D$ Ã|$uF6$dD$G1ËL$ $6u1ÉD$ @ $D$D$D$D$ D$ Ã\$$T$B%t,|$ tB0T$$F6L$\$; T$ƒ|$(t#T$$F6L$L$(L$ T$ƒ|$tBlBL$,Ã|$tF6tۉBC 1DŽ$DŽ$DŽ$1D$|D$t$$$t%u B% But5 $pU$uD1É$$$%U 1  /tB ȃЉBt % l z $d  Ue M %; R S 4$ $|$te L$t $eTD$|uzC$t6$;$s t7;$r鋄$$U|$|t D$|$U1Ë$T$0@@ЋT$0밉D$x$$L$$$[$x $$$$J%RCD$0D$,D$(0(1  /tC ȃЉ1.u+C  /tC ȃЉluCdt Cuu D$,CzuCdt Cuu D$(C$dUZ%=RST$0t$B u䃼$t$$S$|$|tD$|$S$$$$@ )D$z$Ã$$@ D$$$p19}ET$$$9|⋌$ t$C$$$@@Ћ$$ʼn$%빃$$HQ<$A D$ЉT$ D$ $$D$ lj$eVt.c_$$@$2$$H$$@tBQ<$A D$ЉT$D$2 $$D$lj$$B ލD$8$D$,D$D$(D$t$ l$T$dD$5$L$x|$,tU $D$8D$$BD$y $$T$x!$B ރ|$(t1 $D$8D$$BD$ $$뢉 $D$8D$$BD$ $$ns.ip$$F6D$$$@D$ $$$Xu3Ƅ$x$$B $xtȍ$ $ @D$$$$D$D$D$ $$Ƅ$0Ƅ$xoD$8$D$D$t$ l$T$iD$.D$x$D$8D$$$@D${ $$T$x#$B ރ$<$$@ D$$@D$" $$$@lj$$ t $$$$@@Ћ$$ƃux^D$8$D$D$t$ l$T$xD$D$x$D$8D$$$@D$5 $$T$x$B ލD$8$D$,D$D$(D$t$ l$T$uD$Y$L$x|$,tU $D$8D$$BD$ $$T$xE$B ރ|$(t1 $D$8D$$BD$A $$뢉 $D$8D$$BD$ $$n1$ $D$x$E$U$$Ãw@$$$Bl$E$S$$Ã(@$$$$릃E@$딃Vtc҃M$EtA$Z$u $$$8}$D$t9\$tstitǃp$$ED$,$ D$L$, $L$L$F6L$Z$$Ã@$$$su2x$Bdt Bu+B%  /$BStnBRte  /tB ȃЉBt%usF  /uF똃D$L$ $D$?à T$L$uF6$D$9 ËA9~QBD$$A D$ЉT$D$ T$L$B9~B Éȃ à L$|%L$L$ $L$O ËW$G6D$"11 à T$B=E+uЃ ËB@T%tJ $JL$ É$D$?G6L$ à PT$ D$uFG6$aD$71ËB@T%t^$aG6D$c01ËB@T%tiЃD$BD$|$u*tȉ P$t݋L$ $L$L$L$$L$L$(L$ ËB=V#J $V#L$&^uiL$ $L$L$L$L$: PU ^ $1t%^$G6D$D$ @@ D$61Ë^$G6D$61ÃT$ u\‰T$ $G6L$訧 u L$ $L$L$L$$L$<ËL$ $G6L$n u L$ $L$L$L$$L$8ËL$ $G6L$4 \$T$u$T$L$$L$-CÉ$T$ƒu!u1 u$B@D$$L$ L$L$$L$T$ÃtD$ @@T%uJ^$G6D$C@ D$5\$ T$ n$C@ЋT$Z t؃É$B@Ћ\$ T$D$@@T%u 031Ãu‹L$ $T$L$L$tуÃL$ $L$L$Eu1ÉD$ $L$ L$L$$L$yT$ D$ tD$É$B@T$D$@@T%u y21Ãu‹L$ $T$L$L$jtуÃT$D$@@T%u &21Ãuƒ|$T$$*H6L$ڤ uL$ $ËL$ $0H6L$谤 uL$ $y@ËL$ $8H6L$膤 T$uL$ $ZCËL$ $T$L$L$>@@T%uF^$>H6D$L$ A@ D$3T$ $B@ȃÃT$BtÉ$D$L$L$ƒt|$tЃËD$PL$A@T%u01ËA ËL$A@T%u 0ËAøp4ÃL$ $ ƒu t$p4$D$D$dD$蓚 1É$B@σ8D$4D$0D$d@D$,D$D$@uJL$< $T$@u1|$4uD$8ËL$4 uD$4$D$4@@֋D$\L$D $L$LL$L$PL$L$T L$ L$X L$L$HL$wT$\wL$@ $ L$D$yPVD$4|$4FD$4@@T%u^$ЃD$:)L$4 $T$E+L$L$0L$ L$$L$b\$,L$P|$$} D$$D$$|$$D$$9D$0@ D$ D$0hl$L$h +T$$9~A9}ҋL$d $T$kl$aD$hL$d I L$lD$XL$$D$`T$L\$$ D$l$D$ D$D$c T$L$lD$hD$^$H6D$D$$D$/L$\ $L$T L$mL$\ $L$X L$nL$\ $L$HL$nT$\dL$ $L$L$L$L$D$ ÃxD$|D$tH6D$TD$LD$HD$DD$@D$<$ $$$l$D\$LD$`|$`u1xÃutD$`xËD$`@ D$\D$\D$PL$|D$dD$|;D$dT$||$Te /u +/Ar Zar z0r 9+>L$H L$HD$|\$LkكD$Hƒى\$LH!D$Ht%r DD$\D$\(1l$Dr D$\D$\D$|;D$d|$Tt (t|$T D$PD$\L$pL$` $L$`I T$\)ʉL$'}z|$@uQ|$<u(L$` t1xËD$`$D$`@@L$< uˋD$<$D$<@@붋L$@ uD$@$D$@@@덃|$@u1|$<uD$`xËL$< uD$<$D$<@@֋L$@ u‹D$@$D$@@@뭋L$|+L$tu D$`@ L$\)D$h|$l$ $L$@L$LI6L$QI6L$ L$tL$|$L$pL$L$lL$L$K6t$P=|UL6 $L$:t$Pl$T|U=|UW$gL6D$|$\uX|$Hu/|$Du1pËL$D uD$D$D$D@@؋L$H uċD$H$D$H@@믋L$\ uD$\$D$\@@놋D$t{U\$tCD$t}t D$t9D$t9,D$t9 D$t}'L6t$PD$tD$t)H=$\$L$t)IL$L$LL$ |U@Ћt$Pl$T|$LwD$XD$XL$L\|$LwD$XD$XL$L>K6qD$tna@&Ut\'D$XD$X\K6D$L+D$t9}:D$t9D$tʁɋ ;D$tƉKtlD$tʁɋ ;D$LD$Lƒ0rƒ9vTƒarƒfv8ƒD$LD$tKu|$Ll$TƒD$LƒD$L뺋D$XD$XbtfD$XD$X D$XD$XD$XD$X uGt6rttD$XD$X `D$XD$X LK6\vtxWK6?D$XD$X \$ T$L$J~9uÃJ1Ãl$$ 9~ $˃L$|$ 5_D$|$u1Ël$|$(tpEl$u<$T$$T$'T$P|$ 5_l$t0<$T$$T$"T$$|$ 5_l$'ED$$L$$~2|$(thD$@9u\E\ED$$L$$΃|$(t EL$IEL$ $+L$L$t1ËD$Ã\tE\EUEEEE EEEEڃ rRE\Eu EEEEڃ | uE\Etf uE\EnP uE\Er: rs E&E\ExEEڃ " L$ $L$L$D$ ÃT$ B@T%u 1ËJ $JL$ÃlD$pD$hD$HD$DL$t $f|$hD$X|$X|$XuX|$Hu/|$Du1lËL$D uD$D$D$D@@؋L$H uċD$H$D$H@@믋L$X uD$X$D$X@@놃|$tuD$XlËD$X@ D$TL$pT$t D$PD$p;D$Ps0D$p\D$TD$TL$pD$p D$p;D$PrЍL$X $L$XI T$T)ʉL$z|$Hu1|$DuD$XlËL$D uD$D$D$D@@֋L$H u‹D$H$D$H@@뭋D$p)D$dT$pD$p;D$PsD$p\]D$p)ЃD$p;D$PD$putD$pUD$TL$p uD$pD$X@ L$T)D$\119D$p /%D$p)D$`L$x $L$HL$L6L$L6L$ |$L$tL$L$dL$L$`L$L$DL$ L$pL$$L$XL$(L$\L$,L$TL$0|$hNƒ0r ƒ9ƒar ƒfƒED$p9wD$TD$TwD$TD$T|D$p)D$`D$X@ L$T)D$\L$x $L$HL$L6L$L6L$ |$L$tL$L$dL$L$`L$L$DL$ L$pL$$L$XL$(L$\L$,L$TL$0|$h;ƒƒ D$TD$TL$pD$p nl$$ 9~ O$ˉL$# |$$5_D$|$u1ÃuD$Ël$l$OD$ D$ E\EUEEEE EEEEڃ OLEL$ $+L$L$蔝t1ËD$ÁrRE\Eu EEEEڃ ET$ B@T%u v1ËJ $JL$Ã`D$dD$\D$<D$8ܰD$4L$h $D$L|$L|$LuX|$<u/|$8u1`ËL$8 uD$8$D$8@@؋L$< uċD$<$D$<@@믋L$L uD$L$D$L@@놋L$L $\$\uD$L`ËD$L@ D$HL$dT$h D$d9ȉL$D+D$d4)؉D$T M6D$d)؉D$XD$L@ L$H)D$PL$l $L$L$L $L$LI T$H)ʉL$萲Q|$<u1|$8uD$L`ËL$8 uD$8$D$8@@֋L$< u‹D$<$D$<@@뭋D$H$D$dD$D$g L$D\$\D$H;D$4wD$HrD$HD$dbD$d)؃D$TM6wT$u$D$D$L$ $L$ӲÉ$ft$l$Ãu!u1 u$C@u؃ËP M~ЃF M؃Ã\$T$,u:L$ $L$$L$L$(L$T$ L$0L$L$4L$AL$Ë $T$8:T$t( tҋ$@@ЋT$ $L$0L$;T$u $L$4L$~;T$uÃD$ $D$$D$D$(D$D$,D$ D$0D$D$4D$D$8D$L$ t $Ã$D$,uL$( $T$,u1$ËD$@$D$0D$D$8D$D$$ $O6L$P $$C{j$ $$L$L$XL$L$TL$ L$|L$$L$$L$L$dL$L$`L$ L$lL$$ƒu xËhD$tX Ml$p\$h $$L$$L$$L$ 9l$p\$hT$tu xÃua tK$$D$XD$D$|D$$D$ D$dD$D$`D$D$TD$oxÉ$B@먃9$L$l t1xÉ$B@\$d;\$`D$/$O6D$\$\T$|D$謎 \$\D$/T$( $$L$$L$$L$ \$\T$(u xÃuK$$D$XD$D$|D$$D$ D$dD$D$`D$D$TD$SxB]C;\$`$L$`$L$`T$dT$\;T$`}? $$L$$L$$L$ 2T$\u xÃuK$$D$XD$D$|D$$D$ D$dD$D$`D$D$TD$yxB`$$D$XD$D$|D$$D$ D$dD$D$`D$D$TD$(xË$ $O6L$/M u$1$ $O6L$M u$$$D$`!T$`\$| $$L$\ƒu x=-t ($B@ t D$`$B@DT$LD$@D$<D$8D$4D$0D$,|$PuL$H $T$L$TL$D$T$D$@|$@|$@uX|$0u/|$4u1DËL$4 uD$4$D$4@@؋L$0 uċD$0$D$0@@믋L$@ uD$@$D$@@@놃|$LuD$@DËD$<;D$LT$<\$H $L$PL$L$@L$L$8L$ A.L$H $L$LL$L$|$(t$$D$ |$ u11D$,L$,~-9}!<\.9(99}!<\.9t] $)L$3qÃu(L$ t1ËD$ $D$ @@|$ }'D$ @ L$D$D$ L$HD$ ËL$ $D$D$ŭT$t u$B@t u$B@E97<l$ $O|$(t$$l$ul$E9}!<#\.|$u9T$ $l$+L$L$o|$(t$$l$Ã|$ }D$ @ L$D$L$ $D$D$豬|$(T$t$$l$t `$B@P u$B@Ћ|$(t$$l$돋D$ @=E+2D$ D$ @ L$ D$E9<l$ $|$(t$$l$tE9i<Hl$ $|$(t$$l$u7AT$0D$  $|$(D$ |$ u119}D$0L$0|$uD$ @=E+9a\$$ $)L$'nÃu(L$ t1ËD$ $D$ @@|$ }'D$ @ L$D$D$ L$HD$ ËL$ $D$D$蹪T$t u$B@t u$B@띋D$ D$ @ L$ D$9T$$;D$,\$$ $l$)L$1m|$(Ã|$ } D$ @ L$D$l$EL$ $D$D$|$(T$t $B@ u$B@Ћ|$(E8A0L$DT$HD$ uW$qQ6D$T10Ãu.L$4 $L$8L$L$t$$l$o묃 L$$ $qD$u ËL$( $qt$,l$0T$ǃu t É$B@B9j} Bƃ}1J $)L$O L$|$OL$ L$\$T$D$ t tD$ É$C@$B@Ћ\$уqBŃc1\L$ $pD$ u ËL$$ $pt$(l$,T$ u t É$B@|$0~tJ $JL$H L$D$$HL$ t$l$T$ D$ t*L$$ tD$ËD$$$D$$@@$B@ɋJ $JL$H L$D$$HL$ t$l$T$ D$늃 |$t$l$Eu  ËG9w|$}GD$|$}D$E);t$}1 Ã|$ ~cG M 9uMO @MU I9t1 ËO $M L$ML$; uָ ËG L$M 9uMT$ O @MU I9uO T$ $M L$ML$c; i ÃGƃ1L$ $nD$u ËL$ $fnT$u t É$B@$D$ D$L$$L$L$(L$ L$,L$2\$ T$D$ t tD$É$C@$B@Ћ\$ у$L$IL$[T$u1ÉD$ @ $B D$BD$9 L$ $D$Ћ\$T$ u C=E+tЃ t؃É$B@Ћ\$L$iY D$Ml$~-\$ $Il$\$ ‹9t D$NjD$ÃL$iY D$Ml$~-\$ $0l$\$ ‹9t D$NjD$ÃL$AD$ Q D$D$ L$ ~?T$ $nT$t0 $°T$D$D$ L$ D$Ë $T$tՋ $BT$D$뻃T$JB D$L$ u1ÉD$ $֯T$u $T$D$L$ D$ ~?T$ $oT$u $T$D$L$ D$ D$ÃT$B D$Bu+L$ $L$‹9t 1ËJT$D$ 1ɋD$;D$ sSD$tfD$$SL$L$ $貮uL$ $ɮtD$D$;D$ rËL$ $臭u1ӉD$$4L$똃HD$DD$@ D$@D$R6L$L$3}1Ã|$u$聎1)S61ÃL$ $YD$ u ËL$ $YT$ u t É$B@D$$T$\$ T$D$ t tD$É$C@$B@Ћ\$ уD$L$ $Y\$ƒD$u@u!u1 u$C@ u։$B@Ћ\$ŋL$ $X PT$ÃD$t9u tЃÉ$C@ЋT$9u t؃É$B@Ћ\$JPщ $C\$T$6D$ @ $B D$BD$r$ \$D$@L$ I $C D$CD$D$ \$T$ t tD$ É$C@$B@Ћ\$у(D$ D$S6 $L$0L$L$$L$L$ L$ L$L$T$,u1(ËB9D$BD$|$ }BD$ |$ }D$ J T$ $L$+L$ L$L$$I L$L$$IL$ L$&D$L$ $D$L$$ tD$(ËD$$$D$$@@|$]BD$|$KD$>$D$ D$L$, $L$0L$S6L$T'L$ L$ L$L$L$zu1$ËL$( $L$ L$L$L$TZu1$Ë@@T%uA@T%tȃ$Ë^$S6D$L$A@ D${T$ t1$É$B@$D$ D$L$, $L$0L$T6L$'L$ L$ L$L$L$.yu1$ËL$( $L$ L$L$L$Xu1$Ë@@T%uA@T%tȃ$Ë^$T6D$L$A@ D$蓍T$ t1$É$B@0D$ L$8 $KT6L$L$ L$Dl$4u1011ۋUM Njm 9|$,sUE 2|$ ~7ؙ|$ L$ )Ѹ)9~W$YT6D$G10˃9|$,r)9ˉى $>D$|$u101D$X |$WL$I t$ |$ $|$t$ u-D$L$ $T$ l~7L$L$L$.5\$T$u1Ã|$t D$=-u$T$ËD$@@T%t$T$L$L$!ËD$@@T%tgL$ $;ED$|$u1ËL$ $L$L$L$L$D$ L$ tD$ ËD$$D$@@^$T6D$l~7D$p}1à \$T$Cu$L$ É$L$\$ à \$T$Cu$D$O É$D$\$O à \$T$Cu$L$ É$L$\$ Ã(5WL$0l$,}1ɃuE=E+A]كL$0tؙM9 A9t4$U6D$t1(É\$$B.L$,|$0\$D$$|$$u1(ËD$$h Au 19},l$ ,$A D$AD$n l$ \$D$,P9}J)9JЉÉщT$$l$ l$؉\$D$' l$ \$T$D$9|D$$(É)벉A (19},C4$T6D$s1(E(à L$$ $pBD$u1 ËL$( $UBT$D$u t1 É$B@L$, $ Bl$T$u8 tMEt1 É,$E@$B@Ћl$щ$l$D$D$L$0L$ X\$T$D$ t@ t*L$ tD$ ËD$$D$@@$C@ɉ$B@Ћ\$믃$D$L$, $-U6L$L$ L$L$L$ L$L$0u1$ËL$ $ AD$ |$ u1$ËL$ $@D$|$u(L$ t1$ËD$ $D$ @@L$( $L$ L$L$L$L$L$ /D$L$ t*L$ tD$$ËD$$D$@@D$ $D$ @@ T$J $JL$L$#o Ã(:U6 $L$0L$L$$L$L$ L$ L$L$腹T$,u1(ËJ $JL$L$$I L$L$$IL$ L$ L$L$L$pD$L$$ tL$ $農(ËD$$$D$$@@ۃ(@U6 $L$0L$L$$L$L$ L$ L$L$ظT$,u1(ËJ $JL$L$$I L$L$$IL$ L$ L$L$L$ö‰D$L$$ t.}W$GU6D$o1(É$(ËD$$$D$$@@ЋT$빃D$ L$$ $[U6L$L$L$TL$ L$L$-T$ u1ËB;D$| B=E+t)$JT$)ʉT$D$L$L$ WЃÃt$T$ l$}1}1B9~juB9t 9~J $)L$+ËB=E+uЃÃL$ $=\$ƒD$u1Ãt/$=T$Ãu t1É$B@$\$\$L$L$ \$T$D$ t#uD$  u$B@$C@ЋT$̃-D$D$L$ $fU6L$L$L$L$L$ 1,T$u1ËD$=-u$D$L$L$VËD$@@T%t$L$L$L$L$&É$L$L$L$L$Ã$L$( $.<D$ u1$ËL$, $ ^ $`it%^$U6D$D$(@@ D$n1,ËL$0 $D$$D$L$ L$L$L$ L$T$$D$ tL$ $Ej,É$B@,D$ D$U6 $L$4L$L$(L$L$ L$ L$L$Эu1,ËD$(@@T%1ۋD$(@9ډ\$\$( I $5u1,ËL$0 $D$$D$L$ L$L$L$ L$\$T$$D$ t5|$t(4(4,CD$(@9u"",É$B@Ћ\$뺋L$( $w4u> ^ $gt%^$U6D$D$(@@ D$l1,ËL$0 $D$$D$L$ L$L$L$ L$#T$$D$ tL$ $|h,É$B@L$AËT$\$uCËL$ C\$ u--Ë $K)L$!Ã\$ u$D$u!Ë $K)L$Y!ÃT$ W|$ u%t $"V6D$d1Ãu $mV6D$cÃ$L$L$ \$ CCu1ËKI C@ CC dÃT$BH )B L$ D$у $D$D$V l$}1ËEp T$ MT$ ME = }e à \$T$B )9~$\$b\$T$t1$D$D$D$ D$L$ 1 Ã|$1҉T$O9r Ë/G9s~l$M $t|$t$l$Ã} ù)gfff9~ W$V6D$iÍ؉‰D$G9rЃÃL$ $>u1ËL$ $D$D$ŕT$D$ tD$ É$B@L$ $L$L$VÃL$ $;u1ËL$ $D$D$hT$D$ tD$ É$B@L$ ${u1ËL$ $D$D$hT$D$ tD$ É$B@ D$$D$D$D$D$T$ J Ã\$ T$J BJ9sBB.t[uBJKÃl$T$1ۋJMBJ9sBB]uuW$V6D$7`1ËJMÃl$\$T$ BJ9r ËBB.[tW$V6D$_1E$\$3u1ËL$ $T$u _u7D$L$I9uW$7W6D$`_1ø1E$\$uu1ËD$뙃 l$$L$(9ˉL$s؃.t[uD$,$l$؉\$)D$L$D$4$L$D$)D$L$, $t$0l$8u^t$0l$8D$,L$,I9Ãuyur1ƒtIEuuEt*M $\$\$t$0l$8\$t1 ÃtME Ét 뫹1r1 ÃH\$LD$D $K)L$L$,L$L$(L$ L$L$L$XL$j\$Du!u1H u$C@|$(L$, $l$T\$Dƒt1,$T$T$T$D$D D$DL$ $L$ Ã0D$(D$D$8$D$D$D$@$D$D$D$D$D$D$T$(|$Ll$4D$HD$<EM9r 0ËuEM9sEE{t}uD$EM9rE)Ã}u+u E9tW$W6D$X10Ãt {uE9ED$D$80D$8 H|$u 0ËD$<]EM9EE{tb}uJٍD$$\$E)؃D$zL$ $L$@L$L$DL$L$HL$ u10ø0BEM9{W$X6D$V10KW$W6D$V101 \$WL$rtPst? vr$9X6D$L$(^1 É$X6D$D$ ^$x É$(u Ã,D$(D$L$0 $L$DL$L$HL$L$PL$ Nl$<\$(ƒD$$uBu#uD$, u$C@ uԉ$B@Ћ\$(Ãt6$l$T$$ÃD$(t ډ\$$D$(|$8L$4 $L$DL$L$HL$L$LIL$ L$PL$T$$ÃD$(8D$$C D$CD$HT$$D$É$\$L$@L$s\$(T$$D$\$4ȉ$B@Ћ\$(7TT$XD$L$D$B )D$nL$L $L$8L$L$@L$L$0L$ L$(L$L$$L$L$HL$ZL$d $L$8L$L$<+L$8L$&u1TÃ|$@tL$0 $L$(L$L$HL$L$$L$ L$dL$L$\L$L$`L$L$hL$L$lL$ 11TÃTÃ0\$4D$D$(|$@HW$[X6D$S|$(uD$0ËL$( uD$($D$(@@֍L$ $K)dL$gtL$4 $L$8L$L$ƒu ËD$ J  u$B@sD$  e$踆ƒD$ucDT$| D$ (W$[6D$CÁ`$dDŽ$@DŽ$<DŽ$8Q$hC$mu 1`Ë@ $\$4A$Td$P$L$$\$<$<$<ui$4 t>$@t$h t 1`Ë$h$$h@@܋$4$$4@@맋$< u$<$$<@@i$<@ $X$h@@T%$h $a-$\$HDŽ$D$h@@8t$h@@8@2$T$T$\E%$P$P}k$Td$P$L$< $$LL$x$\a$L+$P$<I $X$P$X$X $T$T@$D;$H}$8$< $$L+$PL$$@t$h t9$4 t$<`Ë$4$$4@@׋$h$$h@@묋^$]6D$e@7DŽ$0DŽ$,DŽ$(1ۉ$$1$1$$\E(3$8u^$[6D$?$T~$T$T艬$\)H$T$D$ƒD$Q$@t$h +DŽ$@$8 $T$F$T$$$\$$$h $hDŽ$@DŽ$HDŽ$D$T$T|/$\+, #*$$.$h $$HL$$DL$&ƒ0@@T%u^$\6D$2>$$T$$$\$$$,$,u*4>$$$\$$$,}$0$,؉$,$T$T|$\.4DŽ$($T$T|$\*$$5 $h $$HL$$DL$ƒ@@T%u^$.\6D$<$$裀$$$\$$$($(u*<$$$\$$T$(} DŽ$($T$T|$\$T|/ht l $T$T|$\$T}W$G\6D$;%$$tE$h $$HL$$DL$y$$\$$ƃnDŽ$ DŽ$  ftyXZT%.Et\FtWGtRW$\6D$r~v1?D$\$ $4@ )ȃD$Bω4$$0L$$(L$\$ _$$ǃp $$hDŽ$ $0t DŽ$ 0$ t4-0+%$0DŽ$ +$,9艬$}$,$ $P);$,$P)$L$T$,d$P$L$L}%u ?u<$G@$< $$LL$x$$$$}@$I$ 5$$$@@$L+$P$<I $X$ t;$  t$X$X$ $P$,9~$,$0tlxtXub$  t0$X$X $X$X $P$,$,} DŽ$,$,9~$0$  uk$ t$X$X$ $0t:xtXu0$X$X $X$X $X$$t$艬$D$ $,$$$\$X)$PK9|!$P$X$X K9}߃$8t$D;$H|- $B@Ћ$\$$%tɋ^$\6D$6$ $B@$P$X$X$ $,$,9A1T$0tDŽ$  DŽ$ $$ MD$(Ɖ$%iu DŽ$$dDŽ$$4$Q$$$$$:$@@T%$@@T%m$ $h$$$$$ƒu-$ $.k$$$$$ƒB@T%DŽ$D$($$xL$$0L$$(L$ \$T$$T$T$$$$$$ʼn$ tulDŽ$ $u4^$\6D$ÉD$$@@ D$ ;#$0DŽ$ 0$B@Ћ$$$$$_B@T%DŽ$T$$$$0L$$(L$\$ T$$$$lj$ t&iw $oDŽ$ $B@Ћ$$$ $B@Ћ$$$$$$ctdeD$($$xL$t$$$$$Ń"rqt gio=tF=E+u s3s4$ T$$ǃ(G@T%t;w $$o$(;$($(vG@T%tm $$OL$D$Y\6L$ $$$D$$ t|$$y\$B@Ћ$$t^$`\6D$i1;<$G@׉4$P$$suxL09؃Љ$($T$T$\0w9n/)ٸgfff9$(~W$:\6D$}0O$(؃Љ$(o09؃Љ$,$T$T$\09/)ٸgfff9$,~W$ \6D$/$,؃Љ$,o$0$0$0-t0$0$0$B@Ћ$$$\$$'$h$$h@@ЋT$W$[6D$.E)u I E(uA틄$h@@T%$h@=P-$hI $P-L$\$\s$h$8`DŽ$HDŽ$D[6$K D$51`Ã(l$,\$0T$4D$$D$ D$E+t,$\$T$(É$T$f]6L$'L$ L$$L$L$ L$L$L$k u1(Ã|$$u$I(Ã|$ u|$t L$$ $L$ L$L$L$(ËL$$ $O(ÃE+ $L$ L$L$$L$\$u1É$D$HL$ L$ЋT$D$u t1É$B@L$  $%CT$B B u+$DT$ t |2É$B@B $D$@ D$D$ D$ \$T$L$ KJK t؃É$B@Ћ\$(D$ D$ D$D$D$D$D$ ( D$$) = Pu$ Pu(ùE+ $B} {]6$L$ $L$T-$N- $} ]6$II) $ܶ} ]6$*(ÃTYD$ TtBʋD$A tT$B $BCT$Bu)$.CL$ TYuTD$ ËJ uˋB$T$B@@ЋT$밃 Pt P tV1ہ}2<@M<t@M<\$@M< tC| É$B@Ћ\$݉ $A@띋D$=V2"=ty=f #ti= ==at78jta48t/0t'1t2t3t\91|?0?1Ã5t6t 7u!x31 1=,t#9t=t=t=u1/=t=t=`gz10=j_=f7r=b==c+=d4=eH=g/=h9=iU=7========m =j=7o=a=S=A=(*=W=E=.=i 7=W=f =g =h =j =k =l = j= 7=n =o = v= Sc= J= S= -g= #=~y=|Ct:=xt,=yt=zt={8w6(44$149=t =t=3x3d3=7=========j=7u=g=Y=G=.0=]=K=4=7=]=======Lj=H7===F|=GYi=IP=JY=K3m=,9=MG=NQ=Om====c$U=x =Y==j=7====K=P=H=%5=7D===1===>==Pj=7====v===P=U7}=QH=R6=S$=T(=V:=W(=X-=G=j=7=======j=C7_==@Z=AL=B,5=D7=EP=F9=Vj,=R7=H"=IC=P=Q=S=T=U=t 7=W=X=Y=p Wj=u =v t=w 1]=h!=V!= j.= 7=y W= = = = = = =R!?t6= = =P!t=Q!hl<-0C<=S!t =T!t=U!:Ġ!/.!=_!}"=[!B=W!t.=X!t =Y!t=Z!l^4 .e"P8=\!t =]!t=^!̞!s1Ȭ1=d!7=`!=a!=b!o=c!]s=e!=f!s=g!7x=z!tJ=q!s&=m!==i!o=j!t=k!t=l!T33=n!t=o!V=p!$=v!7=r!=s!=t!=u!r=w!=x!=y!L=!mr=!7={!@=|!=}!=~!J=!=!t=!}8=!1=!-=!t=!!P!=`$=a$=b$z|=$=$=u$P=l$mtd=h$7=d$`=e$N=f$<=g$A=i$_=j$ =k$ "=q$==m$t)=n$t=o$=p$"V"=r$=s$=t$iy=~$j|=z$7{=v$F=w$O=x$h=y$Q={$T=|$u=}$b=$7*=$=$=$4=$=$=$=$=$=$j=$7=$n=$\=$J=$8N=$`=$N=$S=$7o=$d=$=$=$=$,=$=$=$j=$7=$=$=$=$c=$~=$=$==$,}=$0=$=$ =$=$=$='@='=w'j=$7=$=$=$=$w=$=$t=v'Qa=|'7p=x';=y'D=z']={'F=}'I=~'j='W='jJ='7='='='='='='='|='7='t='b='P='>T='f='T='Y=1 =&0j-="07='L=,w=0=!0=#0=$0=%0=907='0=(0=)0=80X=:0=1R=12;='2jf=#27.=1#= 2=!2="2=$2=%2=&2=R21t(=(2=)2 =Q233=S2t =T2t=U2k4 43t"=w =ԩdH=^n=4=2l=_2tx=[2Ct:=W2t,=X2t=Y2t=Z2?`"\""l"=\2t =]2t=^23333=27=2k=2Y=2G=25K=2]=2K=2P=2}tt=2Bt9=2X=2t =2t=238434=2"=2t=2 4,1474=2Et<=2t.=2t =2t=2Y >6044Hu44d^4=2t=2=4ST`6=FQ=Nj.=N7=*8=M;=N=N= N=]N =N=N:=N=Nt=N=NVd"= O~=pO=Q)|1=Sj=CS7=iQ =kQ6=mQ=ASD=DS=ES?=LS(=X7=S=S=S=Vv=X{=z^p=^P=r=L=sj=b7~= _= _=_=_=Lc=g=o=7=~v;==,l==0}=!=FY=&j="7H=xg=<= 1=!=#=$=%"=7='=(=)'=====ר=4ju=07=z===(;=1=2=3 =Ө7=5"=Ш=Ѩ=Ҩ=Ԩ=ը=֨=j=7=ب=٨=v=Sc=J=S=-g=Щ,3=A=K= g=ѩ=ҩ=ө=$===Sj=٩7=թ=֩=ש=ةV=P^=QP=R09=X7d=T.=UG=V5=W=YT===sj)=7=======k[]=7=xL=K=`=P=%===a= j=7 =======u~=7= s= = z= 7c===^=otf=7=d=R=\===J=6,p;= Bt9=t+==t=i|<h;A8}8=!t="=#0'(${8=T=B=-}tt=)Bt9=%t+=&='t=(%8<%'=*t=+s=,DP98X)=2Bt9=.t+=/=0t=1Dx;+`; ;=3t=@=A X"=Kj=G7C=C=DA=E=F=H=I =J=P7=L=M=N=OU=Q=R=S/x=f=]j=Y7=U=VG=WM=X=Z=[=\=b7 =^=_=`=ao=c=d=eI=oj=k7=g=h=i{=j=l<=m1=n!=s,=p =qD=r=t=u/=v=0$=h= U=Q=j>="7=x== =!*=#R=A=J=7===="===fh=[j=7={=i=W=\=X =Y=Z= 7=\*=]h=^V=_= = = '=^ =G j=C 7|= ]=@ `=A N=B 57=D =E l=F =Z 7=} =~ Y=X =Y =[ =\ %=] = j-={ 7=_ =x =y y=z `b=| =} =~ :=d7g=`2=a =b=c=e$=f=g= $=z=qjo=m7=i=j=k=li=n=o)=pC=v7=r=sw=ts=u=w=x=y=$j=$7={Z=|#=}s=~\=$=$=$n= $7w=$=$=$=$02= $_= $M= $ 6=$=$j=$7 =$A=$=$=$=$=$=$=$7=$r=${=$=$J}=$=$=$$4=($jJ=$$7 = $=!$ ="$#=#$=%$=&$='$=,$,=)$=*$=+$=-$~=.$l=/$Z\=|=X$H=D$h=;$j=7$7=1$<=4$=5$=6$=8$=9$=:$=@$7=<$==$=>$=?$x=A$=B$=C$R~=M$j=I$7=E$n=F$=G$=H$t=J$=K$=L$=R$7=N$=O$=P$=Q$=S$=T$=U$}=g=a$j=]$7!=Y$P=Z$ =[$=\$!<=^$=_$=`$o=c7=b$W=`=a=b=d=e=f=pjY=l7=h=i=j=kL=m=n=o&=,"=q========j=7====`s=^=L=:P=7@=U=C=M=i====j=7)=======en=7=c=|=j='S==$== ]=j=7========7=w=e=S=AW=i=W= \= jA=* 7="=d==! = @= .= =),= = =#w=;n=mbw=QD$= lt 2t t t t t1øà ttu=ttۃ t=u=t=t= u= Dt= t= t= t= u= t= {= mk=/ ,^= S=( H=) :8=_ -=0D$(t t t t1øà tut=t=( t=) u҃\$r1҉ ,0É b‰ك ǃ L$ $H@%tȃ Á|D$ȃ ÃL$ $i@@t 1L$ $AHt@ øL$ $}1øÃL$ $Ht@ øL$ $}1øÃL$ $@%t 1L$ $}@t 1L$ $U@%t 1 L$ $+@%tȃ Á|D$ȃ à L$ $H@%tȃ Á|D$ȃ ÃL$ $@t 1YHD$1ہ}f[i<[<i<t+ [ i<\$ [i< t9[i<C|YD8$D$É$B@Ћ\$ 붃D$@T%uËD$D$|$tJD$@D$1;\$}7D$@ \$H ~,@=-t $\$C;\$|ɋD$`Tø-Ѓ\$ D$CT%uËD$$@D$1;T$}(щT$T$$H A@T%uD$|$tcTËAT%t$L$\$ T$tBD$뻃\$CT%t ËCT%u1ËCT%u1Ë YY1}Hhi<h<i<u9- i i<-E|D8$Éj i< u i i<$l$ i i<@@Ћl$yD$D$@D$ 1;T$ }2щT$T$@ $\$T$u1B;T$ |΁KTÃT$BT%tËJ $.L$X ƒuD$P $B^L$T$ AT%u!$7$D$A D$Ãu!$M$D$A D$ËB@T%u+$f$D$A D$B@ D$ Éу $詁 l$\$ K9t W$$D$YكM t1É$B@T$BT%tJ $$L$u`$Ʊ$D$1ÃuȃJ $.L$eV T$tJ $J )ʉT$ùѱ$ $à ^L$AT%u!$ݱ$D$A D$F Ã|$u!$$D$A D$ É $L$ $$L$L$L$- à T$1ɁH)t $$L$譑u`$/$D$1 Ãuȃ T$ty$#D$} ËL$ $C$L$L$L$腑L$ u"D$$T$L$ |$t JTȃÁbTD$L$ $W$L$蟑D$ t W $HL$ t`$k$D$ËL$Ã(D$,u1(ËED$1;\$}1l$E \$H @=-u C;\$|1(ËD$T$$$\$$T$}(ù $\$T$T$ÉD$ ttu (ËL$0 $\$4T$ } ( t.L$$ $L$0L$l$\$;(É$B@ʼn$B@Ћ\$ x-@=^t$D\$HFT%u!<$$D$F D$@Ãu!<$$D$F D$@ËC@T%u+<$$D$F D$C@ D$ @ËCu!<$޲$D$F D$@1C9}}l$<P B=4tB@T%B@T%t=$t$=^t$Dl$<\$Ht<$X$D$m@EC9|$u @ËL$D $D$,D$$L$Cl$H\$,T$Du @ED$$D$(D$ $5\$D  t_;D$ t t'L$$L$(L$ @Ë$@@Ћ\$D뼋$@@Ћ\$D넋$@@Ћ\$DU$\$D)$D$0D$D$8D$<L$0 $l$0\$DT$<9}xE $$D$D$D$ D$D$D$D$vD$D$D$L$ t D$t$(| l$T$BT%u9tD8t1 øt'~19}@ 9u  C9|1 9u  ËuD8u  1T$ uL$ $辕T$ u1ËL$I $ L$k#l$ƒtBuЃÉ$l$ML$ЉL$ $L$L$L$L$jD$ |$ u tD$ Ë`$D$D$ރ L$ $L$L$L$L$ ÃD$0D$L$ $L$$L$L$(L$T$,D$u(+u`$D$(D$v1Ãtuy$tƒu1ËL$ $T$T$D$\$T$D$ t tD$ É$C@$B@Ћ\$щ$L$L$j끃D$0D$L$ $L$$L$L$(L$T$,D$u5u(=+(=+1Ãtuy$臸ƒu1ËL$ $T$T$D$\$T$D$ t tD$ É$C@$B@Ћ\$щ$L$L$}끃L$ $L$ L$|} Ãu"L$ $L$ L$} ËD$ @D$D$@D$1;T$}9щT$ T$@ L$ $D$vT$ } B;T$|1à $t,D$$L$L$/T$uЃ t1 É$B@|$t$ n\$C9}F 9u C9|1à L$ $$L$ƒD$unT$uKL$ $ƒu1 ËB@T%u t1 É$B@Ѓ u$B@럃D$ x19D$ @ 0C9}wD$ @ 9ub4$/^$$D$L$ t6ȃD$T$ u  u$B@ʴ$C9|E9m1Á>$$ƃuË$ @$ DŽ$$;$ $ @ $C$9}ZC $ t$4$D$-L$Lt$$$}tÉ4$F@$$;$ dt$4$ng$L$$ $L$̴$L$($DŽ$L$ $$L$L$ L$L$L$ Ot $r7^$D$$D$IT$ tÉ$B@L$ $$L,$ $)L$$L$D$L$ ]$T$É$uB$$@= D$$C,$D$ u$B@Ћ$롹$u0|$8GD$$L$$Y1ƃu 01;T$$}B;T$$|D$ 1;l$$}G C9|HD$ E;l$$|D$ ;D$$u4$A 10É<$t$t$D$$ 0ËC l$,t$ D$1;\$$}CG $\$( L$L$L$-|$8l$,\$(t$aC;\$$|L$4 $L$L$K|$8t$}4$801;l$$G C9}C ;D$tET$$tL$$ $ |$8,T$0u$ST$0}1,ËL$IL$$A $D$u1,1;l$$}vl$(T$P B@T%y $} l$(Ãu(L$ t1,ËD$$D$@@D$@ E;l$$|L$ $+ \$u t1,É$C@D$$7\$T$}6 t t1,É$C@$B@Ћ\$ӋB L$$$ $L$0L$@T$u t1,É$B@D$$T$\$T$D$ t)|$ } t1,É$B@Ѓ,É$C@ЋT$Ɖ$+l$(D$ $Ã0T$4D$ B=H)$Ãu 0É\$($T$(ʼnD$$ ou 0Ã|$ t@L$4 $l$$D$ED$1;\$}\$H A=4uSC;\$|D$4D$4$D$4D$L$4 $D$D$4$10ËA@T%uD^$$D$A@ D$ T$$ t 0É$B@L$ $D$L$ $L$L$l$$\$$^$C$D$D$ @ D$T$$ t 0É$B@$B@Ћl$$}D$ $$L$SL$ u 0ÉD$,$D$T$,ÉD$( $B@Ћ\$($D$(@D$D$D$D$ D$ ;D$}&L$ T$(H A=4u4D$ D$ ;D$|ڃ|$u^$$D$D$$ËA@T%u^$y$D$1$ÉʋuT$ $NT$ }1$ÉT$ $,\$uD$D$ D$Q$D$D$8L$ $L$L$tD$D$D$ D$ ^$$D$1$Ãl$T$ ZuBuzEurBhtEhtFt t9t 19uBT%tՃЋBh9uBT%t9uJU9u1ø \$t9 $\$‰$T$T$tD$ ËD$ úD8ԋL$t)t AT%tu1Éà `u $ $kƒ`u1 ËL$ $T$t@tȃ 1 à ^$$D$D$@@ D$ à L$$I $%tQ$Vl$$ƒu,$1 Ë@u,$1 É$l$ML$Ѓ ËL$$ $u`$/$D$蟿1 ÉD$u 2‹L$uЃ  L$$I $htX$l$$ƒu,$ Ë@u,$ É$l$L$(L$Ѓ ËL$$ $)\$(u `$K$D$վ ÃtC@T% t.u#u1 u$B@ً^$g$D$C@ D$ Ã\$C@hu`$$D$61ËKIh u -ȃË 5^L$A@T%u!4$$D$A@ D$n1Éʃiu19}&uA  /u_uCB9|ڸÉ4$׷$D$w1  /u뽃11;t$ t$T$@ D$@@T%t||$uL$ $cD$u1ËL$ $D$蜑|$t$l$Ãut1É<$G@G MEtBF;t$ Wt|$<$T$D$ tD$É$B@,$E@Ћ|$t$멃\$T$tC@T% tB@T%uZ$D$D$L$ $D$D$D$xT$D$ tD$ É$B@BtBt^$ $D$蜻É$*XT$L^$$D$gÁ$$]\$, 1$@=H)u  ȃt ^$W$D$1ĄÉ,$T$u$L$U-L$ $L$W.L$L$|L$\4L$L$xL$ ʬu 1ĄËD$|@D$L$1;l$L}$l$PT$|@ P4c E;l$L|;$t<=(t($$L$$L$ЁĄÉ$|$L  $D8L$`D$||$|u 1ĄD$LL$| ${u+L$| t 1ĄËD$|$D$|@@D$d@T%uI^$$D$A D$L$| t 1ĄËD$|$D$|@@L$x $&$L$d\$dD$HD$@D$< ʼnD$4Khu K 1D$0T$t|tD$@tD$<$ $L$HL$$Ћt$tl$dƒuFu+L$| t 1ĄËD$|$D$|@@ủ4$F@뿉Ë$$BTET%@tJT@ET% tJT ETE0فJ0فlJ4ف`J8ى\$XJP$J L$|ET$hL$x $ST$hD$x|$xu t 1ĄÉ$B@L$x $ $L$buG:$t=$$L$bt'L$x $$L$D$b} 1ĄËL$x $($L$Zbt@@T%L$x $0$L$*bl$hƒt@=h)LL$XIIT$X ƋD$dx|$ttCD$PD$P;D$H}1T$P\$t I F~D$PD$P;D$H|σ|$@tD$d@Dž|$<t}h}L$dIML$XIIT$X ExEhtgEhtCEhuE||$HMEE ET%@t^^ M\M`,$@T$h} t 1ĄÉ$B@$ND$hĄù:밁MT@qD$d@ u D$d@Ht-D$d@$)D$d@L!ML MHɹ$<M|d1M|p$M|9$1T$hu t 1ĄÉ$B@D$x$8$D$L$pL$_T$pl$h P$B@Ћl$h=?u=J@tЃË^$$D$܋ W $$L$L$븃,D$(L$4 $L$8L$L$(T$0t@=J@t=?=J@=?}1,ËBT%D$D$$D$ѼD$$|$$|$uX|$u/|$$u1,ËL$$ uD$$$D$$@@؋L$ uċD$$D$@@믋L$ uD$$D$@@Lq$q$L$MW$L$$L$D$`D$|$*ux$ $fƒ`${$L$$L$L$L$ TD$|$L$ $#^$$D$D$0@ D$L$ A$D$Ѓ,Ë^$T$D$uT$0 W $7$L$L$PT$0L$ $AЃà D$$@D$$D$耹ƒD$ 聦L$ $D$T$D$u!u1 u$B@tу $$L$- um$ $L$I L$L$$L$׻T$D$u*L$ tD$ ËD$$D$@@ u͉$B@˼$ $L$L$L$L$L$$L$ _T$D$놋@@T% t D$$B@\$ CP,uB$҃ËL$AAËl$\$9tQtu1ËMS9uMS9u鋍9uًMhSh9uϋMT@ST@9u봃|$ l$P9u9Eh9ЉT$uGh9tftuM9uO9t1øt$ 4$D$n|$ l$T$t1ËD$ @밃T$둃wT$$\$ BK99\$$T$L$T$t D$Չ$T$L$uT$tًD$9tdD$9uL$ $T$u;^$$$D$D$(D$D$$@ D$ D$ @ D$ 1øË^$$D$D$(D$B D$ C D$1Ã^L$D$hu$X$D$ËA@T%u$$y$D$A@ D$耤ËAT%teET%tXL$ $l$l$ݽ$L$7\$ T$t%D$X t1É$B@É$$D$ÃVu $ $aƒVu1É$GÃL$ A@T%u--Ë$ $L$cGt@@T%iu1ÉD$$$L$&$L$L$ L$ \$‰D$ tXt-uЃËB@T%u^$($D$=T$ t1‰$B@$C@ЋT$ȃÃ`D$PD$HD$DD$@D$<D$8D$4D$0D$,L$d $Y$L$=D$\u1`ËL$d $c$L$D$X$D$T$XD$T f|$TtD$T@@T%|$T|$\|$T|$PS|$@|$H|$D|$<|$8uZ|$4u1|$0uD$,`ËL$0 uD$0$D$0@@֋L$4 u‹D$4$D$4@@뭋L$8 uD$8$D$8@@넋L$< lD$<$D$<@@TL$D 8D$D$D$D@@ L$H D$H$D$H@@L$@ D$@$D$@@@L$P D$P$D$P@@L$T hD$T$D$T@@PL$\ 4D$\$D$\@@L$d $$L$D$L$D$*T$LD$H u|$HD$d@@T%2-L$<D$d@@T% -L$8HD$4|$4eL$4 $˾$L$ D$0|$0AD$THL$$A $ t$$D$P|$PD$PL$\H D$\19}T$Th ET$PhC9| $L$0L$L$PL$L$HL$ L$\$$T$9t}D$ tZ|$ t6$D$T$$D$ tD$ (É$B@ $C@$B@Ћ\$$1넉$B@Ћ\$$%(=+(=+ÃD$L$$ $0$L$L$L$5PT$ u1ËD$@@T%D$@D$ $耳ƒT$t0|$ ~L 8Z $k$L$L$T$}#uD$ u$B@$L$L$sT$D$ËD$@@T%tD$@D$ $b\^$=$D$1à \$1ҋCH~ CPыC@‰$ ÃT$$D$ D$L$ $T$$ L$6<\$ T$$tB@BB t W$x$D$aÉ$T$VÃu ËL$ $L$$ L$\$\$;\$T$$D$ t$|$} Ã'1É$C@ЋT$$ˋB t]$D$D$u ÉD$ $T T$ ÉD$ 6$B@Ћ\$"$T$UD$D$D$t+L$ $L$ L$:tD$D$u1ËL$ $L$L$Uu ËL$ $L$ L$D$ D$:T$ }  u$B@낃D$D$D$t+L$ $L$ L$9tD$D$u1ËL$ $L$L$3Uu ËL$ $L$ L$D$ D$9T$ }  u$B@낃\$T$BPu CPPB4u C4*BTKT9t0B0C0bTB0u B4B0u C0CJtBŋBT%@uCT%@BTKT!%tD8BT%jBuKJBTKT!ȃ@tBhuKhJhBTKT!%tu $ UL$tD$HT@ËL$ $H)L$ܺt D$HTՋL$ $1L$赺t D$HT뮋L$ $Ў6L$莺t D$HT뇋L$ $$1L$gtD$HT]L$ $E+L$=tD$HT3L$ $W.L$tD$HT L$ $$L$tD$HTL$ $\4L$迹D$HT (BT B\B`JT@B\uK\J\B`K`J`bTKT JTUKT JT3B4'C4bTKT JTbTKT JT D$$L$L$5t  1 Ã\$T$C0t B0 C4t B4C8t B8CPt BP=l$ CuBtBM9CuBtBM9C u CHC$u CLC,uB,taB,M,9SC@uB@t/B@M@9!CDuBDtBDMD9CTJT!ȃ C(u CdCTJT!%tNCluBltrBlMl9dCpuBpt@BpMp92CTJT!%ru(t9u(t9u(td9Pu(t 9 u(t9u(t9CT%@JT@9u=u tt9uËCT%@tዃu֋=:uɹ뼋k'[JpKpJlKlC<LJ(K(JdKdJ$\$(CT%t1$ÁKT u D8trCu Vu6&$]\$(ƒucT$Éu\$(tщ$U\$(|Ctt$KtL$\$(|Cxt$KxL$+\$(vC|t$K|L$\$(R$训\$(=t$D$2\$(D$D$@D$;l$}9l$T$H A@T%t$L$l$\$(E;l$|NjCT%@tCT%q $>$L$\$(uZCXKX $螅\$(_$F$D$L$ L$T$ \$( t8C0uJ0K0C4uJ4K4C8uJ8K8CPuJPKPD$D$@D$1;l$}Bl$T$P B@T%t$\$l$\$(E;l$|KTKT1$É$B@Ћ\$(2$N$D$-D$\$( t=:s^$$D$C D$x\$( $T$K^\$(JKT$$6T$\$(lD8D8A D$$D$u($eL$$D$u ËL$( $D$"l$Ƌ]K|7E H ~@=-uމ,$\$t$g ø-މ,$t$ t$iT$ D$ tD$ É$B@t$D$uË]K|0E H ~@9u,$\$[ø-ÃT$L$A=W.t@Y$V$D$Ao1ËA9u Ë^$$D$T$AD$ v1ÃD$D$ L$ $D$wu1ËL$ $D$ ЉƒD$uoT$u $.1ÃD$D$ L$ $D$u1ËL$ $D$ ЉƒD$unT$u $q1ÃD$D$ L$ $L$u1ËD$@ L$ $D$D$ ЃÃD$D$ L$ $L$kT$u1ËD$X B@Tu#\$K $JL$\$T$t$\$D$ Ѓ(=+(=+ÃD$D$ L$ $L$T$u1ËD$X B@Tu#\$K $JL${\$T$t$T$D$ Ѓ(=+(=+ÃD$$D$L$ $L$]u1ËD$ @ D$L$ $L$L$D$Ѓ}1Ã~(=+(=+ù $@VuJL$ t(L$ t1ËD$$D$@@D$$D$@@ËL$H L$HÃ$D$0D$ -D$L$, $$L$L$L$ L$L$L$L$hu1$ËL$( $L$L$L$L$D$ Ѓ$Ã$D$0D$ -D$L$, $$L$L$L$ L$L$L$L$Thu1$ËL$ $L$(L$L$L$D$ Ѓ$à D$D$L$ $D$u1 ËL$ $D$Ѓ à D$,D$L$( $$L$L$L$ L$L$gu1 ËL$ $ WL$蠛ƒD$ujT$uL$$ $T$D$Ѓ 1 ÃL$ $ WL$SÃD$uyj\$uB}D$@P4tu؃ËL$ $Ћ\$} ٸÃL$D$ D$AuGA L$ $D$YƒD$uiT$uL$ $T$D$Ѓ1É $D$1ÃD$(D$L$$ $$L$L$L$L$L$ ['u1ËL$ $L$L$L$L$D$ЃÃ,D$8D$(L$4 $$L$L$L$ L$L$L$L$eu1,ËL$0 $L$L$QƒD$$uhT$$u=L$0 $T$L$L$D$(Ѓu hu--,1,1,ÃD$(D$L$$ $L$u1ËD$$@ L$ $D$ƒD$uEhT$u=L$ $T$D$D$Ѓu hu--11Ã(D$4D$$L$0 $$L$L$ L$L$L$ L$L$%u1(ËL$, $L$ L$L$L$L$L$ D$$Ѓu gu--(1(à D$,D$L$( $$L$L$L$L$L$ %u1 ËL$$ $L$L$L$L$D$ D$Ѓu gu-- 1 ÃD$ D$L$ $L$u1ËD$@ L$ $D$D$ЉƒD$ ufT$ u $i1Ã(D$4D$$L$0 $$L$L$L$ L$L$L$L$bu1(ËL$, $L$L$L$L$D$$Ѓu fu--(1(ÃD$$D$L$ $L$u1ËD$ @ L$ $D$D$D$Ѓu eu--1à D$,D$L$( $L$\$$u1 ËD$(P B@(;D$t#T$J $KL$B\$$T$t1$T$D$ЉD$et1 ËL$ $' Ë^$$D$C@ D$C@ D$ B@ D$l1 ÃD$Ht AT%uCt AL;D$u Ë^$$D$D$ D$A D$ k1Ë룃(D$4D$$L$0 $ $L$L$L$ L$L$L$L$`u1(ËL$, $L$$L$ $L$/u1(ËL$, $L$L$L$L$D$$Ѓ}1(--(ÃD$$D$L$ $L$u1ËD$ @ D$ L$ $L$L$$L$u1ËL$ $L$ L$D$D$Ѓ}1--ÃD$D$ L$ $D$1u1ËL$ $D$ ЉƒD$ubT$u $1ÃD$L$ $L$L$L$ L$ЃÃD$ D$L$ $L$u1ËD$@ L$ $D$L$$L$D$ЃÃL$ $L$L$L$L$D$ ÃL$ $L$L$L$L$L$ ^ÃL$ $L$L$L$L$L$ 2ÃL$ $L$L$L$L$L$ ÃL$ $L$L$L$L$L$ ÃL$ $L$L$L$L$L$ ÃD$D$ L$ $D$Uu1ËL$ $D$ ЉD$|$u `tD$Ë,`$d`$D$0D$ D$L$, $#$L$L$L$ L$L$L$L$7]u1$ËD$=-uD$D$=-uD$|$u|$t!L$( $L$L$L$L$D$ Ѓ$Ë^$$$D$_1$Ã(D$4D$$L$0 $C$L$L$L$ L$ L$L$L$x\u1(ËL$, $L$ L$L$L$D$$Ѓ}1(--(ÃD$$D$L$ $L$u1ËD$ @ L$ $D$D$D$Ѓ}1--ÃD$L$ $L$L$L$ L$Ѓ}1--Ã,T$0L$4B@T%A@T%A{I A@T%u.^$$D$B D$A@ D$ e1,ÉL$$ $T$(T$Z|$45^l$(\$$u34$$D$E D$C D$ C D$E D$Ke1,ÉڃtBT%t9ul<$L$OL$]Qu1,ËL$$ $D$4D$L$8L$D$(ЋT$4D$ tD$,É$B@4$$D$E D$C D$ u$D$d1,ËB 싒&^$j$D$B D$Kd1,øD$$vGT$0L$4'L$ $W$L$t1ùdC< $L$L$D$膳u ËL$ $_$L$D$ D$T$ t t É$B@ t1É$B@L$ I $L$$L$TD$u ?a1ËL$I $L$$L$)u(aT$ t É$B@D$$L$L$L$膊\$T$D$ t0 t|$ } `1ËD$ É$C@ى$B@Ћ\$뿃L$ $g$L$_L$o$L$ 謊u ÉD$$T$ÉD$ t5}*ZuW$r$D$uZÉ؃É$B@Ћ\$뺃 ^D$D$u $ $ƒ^u1 ËL$$I $T$襬l$$ƒD$D@L$( $T$ÃD$ $~C\$ƒtmZ L$ $T$T$D$Ϥ\$T$D$u#uD$ u$C@ uԉ$B@Ћ\$ÃuJu/|$u1 ËL$ uD$$D$@@ uȉ$C@ u$B@Ћ\$뜉$l$ML$ЃD$1 Ë`$^D$EX\$T$O=Ptf W $$L$L$e}1ËL$ $$L$XL$$L$ L$ L$L$$L$1붃l$(\$ T$$uS$$L$\L$$L$ T$軇ƒu  t1É$B@$$L$UL$$L$ T$l$d맃 P W|$0$$L$L$H} ËL$$ $:$L$WL$G$L$ L$(L$L$,L$ކƒu t1 É$B@1닃tn$L$L$L$贔} ËL$$ $$L$ZL$$L$ L$(L$L$,L$L$0L$B_1먃D$ L$ $$L$t^L$D$ $L$$L$rC\$uWD$ t9|$tL$ $T$D$ tD$ É$B@$C@뺉$D$D$D$ؠ\$T$D$ u$B@Ћ\$pUuL$ $L$$L$L$賛D$ mL$ $$L$ ]L$$L$ L$L$Ãl$(\$ T$$uS$$L$\L$$L$ T$誄ƒu  t1É$B@$$L$UL$$L$ T$l$S맃l$ \$$MS9tKI01D$E@0tE@0=tA|$t+$$L$VL$$L$ l$ӄ(=+(=+Ã|$tK $ML$1l$ \$$um,$$L$4]L$$L$ \$sl$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$$L$gl$ \$$m$$L$VL$$L$ l$l$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0 ial$ \$$MS9tKI01D$E@0tE@0@=jtA|$t+$%$L$VL$.$L$ l$ (=+(=+Ã|$tK $ML$kl$ \$$um,$$L$0]L$!$L$ \$譂l$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$$L$l$ \$$m$ $L$VL$$L$ l$l$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0Ijg_l$ \$$MS9tKI01D$E@0tE@0@=1tA|$t+$T$L$VL$]$L$ l$F(=+(=+Ã|$tK $ML$~l$ \$$um,$H$L$(]L$P$L$ \$l$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$2$L$l$ \$$m$;$L$VL$D$L$ l$Sl$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0I1g_l$ \$$MS9tKI01D$E@0tE@0@ =tA|$t+$$L$VL$$L$ l$(=+(=+Ã|$tK $ML$|l$ \$$um,$w$L$L]L$$L$ \$l$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$a$L$l$ \$$m$j$L$VL$s$L$ l$~l$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0I g_l$ \$$MS9tKI01D$E@0tE@0@=tA|$t+$$L$VL$$L$ l$}(=+(=+Ã|$tK $ML${l$ \$$um,$$L$@]L$$L$ \$X}l$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$$L$Ll$ \$$m$$L$VL$$L$ l$|l$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0Ig_l$ \$$MS9tKI01D$E@0tE@0@=tA|$t+$$L$VL$$L$ l${(=+(=+Ã|$tK $ML$Oyl$ \$$um,$$L$|]L$$L$ \${l$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$$L$l$ \$$m$$L$VL$$L$ l$zl$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0Ig_l$ \$$MS9tKI01D$E@0tE@0@=tA|$t+$$L$VL$%$L$ l$*z(=+(=+Ã|$tK $ML$wl$ \$$um,$$L$l]L$$L$ \$yl$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$$L$l$ \$$m$$L$VL$ $L$ l$7yl$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0Ig_l$$\$ T$-u$\$ËB@0tB@0@=t(=+(=+É$)$L$TL$1$L$ \$l$dwÃL$ $6$L$x]L$>$L$ 6wÃL$ $A$L$]L$I$L$ wÃL$ $L$L$]L$T$L$ vÃ$D$D$L$( $W$L$l^L$uD$ u\Ft $ËL$( $c$L$_L${uD$ uFt $øD$$0L$ $D$D$D$s\$‰D$ tbB=1B=-^$k$D$|$td$D$B@ D$ [MT$D$ t*L$ tD$$ËD$ $D$ @@$B@ɸ$뚉$uT$D$막$C@ЋT$5L$ $$L$`L$$L$ uÃL$ $$L$]L$$L$ tÃl$ \$$MS9tKI01D$E@0tE@0@0=#tA|$t+$$L$VL$$L$ l$Tu(=+(=+Ã|$tK $ML$rl$ \$$um,$$L$]L$$L$ \$tl$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$$L$l$ \$$m$$L$VL$$L$ l$atl$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0I0#g_l$ \$$MS9tKI01D$E@0tE@0@4=tA|$t+$*$L$VL$6$L$ l$s(=+(=+Ã|$tK $ML$pl$ \$$um,$$L$ ]L$&$L$ \$-sl$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$$L$!l$ \$$m$ $L$VL$$L$ l$rl$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0I4g_l$ \$$MS9tKI01D$E@0tE@0@8=tA|$t+$\$L$VL$e$L$ l$q(=+(=+Ã|$tK $ML$$ol$ \$$um,$P$L$,]L$X$L$ \$fql$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$:$L$Zl$ \$$m$C$L$VL$L$L$ l$pl$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0I8g_l$ \$$MS9tKI01D$E@0tE@0@<=xtA|$t+$$L$VL$$L$ l$o(=+(=+Ã|$tK $ML$]ml$ \$$um,$$L$$]L$$L$ \$ol$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$i$L$l$ \$$m$r$L$VL${$L$ l$ ol$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0I$L$P]L$H$L$ ,iÃL$ $K$L$X]L$S$L$ hÃL$ $V$L$`]L$^$L$ hÃL$ $a$L$h]L$j$L$ L$L$hÃL$ $n$L$t]L$w$L$ L$L$dhÃL$ ${$L$]L$$L$ L$L$.hÃL$ $$L$]L$$L$ L$L$gÃL$ $$L$]L$$L$ L$L$gÃL$ $$L$T]L$$L$ L$L$gÃL$ $$L$\]L$$L$ L$L$VgÃL$ $$L$d]L$$L$ L$L$ gÃL$ $$L$p]L$$L$ L$L$fÃL$ $$L$]L$$L$ L$L$fÃL$ $$L$]L$$L$ L$L$~fÃl$ \$$MS9tKI01D$E@0tE@0=ztA|$t+$&$L$VL$4$L$ l$f(=+(=+Ã|$tK $ML$Xdl$ \$$um,$$L$]L$"$L$ \$fl$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$$L$l$ \$$m$$L$VL$$L$ l$fl$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0zaYl$ \$$MS9tKI01D$E@0tE@0=GtA|$t+$f$L$VL$s$L$ l$-e(=+(=+Ã|$tK $ML$bl$ \$$um,$V$L$]L$b$L$ \$dl$ \$$=(=+u/CM9t% J$B@Ћl$ \$$2ЃÉ,$\$8$L$l$ \$$m$E$L$VL$R$L$ l$:dl$ \$$=(=+tЃt D$$B@Ћl$ \$$ދKI0GaYL$ $w$L$]L$$L$ L$L$bÃL$ $$L$]L$$L$ L$L$xbÃL$ $$L$@_L$aD$u7ù $L$$L$l$1҉T$ME(=+ttu É$tT$ÉD$ t:u.2\$ u} Ã~1É$B@Ћ\$ 7$B@',$E@ЋT$S,$D$D$D$|l$\$‰D$ $C@Ћl$T$ \$T$C@(=u$T$u\$T$ ËB@(=u-$\$K\$T$} Ã؃ 9s 9v1L$ $$L$0ZL$_tBD$$D$D$gT$D$ tD$ É$B@5T$$ $JI L$T$zKÃL$ $$L$XL$X_tBD$$D$D$םT$D$ tD$ É$B@15L$ $ÃL$ $$L$UL$^ƒt -4L$ $$L$x[L$^ƒu%4L$ $$L$L_L$r^ƒt& tL$ $`É$B@e4L$ $t`ƒT$u/T$tЃú B$B@2T$$D$D$u\$‰D$ thu ËB@T%t6$ 6Ћ\$ ‰D$ P$C@ЋT$<$p\$ ‰D$ˉ$C@ЋT$ 뇃L$ $$L$ZL$(]u1ÉD$$L$L$L$ L$xT$D$ tD$ É$B@L$ $$L$WL$$L$ L$L$"]Ãl$\$ D$Ct!$l$ML$Ѓu1ÉD$É$L$$L$D$V}T$D$uD$ u$B@`D$ @D$u $ $[ƒ`u1Ã=Wu$$ $2`Wu1ËL$ $T$~T$u JHL$ $L$$L$ÉD$$ WL$~l$ \$$ƒt@=v1B=u{,$\$fD$ |$ u ` $-u*L$ tD$ ËD$$D$@@1L$ $L$L$L$$L$(D$ ,$T$T$\$ T$D$ j$B@Zl$(\$ T$$uS$$L$p^L$$$L$ T$Zƒu  t1É$B@$($L$PXL$4$L$ T$l$sZ맃\$$L$ $ )L$ <L$YD$u/(=+(=+ù $L$ L$\$u&D$ tD$ É$C@$D$D$D$1u\$T$D$ u$B@Ћ\$뤃D$@@d=Mu4L$ $L$L$L$L$=(=+tЃthD$@@d=Mu;L$ $L$L$T$ .L$=(=+tЃt(=+(=+É$B@$B@닃L$ $c$L$QL$PXD$tu$\$D$t-$D$ D$D$s\$T$ D$ t tD$É$C@$B@Ћ\$-L$ $l$L$^L$Wƒu+^$x$D$D$@@ D$/1tL$ $cÉ$B@L$ $$L$\L$$L$ WÃXD$ @D$u $ $dƒXu1ËL$ $T$zL$t$ l$$\$(ƒu=Ru ǁÃu-u-$t$l$\$ D$wÃl$(\$ T$$uS$$L$4YL$$L$ T$Vƒu  t1É$B@$$L$xUL$$L$ T$l$]V맃L$ $$L$h^L$Uu ÉD$$L$L$L$ L$rq\$‰D$ tvu Á-tD^$$D$B@ D$y-T$ t É$B@ t1É$B@$C@ЋT$ v [u $ $>ƒ[u1 ËL$$ $T$7YD$u1 ËD$(HL$ A $T$$|$ ƃu1 P 19}T$(h EhC9|L$ $t$t$L$,L$ p\$T$D$ t tD$ É$C@$B@Ћ\$у$D$(D$$D$D$D$D$)L$( $$L$0YL$ASt\$ T$ttt1ÉˉL$ u؃Ã(D$D$D$D$0@L$, $D$D$L$l$,T$0D$ uB9tЃ(É,$T$0JL$tt$ l$,T$0Ãu@p9u D$B;D$t|$t|$t L$Ѓ(ËL$@=v1u\$$C@J9tdC=})u C@=}t3-u <9tD$BD${D$m9u‹D$S,$JL$t$ l$,T$0tn9tj\$$C@ J 9,$\$ KL$OL$ t$ l$,T$0|$tA9D$t D$AD$BD$덃 L$t$D$$L$D$L$u1 Ã=_tú#t8T$ $DT$BBu;$$3 T$u_ÃDD$H$4l$LD$ú#tB9u؃uD$Ët J#vB9t>u|$u1DËL$H $l$6L$L$L$ wDÃ뮃 #tL$ $T$‹u à #t%D$$L$AD$L$uۃ ÃL$ $L$ L$D$Ѓ} ËL$ $L$L$L$L$L$ L$ Ã(D$,D$|$u1(ËD$@D$1;l$}1D$@ l$H @=-u E;l$|1(ÉD$$tB@T% u2$L$0L$L$4L$L$8L$ l$}(É$L$0L$l$\$$t냸-pD$ D$>#tC u9uD$ tL$ $} 1ËL$ $\$KL$\$tD$ tL$ $KL$;T$ \$x=u2L$ $KL$-L$\$FËL$ $\$ L$u ËL$ $L$IL$D$D$艞\$T$}  $B@Ћ\$ T$\$CC KHB upBuABuD$$D$@Ѓ ËJ uڋB$B@@NjJ uB$T$B@@ЋT$똋J uB $T$B @@ЋT$f\$Ct4$ $StKI L$KI L$6ù'$,$ $StKI L$6ùH$4t$8t$0Fu)L$T$$$T$0R \$0[9u81ɉL$L$L$ՋT$$D$ t T$ Ѓ4É$B@L$0I E;l$ DL$8 $L$MEt&L$( $bT$$ u 1,$E@͋Et!BB JHt$(;t$}$@ @ F;t$|܉l$,$L$(L$萴t$(l$ÃuD$$D$$δ 9~)\$ $D$)D$] \$D$$ڃT$ Bt-$UT$ B 8_ 8_IJB8_P1 É I  @ $t$l$@ @@Ћt$l$D$}SQ<8R<D$Q<\$ 8R<tB D$$衳\$ T$uC|D$Ã=Q<uQ<uË Q< uދQ<$Q<@@Ń\$ ڃBB JHC u $ËK uC $C @@Ћ\$ у T$B tJ $L$L$D$Ѓt 1 à l$] u1 ËEK9}M@ E t E 1 É$C@Ћl$\$ 1ҋC t C PK)ʉ$XAÃD$@@T%u-$D$^1ùd+ $T$-8_Ãu1@P ‰D$ T$Bt-$-8_\$ T$B*MJBU؃ÃL$ $'D$ u1ËL$ $Y8L$ݩD$L$ $@T$ BЃÃL$I $m2L$蟩D$L$ $@t$D$ 1;l$ }@ uE;l$ |4$Í I uލ@ $l$@ @@Ћt$l$빋D$@Ãl$ \$|E9}@ @ Ë^$1D$Y1ÃL$\$T$}1ۋA9~Q9}ډщT$)ى\$ $|$ƃu1É;\$}T$h E)h C;\$|Ã8T$@B@0tB@T%B=d-$L$t- ="tEl$0\K8El$0"El$0' 0t1uCЉ9s0}El$07Cƒ9s0|7ƉCƒ봃3t4t5t6O녃netT\t@at,btf.El$0 WEl$0HEl$09El$0\*El$0 r,tvx؉\$<@9|$(s"  /%|$DL$D $8L$U L$D $8L$U |$(l$0\$<u:El$0?9e  /%CC=L$D $8L$8U |$(l$0\$<tW$8D$D$DD$YW$8D$S=K /%%C /tkуЉ%C /tЃƉEl$0ވM /t Ѓ҉Ѓ /tу뀉уvEl$0 El$0 El$0 L$ $L$L$L$ L$t ËD$ ÃL$ $L$L$L$ L$it1ËD$ÃT$B@T%u $zËBÃT$B@T%u $ÉЃà \$T$u8$$D$ ËB@T%u4B@T%tz$D$֮\$ƒu ÉщT$ |$tD$J1 Ë $s L$I9t^$B8D$ Ë^$8D$B@ D$9 ÃD$$|$ t$(D$+D$,$<$||$4u|$0u Ã|$,|$, Ã|$4u119}#8;uD$D$;D$0uD$0C9|݋D$Ã|$4u"19}8;u؃C9|ÉK~8;u؃KD$,HD$D$HD$D$|$441;l$}5 3 D$2T$:2u D$)HD$E;l$|ˋ\$ 3 D$1;,$hT$,:@T$, I81;\$} ;:3tx;\$uE|$4tD$D$;D$0uD$0l$E;,$~|$4t ËD$Ë\$, ; L$!ul$,l$Co\$, ; L$!ul$, D$l$~+ 3 D$82uHD$MՋ,$=8:uR\$~ ;:3t9uÃ~ /IL$!t+l$M+l$,K벃~ /IL$!u+l$,̓l$,\$0T$$}1Ãu9}@ÉL$ $T$L$(L$l$ \$D$}1ÃÃ\$$T$,} ÃuD$0ËL$ $\$L$(L$T$ L$L$H|D$0ȃÃ\$,T$$} Ãu D$0ËL$ $T$L$(L$\$ L$L$|D$0ȃÃL$t$,l$(9~A΃} ̓}1T$  $)L$L$ L$L$$L$ l$Ã}΃}1뱃L$t$,l$(9~A΃} ̓}1T$  $)L$L$ L$L$$L$ l$Ã}΃}1뱃\$T$ك $KL$уL$JL$ D$1t 1`D$XD$T-D$P-D$LD$OD$|D$OD$OD$:D$L$ $m D$D$dD$1)ЉD$C D$KL$h $L$L$L$\L$L$PL$ L$LL$u1`ËD$P=-tL$P $L$XL$+Tu1`ËD$L=-tL$L $L$TL$Tu1`ËD$pL$XD$tL$TD$lL$\`à |$8uW$e8D$ 1 ù $ļD$u1 ËL$( $L$,L$L$4L$L$8L$ L$L$t$$\$V}s SS؃ ËL$( $D$D$6\$T$0l$C SD$8ŋT$(  $L$,)L$L$A}T$t t1 É$B@Ѓ à |$8uW$u8D$1 ù $裻D$u1 ËL$( $L$,L$L$4L$L$8L$ L$L$t$$\$V}S Ss؃ ËL$( $D$D$\$T$0l$C SD$8ŋT$(  $L$,)L$L$A\T$t t1 É$B@Ѓ ÃT$,D$  $H\$$t$(D$ |$ u11D$,L$,~/9}#% ;"999}#% ;9taډ  $)L$Ãu(L$ t1ËD$ $D$ @@|$ }'D$ @ L$D$D$ L$HD$ ËL$ $D$D$T$t u$B@t u$B@EE9}#% ;u9  $l$)L$\$$t$(l$ǃ|$ }D$ @ L$8D$FL$ $D$D$T$\$$t$(l$t $B@ u$B@Ћ\$$t$(l$돋D$ @=$18D$ D$ @ L$ D$EEAyT$0D$  $|$(D$ |$ u119}D$0L$0|$uD$ @=$19aT$$  $)L$~Ãu(L$ t1ËD$ $D$ @@|$ }'D$ @ L$D$D$ L$HD$ ËL$ $D$D$bT$t u$B@t u$B@띋D$ D$ @ L$ D$9L$$ :D$,T$$  $l$)L$|$(Ã|$ } D$ @ L$D$l$EL$ $D$D$|$(T$t $B@ u$B@Ћ|$(E5A0L$DT$HD$ uW$8D$10Ãu/L$4 $L$8L$L$t't (=+Pt (4?" 1} 1t 1tu| 1~ 19~ P1I10(4"tKܹ(=+\$D$KP9u KP8t1Éڃ$ƒT$ST$K uظӃ t$F tF Ënu F 1 É<1M|iCBC 1M}F1‹<1ƒuV Ѓ Ã\$$T$(t1 Ã0L$4AD$,D$$ȃD$ -D$L$8 $8L$L$L$L$$L$ hT$4u10Ã|$$}D$$D$=-u$$L$ L$L$,L$L$$L$ 0ËD$@@T%tJD$D$D$@D$($L$ L$L$,L$L$L$ L$(L$L$$L$M0ËD$@@T%t$L$L$L$$L$H=0ËL$ $L$L$L$(L$T$4s10Ã,Éу $JL$L$$L$L$ L$ L$L$L$L$j,ËD$(@@T%t,$L$(L$L$L$L$L$ L$8L$,ËL$( $L$$L$L$ L$#T$0 ,ÃL$ $L$L$L$wu1É$ÃL$ $L$L$L$@u1ÃuW$%8D$u1É$}ÃL$ $L$L$L$u1É$FÃL$ $L$L$L$u1ÃuW$98D$1É$Ã$L$0D$(D$ D$(@D$ȃD$AD$1|$,t@;t$}:L$ $T$ t$ ɉL$L$L$0> t$l$|$,tFM9t$|t$(L$ T$4l$0$Ã(D$$D$ 8 $L$0L$L$L$L$$L$ L$ L$pu1(ËD$@@T%1ۋD$@9}hL$, $ډ\$\$ I L$L$$L$L$ L$ L$\$u1(Ãt(4(4(CD$@9|""(ËL$, $L$L$L$$L$L$ L$ L$u> ^ $t%^$8D$D$@@ D$J1(É$(Ã(D$$D$  8 $L$0L$L$L$L$$L$ L$ L$ u1(ËD$@@T%1ۋD$@9}hL$, $ډ\$\$ I L$L$$L$L$ L$ L$\$u1(Ãt(4(4(CD$@9|""(ËL$, $L$L$L$$L$L$ L$ L$+u> ^ $菅t%^$8D$D$@@ D$1(É$趆(Ã$D$ D$L$, $L$0L$\8L$#L$ L$ L$L$L$uu1$ËL$( $L$ L$L$L$Gu1$Ë@@T%uA@T%tȃ$Ë^$g8D$L$A@ D$ T$ t1$É$B@$D$ D$L$, $L$0L$8L$#L$ L$ L$L$L$tu1$ËL$( $L$ L$L$L$˝u1$Ë@@T%uA@T%tȃ$Ë^$8D$L$A@ D$%T$ t1$É$B@0D$ L$8 $8L$L$ L$?l$4u1011ۋM ǃ9|$,sTE 5|$ ~7ؙ|$ L$ )Ѹ)9~W$ 8D$ր10E9|$,r)9$ىL$fD$|$u101\$L$IT$ Njl$4;l$,siE uh|$ ~R|$ L$ )ΉIt;9r)L$ CD$$D$@@+C IuE;l$,rD$09sCMFE t E u1́CE t E )91l$T$\$}1}1҃u $l$щT$SщL$T$Ãt&؉\$ $D$ D$T$ T$\$ \$ $D$D$D$@D$# l$\$ t*L$I D$$D$ D$l$r \$ ؃ËC=$12؃ÃD$ L$ $!8L$L$L$L$L$ Ã\$ u$D$Ë $K)щL$ÃT$ W|$ u%t $[8D$v1Ãu $8D$uÃ$L$L$茇T$ BBu1ËJ B@ ȉBB dÃT$J)ˋB ى\$ D$у $D$D$l$}1Ëu\$ 3M\$ 3ME = }e à \$T$B )9~$\$h\$T$t)$D$D$\$  D$L$ 1 Ã|$1O9r ËG9sr 0| 9~hŃ} ù)gfff9~ W$8D${ÍCG9r땃L$ $[u1ËL$ $D$D$ԧT$D$ tD$ É$B@L$ $L$L$eÃL$ $Ju1ËL$ $D$D$zT$D$ tD$ É$B@L$ $u1ËL$ $D$D$zT$D$ tD$ É$B@ D$$D$D$D$D$ T$ J Ã\$ T$J BJ9sBB.t[uJJKÃl$T$1ۋJMBJ9sBB]uuW$8D$Ar1ËJIMÃl$\$T$ BJ9r ËBB.[tW$78D$q1E$\$2u1ËL$ $T$u qu7D$L$I9uW$p8D$lq1ø1E$\$ru1ËD$뙃 l$$T$(*9ˉL$sC.t[uKD$,$l$؉\$)D$ L$D$4$L$D$)ȉD$L$, $t$0l$8upt$0l$8D$,L$,I9Ãuyur1ƒtIEuuEt*M $\$\$t$0l$8\$t1 ÃtME Ét 뫹1r1 ÃH\$LD$D $K)щL$L$,L$L$(L$ L$L$L$XL$s\$Du!u1H u$C@|$(L$, $l$T\$Dƒt1,$T$T$T$D$D D$DL$ $L$D$bÉ$B@ԃ|BuT$ $كL$Qul$T$uD$ $Ns`Ëk+@C 1à l$L$\$U9}E}؃ É$T$F Ë^$8D$Z1 Ã,D$0$T$8\$\9\$uZT$8}D$$L$$t$ t 1Ë$$$@@܋$$$@@DŽ$DŽ$$1ۉ$DŽ$DŽ$l$,$D$(E$E('$u^$<8D$PE$~$$艬$)H$TK$D$-bƒD$$t$ DŽ$$ $T$W$T$$$$ $,DŽ$DŽ$DŽ$$$|.E$+ #*$$ $$L$$L$[ƒ@@T%u^$l8D$O^$$@$$$$$u#'O$$$$}$$؉$$$| E$.1$$$| E$*$$ $$L$$L$#ƒR@@T%u^$8D$M&$$衑$$ǃ$u#M$$$} 1$$$| E$$|.ht l $$| E$$}W$8D$ ML%$tH$ $$L$$L$$$$$1$DŽ$ fd tyXe%uEt\FtWGtR$  $q$$)HD$W$8D$T$T$ D$D$S`$ $$L$|$\$ U$$$"$$$h$t DŽ$0t>$-m$+Z$'+$9艬$}$$$);$7$)$$$d$$$}l$ tA$u PË$ u䋄$$$@@ɋ$$$@@뤍$ $$L$$$$t>$u 1Ë$ u狄$$$@@̋$$ +$$t7$ t$$ވ$$9~$$t~xtXut$ tB$$$$ $$$$ $$$} DŽ$$9~$$ utt$$ވދ$tLxtXuB$$$$ $$$$ $$$D$$l$ $$$$$)$K9|$$$ K9}ー$t$;$|- $B@Ћ$$%tɋ^$88D$G$ $B@$$$$$$9G1 $t 1$$6M8$Niu DŽ$dDŽ$$ $b$$$$$@@T%Z$@@T%?$ $y$$$ƒu+K$ $|$$$ƒB@T%DŽ$D$0$$ $xL$$L$$L$ \$T$$T$T$$$ʼn$ tl$u1^$8D$\$$@@ D$ L$DŽ$0$B@Ћ$$vB@T%DŽ$T$$$$L$$L$\$ $L$L$ L$T$$$$ tl$ $$B@Ћ$ $B@Ћ$$$$ ctd'e$@@T%qD$,$D$($$t$ DŽ$$@@T%t$$$$DŽ$$+$썌$ $D$$ $sA)؃$D$D$D$ D$ $$L$$ É$ $ $\$_$$$ tO t9$ t$Ë$$$@@׉$B@뺋$$$@@Ћ$돉$B@Ћ$>$@+$$$+$$ƃK|$ h Eh K}ቴ$($$$@@D$0$$ $xL$$L$k$$Ń|rt gi$oru+$ $_$$$$$$@@T%u;^$8D$@$ $B@$$$h9stuEx7$@@T%tD$,$D$($$ $_$$$$$$@@T%$ tD$,$D$($$$$@@ʃL& /߃Љ$$$E$ /y/)ٸgfff9~W$8D$>؃Љlj$l /؃Љ$$$E$ //)ٸgfff9$~W$x8D$=&$؃Љ$b$$$-t0 $$$B@Ћ$$$[$$$@@ЋT$W$V8D$=WE)uIEJE(uA$@@T%$@=P-$I $P-L$k$b$$ODŽ$DŽ$ TD$T$B@T%B=$1tËBtÃu$T$ÃTu AÉ$T$ٻl$\$ƒt0D$ tË$@@Ћ\$T$ T $l$l$aL$} AÃ)Aø8$H&TT$%D$$L$@t @ÃL$ $TND$|$u1ÍD$$D$à 1ہ}2<<t<\$< t,Ã,Ã" $LÃd- $Tt$l$ \$ƒu1Ãu-u-Eu-rjZ ЃÃL$ $zD$u1ËL$ $vzT$u t1É$B@$D$D$D$<\$T$D$ t tD$ É$C@$B@Ћ\$у|$t$l$\$ T$B=-@B=-HB =-uH}=EE9~ Ë9| Ëu 1ÉċB @@T%uB@@T%t2J $I{|$t$l$\$ EEw]o1DB@@T%uB@@T%t3J $z|$t$l$\$ T$ËB@@T%uB@@T%t&J $z|$t$l$\$ T$zÃ|$t$ l$$\$(G=- D$H‹ D$ G=-G =-uvL$ M}E9|D$,1Ë~ M9}}E)@\$|$@L$,NjE)H\$|$@L$,뫋O $l$ݵT$t$ l$$\$(u ËE}UE} })EE97 } HE%1؋O $t$i|$T$t$ l$$\$(u Ë}} }&9 } H1ۋD$}1dO $\$|$t$ l$$\$(u ËW$ʳ"D$4Ã(1D$D$ D$$" $L$4L$/2u1(ËL$0 $"L$L$L$ L$$L$L$ L$L$L$0u1(Ã|$ uD$$D$ D$$L$$ $L$ L$L$L$e(ÃT$J tRJ t/J t $?KËB $B @@ЋT$݋B$B@@ЋT$뺋B$B@@ЋT$뗃" $ED$" $ED$ L$I $eQD$D$$D$D$D$$D$ D$L$I $*QD$D$$D$D$ID$$D$ D$L$I $PD$D$$D$D$" $,ED$D$$D$D$T$ tD$É$B@,L$4 $ WL$bƒD$(u1T$(udL$0 $T$L$$L$L$ L$ L$L$L$L$<}1,ù" $L$$L$L$ L$L$L$ *T,1,ÃT$" $JL$JL$J L$ JL$SÃ\$T$D$ 9u1ËK $JL$L$ L$5} Ã|$ tD$ ËL$I $L$I L$L$ L$5} Ã|$ tD$ ËL$I $L$IL$L$ L$l5} ËD$ Ã^$."D$0à  $L$L$Wu Ë W$L$L$|/T$ t É$B@,L$0|$4AD$IL$t$8#t$t$(T$ AA9A;T(L$ D$8D$$T$$@ƉD$(#L$T$ʉ‹@u|$ tT$ Ѓ,ËB9t;D$8u B;TuB;Tu|$ tl$$땉T$ T$RT$ $|$L$]|$4t$(\$ T$ʼnD$ tI}1,ËD$0@9D$uB9tL$0 $|$L$8L$,ÃT$\$u t É$B@C ;D$ ~:C@KɃ9|($S P~K ɉL$ËK 1É$Y\$ƒSÃ\$T$$JL$ L$CЋTu Ë@t5A9t.QYD$H t É$B@1Ã\$ C=$1uyS tqL$ $\$T$D$@ЋTu Ë@t5A9t.QYD$H t É$B@1É$X\$ ƒxÃ\L$`AD$Tȃ9D$T7D$PAD$L|$Pȃ$D$@D$ \$`C1ɉK كKCC\T$T|$L~"BtL$LJ t#|$Lރ|$Pt D$T$30 1\ËB$T$XB@@ЋT$Xƒ|$L~D$ $D$TD$@D$ D$ D$TD$`$D$@D$ \$`C1ɉK كKCC\(1 L$=TD$iq9ڋ@t ڋ@9uC9~D$A9~1 ËD$ډ Ӊ ÃL$AD$ $\$-YtET2| $uÃl$tETC`t$ l$\$S|$~&BtL$J |$ڋCك9tC$. l$\$=X`P}WC=@a#t C=1uCX`X`6=NMTEX?ET3t)$CЋl$뾋B$T$ B@@Ћl$\$T$ =$D$D)D$E)D$L$( $rtG}$6D$ D$,$H)D$D$(@@ D$* D$ $I1$D$ D$,$P)D$D$(@@ D$ D$ $ L$( $L$L$L$ L$tjD$ D$$D$,D$ D$ $D$D$L$ I $L$,L$D$V@tD$($Kr$5D$ U)$D$,D$ D$ $VD$($ r1$ÃD$L$ $qT$ t&}1ùX) $JI L$2=É$ guD$ $qD$ÉD$$f@T$ÉD$ tGtȹ`) $L$ II L$كL$L$4 $iT$(D$ |$ u t1,É$B@L$ $xjD$$$3BT$$uhL$ tBL$( t t1,É$B@D$($D$(@@ЋT$$ˋD$ $D$ @@ЋT$$륉D$T$L$0 $L$L$\$(T$$u`L$ t6 t t1,É$B@$C@ЋT$$ӋD$ $D$ @@Ћ\$(T$$뭃$L$L$T$$uhL$ tBL$( t t1,É$B@D$($D$(@@ЋT$$ˋD$ $D$ @@ЋT$$ N$B@>L$ t0T$(t t1,É$B@Ѓ,ËD$ $D$ @@뻃\$D$ @u $1D$ @9}bl$T$ @ \$$D$l$T$ÃD$u t1É$B@ tED$ @9|؃É$B@Ћl$\$ك L$ $L$L$u1 ËD$$L$L$lT$ t-- É$B@ L$ $L$L$u1 ËD$$L$L$ T$ t-- É$B@D$ @=@a#tD$ @=1u}D$@=@a#tD$@=1uL$ $L$L$ËL$I $@a#L$:uˋL$I $1L$:u(=+(=+ËL$ I $@a#L$:bL$ I $1L$a:t@ T$B=@a#t B=1uAL$ $T$4ƒu1 tD$D$ É$B@J $@a#L$9T$uJ $1L$9T$u(=+(=+ Ã(\$0T$,9u&B u(4(4(""(ËC=@a#wC=1i$VdD$ |$ u1(ËL$ $ eD$$$<T$$u> t(L$ t1(ËD$ $D$ @@$B@ˉD$T$L$, $L$L$T$$ÉD$ tgu(L$ t1(ËD$ $D$ @@3L$ t""(ËD$ $D$ @@܉$B@Ћ\$눋L$ t t1((4(4(ËD$ $D$ @@D$C J 9~\$,Ӊ\$0$L$L$L$L$6t7L$, $L$L$\$0u1(Ãt""((4(4(Ã\$T$9u $yËB=@a#tB=1D$ $L$ L$L$L$\$t"$L$L$T$uƸËCK )ȍK9}1É$S P~K ɉL$^ËK J $@a#L$6T$TJ $1L$6T$3$naD$ |$ u ËL$ $bt{L$ $D$D$T$uEL$ t t É$B@D$ $D$ @@ЋT$ u$B@tL$ t\$ËD$ $D$ @@Ѓ\$1ҋC9}5T$ @ L$ $D$\$T$ u1BC9|--à T$(D$B=@a#tB=1L$$I $D$KD$u1 ËD$(@=\4L$$ $L$L$L$L$7t|D$D$ D$@D$L$( $L$IL$L$ L$輰uL$ $L$ L$uL$ t1 ËD$$D$@@D$ ËL$$ $L$L$L$L$t{L$( $L$L$T$u t1 É$B@u$L$L$HuL$ t1 ËD$$D$@@D$ ËJ $@a#L$3bL$(I $1L$c3AD$(@=\4/L$$ $:u1 ÉD$$L$(L$T$tЃ t1 É$B@L$\$Au $ËA $D$\$Ńu1úC9}QT$@ l$ ,$D$l$ \$T$uMEt1É,$E@BC9|ÃD$ @=@a#tD$ @=1u}D$@=@a#tD$@=1uL$ $L$L$ËL$I $@a#L$1uˋL$I $1L$1u(=+(=+ËL$ I $@a#L$1bL$ I $1L${1t@T$B=@a#t B=1u'L$ $T$L$ u1ȃËJ $@a#L$1T$uJ $1L$0T$u(=+(=+Ã8T$T$4u t18É$B@uL$< $L$(L$T$4u t18É$B@L$4 t--8ËD$4$D$4@@܋L$@I $@a#L$. L$@I $1L$}.L$@a# $T$u1ËL$ $D$D$T$D$ tD$ É$B@T$B=@a#t B=1u$L$L$ËJ $@a#L$*T$uϋJ $1L$*T$u@a# $T$u1ËL$ $D$ D$gT$ D$ tD$É$B@\$T$ B=@a#tB=1eD$$t{tft(=+(=+ËC J 9t""ËC\tB\u$T$yËC\J\9t""É$T$PËC J 9|""É$T$'É$T$L$ u1ÉD$$9D$ L$ $]T$D$ tD$É$B@t$T$ËC J 9""É$T$ËJ $@a#L$(\$T$ vJ $1L$(\$T$ Q|$$u""Ã|$$u(4(4Ë^$)D$1Ã^$ )D$ÃL$ $L$L$.u1--ÃL$ $L$L$KT$ÃB=@a#t"J $@a#L$'u Ë ^ $Jt1 $L$L$u ËL$ $D$ D$T$ ÉD$ t؃É$B@Ћ\$ L$ $L$L$u1 É$ ÃL$ $L$L$TƒD$@=@a#t#L$I $@a#L$&u1Ë ^ $Pt1 $L$L$u1ËL$ $D$ D$\$ ‰D$ t1u1ÃuD$$1--É$C@ЋT$뾃L$ $L$L$`T$B=@a#tJ $@a#L$%u1Ë ^ $bt1 $L$L$u1ËL$ $D$ D$T$ D$ t|$u1--É$B@׃ D$D$D$L$$ $;T$ÃD$ukuLu1|$uD$ ËL$ uD$$D$@@ uƉ$C@ u$B@Ћ\$뚹 $D$\$ƒD$qL$$ $-)L$(ƒu }- $L$$IL$L$L$T$T$ (\$T$D$T$ dBу9t BÃÉ$7ÃT$D$B=@a#tB=1B=@a#J $@a#L$#uyL$ $L$II L$D$L$ L$L$u ËD$$^T$B\|$u1É$L$L$ù6) $L$$L$iËJ $@a#L$"T$J $1L$"T$Ã@a# $L$ L$Ã1 $L$ L$ÃT$ B=@a#t B=1uB ËJ $@a#L$;"T$ u܋J $1L$"T$ u)$D$ÃT$ B=@a#tJ $@a#L$!T$ t $ø)$D$ÃT$ B=@a#t B=1u$L$L$ËJ $@a#L$Z!T$ uϋJ $1L$=!T$ u)$D$ÃT$ B=@a#tJ $@a#L$ T$ t$L$L$Dø)$ D$ÃT$ B=@a#tJ $@a#L$ T$ t$L$L$ËB=1tD$1ù܁) $L$Ãu1Ëyq ACCHK 1)K؃à `TA9w1=I$ v1ÉD$ @ Y $D$ u1ÉNj5T;t$ sH vv T$ J9v HF;t$ r TI =YD$ TL$A` $ T$u `J`1VB JB@t J)JJJ Ѓ1PT$5[v1ÉH=Hlj‰D$!C9tSkECtËCK9w!K C@CCËS[ Z SÃu>T$|$ƃ[uu$ É@1ɉHnMNNFuF[t@?!UU jj EE9u EMÉ}@  E)M >MEËn+ Y$I‰UEFNFYF[G@;$t$(u$É};=Ts Y+ =r 4$ $É  Y<t݋UuMMEt$Ë]U S ZMI Y ‹HMh@X@ 9u^BuKB[Bt BJH `J`T$$E D$ V$ËBJH볃u, [JB=[t [P[$ËBtjB@9v`BtMBJHBJHBt B@9wBPBtBP$ËJJJIJŋB[뱃$ME!Z U] j k$Ãt$ l$$u ,$+Áv1É%D$D$x;=Ts Y+ =r5t4$l$U É4$L$@ tËD$ ʍ Y<tD$@@9ʼnD$w9vÉl$,$]t,L$ $D$ D$D$D$ D$ $L$ȃËL$uT$u u$B@T$ubËL$JËT$uCËL$ JL$JÃL$ I $u ËL$ Hà T$BD$Jȃ$Xu ËL$HL$H ÃD$$ÃD$|$( ~ _$;D$`lt ËD$ $胪 \$$T$ul[D$D$ $;D$] D$$||$u3L$ $] t"Y$PD$ $ D$D$Ë=L$D$D$ $;D$D$L$ ܥ D$$zB@؃tm$ƒu.D$A 4$B@$T$$L$ L$L$L$(AL$ vT$D$몉$둉$L$ L$\$B@ЉD$L$ $L$L$L$L$D$ Ã|$uh"$;D$Τ øh"$;D$贤 D$D$$h"D$D$uD$$T$h"$;D$Ju;D$D$ T$M zB@ iT$t1Ãu ; $9ËB@,u; $JI L$T$HÉ$B@,Љƒu1Ë@@T%t6T$$D$D$T$ÉD$ tht]ڋB@T%uE^$";D$T$B@ D$T$ t1É$B@Ѓ1É$B@Ћ\$ 뇃T$uM; $"ËB=$1uЃËB=E+uЃËB@Du $Ë YA A ;U~T; $>T$$B@DЉ‹YH u1ËB@T%ttucJITuR1uE^$x;D$T$B@ D$T$ t1É$B@Ѓø11ÃL$ $ƒu1Ë@@T%t6T$$D$D$T$ÉD$ ttډЃ1É$B@Ћ\$ ܃T$ D$ u[; $fu1ÉD$$D$;L$OT$D$ tD$É$B@B=E+uЃËB=$q=Uu&; $T$ U=Uu1É$ UL$pD$ D$$D$-l$T$ ÉD$ME|$ u4B@T%tJ $JL$/ËB=$1udӃu1ËC@T%u2\$$D$;L$T$D$ t \$؃É$B@B@Dt$B@DЉ놉$Vw,$E@Ћ\$T$ $\$T$ $;L$UL$ tQD$ D$$D$,l$T$ ÉD$ME,$E@Ћ\$T$ +\$T$ 1à L$tu ÍD$$D$D$D$ D$ D_ $;L$L$q}~|$uU|$u,|$ tL$ uD$ $D$ @@|L$ uNjD$$D$@@벋L$ uD$$D$@@뉋D$$D$D$D$ D$| ȃË D_ $;L$L$} Ã|$} øt$\$FK9t#K $NL$t$\$NIT F@dt14$\$L$ L$Ћt$\$=(=+tЃtDKIT t2C@dt$t$T$ .L$Ѓø(=+1Љ$B@Ћt$\$1jKIT tcC@d5$t$T$ .L$Ћt$\$=(=+tЃ$B@Ћt$\$1럃\$T$KIT C@duJIT B@dt|$T$L$ L$Lƒu =(=+ut É$B@D$$T$D$ tD$ É$B@1o1Kl$T$MIT E@duJIT toB@dt[1ۃ}7,$T$\$ 3L$l$T$\$ ttC|ɸË 3øø11sD$@P(D$@=$uL$ $L$L$҃ËD$@=$uL$ $L$L$D$@@(ЃÃtD$@@(9<D$@@(=L$ $L$L$} Ã~ ËD$@P(tD$@@(9tML$ t+L$ t ËD$$D$@@D$$D$@@L$ $L$L$҉D$ L$ t2L$ tL$ $VËD$$D$@@ۋD$$D$@@빋L$ $L$L$跤ËL$ $L$L$҉$Ãl$$T$ BM9u9s 9v1-u Á-u É$5ty#;D$L$$ $tS$;L$ $T$M } Ã~ ËL$ IT$$R9s øD$$@P 릋D$ @@ D$뀃l$\$CM9u C@(uJ$l$n}ËL$ $L$L$}ËL$ $L$L$É$l$Ћl$\$‹C=$u tЃÉ$pà \$T$totj9u1 Ë YA A ;U~9; $\$T$u)$T$ YH } É ø%;$[D$ ÃL$ D$pt\tEt.tt (4ø"u 1 1} 1t 1tu| 1~ t1L$ $L$L$F\$ƒ|5=PtD$@L$I9u5L$ $L$L$\$ƒ1É$T$Ãtƃt W $A;L$L$V}1ÃL$ $L$L$L$L$=(=+tЃt L$ $L$L$L$L$É$B@Ӄ\$ YA A ;U~n; $a\$ CL$$I9u C=$u)$L$$L$L$(L$7‹YH ЃËKIT C@dt+$L$$L$L$(L$Ћ\$ =(=+ut@C@(t$L$$L$Љ$4u1뀋L$( $D$Mi$B@Ћ\$ 1x1Ãl$\$T$ 9uu Ãu1É,$\$T$ƒu Ë@=-u3(4u'D$ tD$ É$B@1ډT$$;T$D$ ȃ4D$8$D$3 qD$8$ \D$8$D$,D$s \$$\$$l1\$,rAd$,l1w/D$,|$ fD$l$\$l$ L$uȃ4D$8$Fu 4ÉD$$PT$D$ tD$4É$B@D$8$D$ D$y \$8h;L$8\$8D$8|$ fD$l$\$l$ T$T$D$l$8 h;\$8D$ D$8|$ fD$l$\$l$ T$уuȃ4D$8$D$ t\$8PXv ,4ø/14ÃT$  ȉuȃà ^$v;D$D$@@ D$ Ã\$ SB<t $B<ЃËu6T$$AY\$ T$} ËB<t $B<ЃËB(uJT t Bdt $MÉ$1߃\$T$B@ t$\$B@ ЃÉ$u1ËL$ $D$ D$T$ D$uD$ u$B@ L$ $L$L$nƒtt  É$B@<1 Ã\$T$B@$t$\$L$ L$B@$ЃÉ$9u ËL$ $D$D$L$ L$WT$D$ uD$  u$B@l$T$]\$B@T%u9B@T%$D$}l$\$ƒu1ËCHt,$T$CHЃËC t,$уL$C ЃË`$;D$C D$ЃD$ 1Ë^$;D$B@ D$1à L$ $L$L$ƒtt  É$B@1 ÃD$ @D$D$$@@T%D$$@@T%L$$ $D$D$D$$|$$u ÍD$$$l$ \$(T$BLtB,$L$$L$\$BLЉD$L$$ tD$ËD$$$D$$@@B$tE,$L$$L$\$B$ЉD$L$$ tD$ËD$$$D$$@@L$$ B uBHtG^$N;D$B D$u";D$ D$$D$ø;܋^$;D$B D$u@;D$ D$$D$뷸D;D$$$D$$@@Ћ\$(T$I^$;D$D$$@@ D${ËD$$Pl$UBT%u1Ëu1Ã}M}ًBJȃÍ+ËD$à ^$;D$D$@@ D$1 Ã0D$4PT$,D$$D$8@@T%D$8@@T%}L$8 $D$D$MT$,D$8|$8u10Ëu;$/ST$,}*L$8 tD$$0ËD$8$D$8@@$L$8L$t$4T$<Ã1|$ \$(tC@T%\u@D$,t1}%N}ًD$,@L$,Iȃʼn2t|T$<$L$8L$F|$ t$4T$<\$(D$$|$$tBD$$u $B@ uډ$C@ЋT$< tzt5$t$NL$׋T$(D$$ $B@t \$$`$;D$D$,@ D$D$8D$ P$B@Ћ|$ t$4\$(jC|$ C|$t$NL$׋T$(D$$ $B@^$;D$D$8@@ D$10ËD$8~ L$ $L$L$D$ Ã$|$,D$(PT$ D$G@T%G@T%<$D$D$9T$ ǃD$,u $Ëu3$PT$ |$,}tD$$É<$G@$|$ |$,l$0T$41t$D$tC@T%u9L$( $Z|$,t$l$0\$T$4tD$u <u{T$4$|$T$t#uD$  u$B@$XT$D$ ˃D$L$ $c;L$ ƒt$T$B@T% t3$3XT$D$uD$ u$B@L$ $ T$tƋ^$l;D$L$T$륃D$D$L$ $;L$^ƒG-ƒT$uP|$u#uD$ u$B@L$ uЋD$$D$@@ЋT$뷉$L$ L$;L$6T$|$L$ L$;L$T$hL$ $;L$D$u|T$$VT$D$,L$ $D$.T$̋@@T% u" t ,$B@T$$UT$D$ t T$ $B@T$B=$I$;L$T$ÃD$ u$ ` $# 莾\$ T$uiB=?1tSJ $?1L$7T$u6B@T%uB=4t$‰ЃÉ$$$D$\$ ‰D$ t]u1ËB@T%u^$;D$B@ D$¿T$ t1o$B@$C@ЋT$1É$;L$^L$D$ \$ T$1ÃT$ uAƒtT$$ T$uЃ t1$B@$뺃; $}Ã;$Ã; $UÃH) $B} 6;$ס. $jB} Q;$踡0/ $KB} o;$虡" $,B} ;$z- $ B} ;$[$1 $A} ;$} ;$5v6 $>} ;$}) $>} ;$p6 $>} ;$؝h) $k>} ;;$蹝4 $L>} Z;$蚝# $->} v;${B+ $>} ;$\F. $=} ;$=v1 $=} ;$$ $=} ;$# $=} ;$pp$ $s=} <;$+ $T=} d;$袜X!$ $5=} ;$胜ty3 $=} ;$d@- $<} ;$E! $<} ;$&ÃT$v1Ãt щ $" T$v1ËL$ $t щL$ɻ D$$D Ãһu1ÉD$$;L$6\t$ŃuX$u ËL$ $;L$D$D$H\t$l$} MEt0]K|E 9uÉ,$t$61É,$E@Ћt$l$뻃uÉ$;L$l[t$ ŃtD@@T%t4]K|'E 9u,$\$@D$D$ ÃËT$ YJYÃ\$YJXKZXà Yt+APAYV $ҋ Y VuՃ ÃYCXt*SXBhJKX\$ CT$Ջ\$ KTCXuփÃ?1 $`D$u1ËL$ $D$ !\$T$ CCt*t%K $q$L$T$_Z\$T$ t;u t1É$C@ uۉ$B@Ћ\$ʋK $q$L$-L$Y\$T$ uK $q$L$-L$Y\$T$ m t$^D$É$B@Ћ\$߃ T$B=?1tJ $?1L$T$tRu ‹L$AЃ øq$$2D$覴1 ÃT$B=?1tJ $?1L$T$tYBt$r$L$Xƒu@Y$ r$D$1Ë@@T%tӉ$z1ÃT$B=?1tJ $?1L$T$tYBt$r$L$Xƒu@Y$&r$D$\1Ë@@T%tӉ$1Ã$D$(@D$|$u$D$ L$ $L$ L$L$L$L$L$ 1tzD$=-t̋D$@@T%tL$ $_uA_t=S~>r$$L$1"D$$D$D$-D$3-]D$ L$ $L$ L$L$L$L$L$ V0D$=-tȋD$@@T%tL$ $U_uT$$Or$L$# T$t=S~\r$$T$m!D$$D$D$-D$o,D$Ã$-D$-D$L$, $L$0L$vr$L$7L$ L$L$L$L$zu $ËD$(PuDƒu $ËD$(PT$ $r$L$L$L$U} $ËL$ $r$L$L$L$U} $1$ÃD$$ZT$Bt$tT$J t$BЃËB$B@@ЋT$׃L$ $D$uݮr$D$L$ $wu辮r$ $L$L$ùr$ $L$L$D$dà T$BtJ $L$L$D$Ѓt 1 à l$\$\B \})J pSL$Juhj u\ZӉT$\$CtL=-$-\$T$C 8_ 8_IKC8_XЃ E듹}) $'Zl$\$ƒg1 ÃL$ A=})tf=-$,D$1ËA@ÃL$ A=})t=-$6D$߮1ËA ÃL$ A=})t=-$@D$諮ËA@à L$$\$(T$,L$Apt$i l$A@t/t2t >-$xD$71 É,$\$T$փ ÃtC$eCt$l$\$(t*^$&>-D$D$@D$*1 É,$\$փ Ãt$Ct$l$\$(uCu[ ,$\$փ Ãu1tq1t$Bt$l$\$(ZKu,$K L$փ Ë^$=-D$D$@D$L$ h1 Ãt$[Bt$l$\$(Ku,$D$փ Ë^$=-D$D$@D$L$ 1 ÃT$ ӃCC KHB uZBu/=pS} \J \pSÉ$WJ uŋB$B@@ЋT$ 뮋J uB $B @@ЋT$ 냃D$ @@ t $ȷ--ÃL$I $衷à T$B t!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 à Nt_$J>-D$1 ËD$H u-ȃ ÃT$B u>- $J L$ù>- $J L$J II L$J L$ ÃT$ \$B K 9tJ S 9s øB@KI9u1ËJ $K L$ } øÃT$ L$$l$(t B=})uxA=})unӉʋC I 9u\tC@JI9u<ut(4ȃø"t "㸠(411(=+(=+Ã=Pt: W $>-L$L$9}1(=+(=+1 T$B u:D$JI $T$u 1ƒuЃ ËJ $T$D$u Ã$1ۋT$(t t CuRu$D$u1$D$L$(tYL$ tDT$ $jD$ D$$D$D$D$ D$L$ T$D$uIu@T$t t1$É$B@$AD$$Ãl$\$_u C_tSl$Ut=  8u'A $T$ AL$ l$\$T$ t*uËmu`$\$91É$L$L$D$UÉ$=?-L$ uH=Pt; W $I?-L$L$}1ËL$ $1L$ $j?-L$= l$\$D$@@X$觲ÃD$D$ D$L$ $L$L$L$ L$à \pSD$t"A \ $R \ pSuދD$ à L$ $L$L$D$ ÃL$ At AËAu Ë^$h/1D$薞Ã\$T$ ߉ֹ BuBu(BuB uÉك,K C J ك(K$X\$T$ K빃\$T$D$ Ct#K $T$L$L$\$T$D$ t$؃ D$>D$ ÃD$ $KÃ(1 $Ou1@D$ $D$D$8_T$ T$Bt/1$(8_T$BKJBSD$ ÃDT$HB@PtB@T% u^$/1D$1DËB@P@tՉ$L$ L$L$Ū}1DÍL$ $\$HuD$ $-1DÉXDÃL$ $L$$L$01L$q4L$ L$L$xu1ËL$ $Ã$|$8l$4\$0u D$($D$,D$D$ÃÃT$tOB@T%t?֋j1Ƀ} ؕM| I ȉM}ÃtB@T%u998$D$É$;ÃD$Hu1ËH}l$1ۋM}eE؉ƃ~Sh@øI9t W$Q98D$Ctu؃ËE뛃H|$Xl$L\$PD$,u$rHÃ|$T8l$DHt= ljʉl$@݈ؖÇ19s8؇)̓|$Xt9vW$98D$%1HÉl$8$t$,D$0|$0u1HD$ D$$D$D$1|$DD$(D$(;D$8D$D$ |$XtGD$5L$ T$ ЋT$$щD$L$ D$L$ D$ L$$1!D$!L$ D$T$  D$ T$r1T$0T$?1ۉP FD$L$D$L$D$(D$@NjD$(;D$82tT$0L$H FD$0|$XtىHL$0 $MHÉ1bESA#11HD$D8\$@D$<@xD$<@؉D$0|$Lu W$98D$)~8D$ |$HD$1D$(D$,1|$ D$D$4D$4;D$0L$4T$<X |$ tہ?\$D$?1҉  D$( T$,D$0H9D$4[|$ I5?tEurZ;|$Dr W$98D$'}8GT$(1ۈD$ƃD$(L$,D$(L$,sD$4D$4;D$0v{;|$DsG|$ t }[ D$( T$,T$(1ۈD$ƃ|$ t%;|$DsʈGD$;|$Dr181ܺ1;|$Du|$Dv|$Lt+D$=r;D$ 1811{1L$Dڍ HD$D$<@D$0D$ T$} $É$'ÃT$ B@T%t&JL$u{L$uȃ1ËB@T%t$T$ | $밉$뤃$1D$D$,u D$(+D$(L$,D$L$D$D$D$D$D$D$D$T$ $T$ Ńt7 |$t[ىHD$D$D$D$D$uD$u$ÉT$?1ۉD$L$D$L$뼉BD$L$D$L$ED$(D$D$,D$ 1ҋD$D$ D$ D$D$ ulD$ucT$$Ńt L$MD$uD$ uÉT$?1ۉD$L$ D$L$ BD$ L$D$ L$nD$D$D$L$ $L$L$L$L$ (ÃD$D$D$L$ $L$L$L$D$ Ã,T$4D$ u+98$D$D$0@,ËB@T%B@T%t$L$0‰Q,ËBX0CH$CHЉƒuD$0@,Ë@@T%tHT$$茺T$D$$L$( tL$0D$$D$(A,É$B@ދB@T%tCD$$$T$T$T$ tL$0D$$D$(A,É$B@ t,^$:8D$PwD$0@,É$B@Nj^$:8D$wD$0@,É$L$$L$L$L$ L$ L$l}D$0@,ËL$0D$$D$(A,Ã$T$,D$tfB@T%tV$L$L$L$L$L$ D$}L$(‰Q$ËL$(D$D$ A$ø7:8$D$e}D$(@$ÃL$$A@T%΋iD$D$} ؕM|)@ 1ɋT$\$ ˉT$\$M}׉D$T$ ՃuL$ Q׉ՉO:8$D$|D$ @Ã4t$L$ $L$$L$L$L$L$L$ u(=+(=+ËD$@D$@L$ $L$L$ƒT$tBuRL$ t,L$ tЃËD$$D$@@ЋT$D$$D$@@ЋT$뻋JىJ뤋L$ $L$L$exD$@}L$ $L$L$>‰D$^L$ $L$L$‰D$?8\$L$T$$ $D$D$؃ D$CD$ |T$ tL$$ $@É$B@,$E@Ћ\$뎉$B@Ћl$\$kD$($D$(@@D$,$D$,@@L$, $L$(L$JD$L$ [D$ $D$ @@CD$0$D$0@@\D$4$D$4@@3$B@$B@$L$L$L$,L$L$(L$ F=CB,\$0T$4KC؉ËJB؉ى\$(D$$ $ȳu1,à $D$L$AD$eL$( $莳\$$D$|$uQL$ t/|$u1,ËL$ uD$$D$@@؋D$$D$@@D$ \$$;\$(D$(ËD$ $L$ T$4 D$؉\$D$$T$L$JL$0 $T$hl$ Ã2T$ $D$@)D$؃ D$\$CD$ \$$T$ tID$)ËD$D$ 9L$ tL$ $,ËD$$D$@@ۉ$B@Ћ\$$릉B(C L$ $L$$L$L$L$L$L$ u(=+(=+ËL$ $L$L$U‰D$D$@L$I1ȃ}uRL$ t,L$ tЃËD$$D$@@ЋT$D$$D$@@ЋT$뻋JىJ뤃 L$$ $L$(L$L$L$L$L$ T$(} ËD$@BL$ $T$D$L$ D$D$|$u+L$ t ËD$$D$@@ $.ƒD$L$ $T$kT$D$ L$ ttD$D$|$,tCD$,L$|$0tD$0L$1 ËL$ uD$$D$@@؋L$ uD$$D$@@륋D$$D$@@t$B@WL$ tJL$ t$u u$B@D$$D$@@ЋT$ËD$$D$@@ЋT$띋D$$D$@@KD$@B L$ $L$$L$L$L$L$L$ u(=+(=+ËL$ $L$L$L$L$D$ Q}D$L$ t*L$ tD$ËD$$D$@@D$$D$@@L$ $L$$L$L$L$L$L$ 'u(=+(=+Ã=\t% W $"<8L$L$u|}L$ $L$L$L$L$D$ k}D$L$ t*L$ tD$ËD$$D$@@D$$D$@@D$몃tL$x $L$|L$L$pL$L$lL$ 7u(=+(=+tËL$pID$p@؉ŋL$lIyD$l@؉ËD$p@WL$lI;1ȉD$<uaX$8<8D$6L$p t(L$l t1tËD$l$D$l@@D$p$D$p@@Ãu]L$p t;L$l t|$<t$tD$l$D$l@@ҋD$p$D$p@@밃~SL$pI@ƒ~$L$lIt 9l$d)=CDD~W$o<8D$b5=D$T ډ\$`\$l I $D$T$d\$p I $l$dT$T R+L$ɉD$@ى\$\ٸ¸)9|W$I<8D$4щT$A $dt$Ń1ۉ9}@ C9|l$h $L$p L$L$dL$D$D$\ؙD$ |$ D$T$ ËL$T$d T$hX D$h$耩T$hB|$`2у $у L$D$L$lI L$ 6D$ D$h$9l$h|$ tD$@ME؉D$P I $3l$h\$P ʍ IȃD$L+L$\9L$L+D$\ˉINjE D$@!tH!@Iщ!ʉU K@ D$D$}<\$,~1D$, ;K@ D$D$}<\$,ωMED$\D$L=|3D$\D$L=$D$LD$fG \$,D$,$D$\D$DG \$$L$p tAL$l t|$<td$$$tD$$D$l$D$l@@̋D$p$D$p@@몉,$E@3D$L|E'$L$lL$L$L$T$hD$ tRl$ l$hD$@tD$@L$ D$$D$@@Ћl$h$B@롸؉\$\‰)щT$ $ܦl$ SD$h $\$p L$L$d)L$D$D$\D$ |$ D$T$ l$@\$ D$|$tl$@~KT$p@ tڽӉnMT$p@ D$D$}<\$~3D$ ;MT$p@ D$D$}<\$KT$l@ D$D$}<\$~3D$ ;KT$l@ D$D$}<\$D$t$\$$`1111D$l@D$p@]L$ $L$$L$L$L$L$L$ @u(=+(=+ËL$ $L$L$D$L$L$ }D$L$ t*L$ tD$ËD$$D$@@D$$D$@@$L$( $L$,L$L$ L$L$L$ 舼u(=+(=+$ËL$ $L$L$L$L$L$L$ }JL$ t(L$ t1$ËD$$D$@@D$ $D$ @@ù $D$|$D$$D$D$D$sD$$D$D$D$VL$ t*L$ tD$$ËD$$D$@@D$ $D$ @@L$ t"L$ uD$$D$@@녋D$$D$@@ɁDŽ$DŽ$DŽ$D$D$D$ D$$D$(D$,D$0D$4D$8D$<D$@D$DD$HD$LD$PD$TD$XD$\D$`D$dD$hD$lD$pD$tD$xD$|DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$$ $$L$$L$$L$ 賹$u(=+(=+ļËB@T% $$@>$^$<8D$/+$t a1ۉ$$@~1 }|E |$ $ $uE$u ؁ļË$ u狄$$$@@Ћ$ŋ$ u$$$@@Ћ$뉋$$$@@Ћ$Z$$$@@Ћ$!L D$$D@@Ћ$$$C@$ t]$ t+$ $$L$T$pM-@ЁļË$$$@@Ћ$볋$$$@@Ћ$끃$U$@u#W$<8D$($$@}yDŽ$$ $$$$i$ $$DŽ$$$IىH$@u$@ $@}j$ $$L$D$$L$ $$  $$DŽ$ $PÃ$l$@$@H$$$$@ D$DŽ$ $$\$$$$@$$DŽ$$tX$$L$D$$L$ q$~$$DŽ$D$#$$$L$M$$$?$$DŽ$$tX$$L$D$$L$ $$$DŽ$Ѽ$$x$$2$xCl$$L$l$$$" t$$DŽ$$C@ 3$C@# $C@ 2$C@" $C@\$ $L $$L$`$$$$%|L$DDŽ$$tbL $$L$D$$L$ $$|$DDŽ$E ($@H$$$$@ D$DŽ$$$D$D$DŽ$$$\$$$$$$DŽ$$tX$$L$D$$L$ y$>$$DŽ$$$?|$$T$LL$H$$$$$DŽ$$tT$$L$D$$L$ $u;$$DŽ$$$A$ u$C@ D$C@4 $C@ 6$C@&L FD$D@@Ћ$$ L D$D@@Ћ$$}$$$@@$?É$z$$$@@B@T%t3J $$$$$-uDŽ$$ t=$ t(=+(=+ļË$$$@@Ӌ$$$@@먃 $@u1ËL$ $D$D$9\$‰D$ tu1ËJىJЃÉ$C@ЋT$ փT$ Bu B=Ў6t!$sƒt L$ IىJЃЃÃT$B} $É$ ËD$@t1HD$<L$L $L$PL$L$DL$L$@L$ 蝬u(=+(=+HËD$D@L$D $uLL$D t*L$@ tD$t(L$8 t1,ËD$8$D$8@@<$G@ˋD$4&[^+|t 51,1;l$}@ \$8 I ȍ A E;l$||$4^u |$$;l$}- $ D$D$)D$M|$0t$ |$ t=NىNL$@ ? $ D$D$@D$|$0t$ t2L$8 t 4$K,ËD$8$D$8@@Ћt$ ۉ<$G@Ћt$ ;l$f I ?H E1;l$@ \$8 I 1ȍ A E1;l$@ \$8 I !ȍ A Eۉ1ˉL$$!˃L$$t Љ1C1iFJL$ $L$$L$L$L$L$L$ 裣u(=+(=+ËL$ $&L$L$L$D$L$ t*L$ tD$ËD$$D$@@D$$D$@@L$ $L$$L$L$L$L$L$ u(=+(=+ËL$ $^L$L$L$.D$L$ t*L$ tD$ËD$$D$@@D$$D$@@L$ $L$$L$L$L$L$L$ Su(=+(=+ËL$ $|L$L$L$D$L$ t*L$ tD$ËD$$D$@@D$$D$@@T$ @@T%t1 I $ET$ u ËD$1Ë@@T%tD$1øÃT$B=Ў6uЃÉ$胉L$ $蓎D$Ut@ W $t'T$ B=Ў6uЃÉ$,1ËL$ $?TÃD$$\$\9\$u uD$$ 1ÃL$ $L$L$D$ ÃL$ $L$L$D$ ߧÃ(l$,\$0T$4D$$D$ sЎ6t,$\$T$(É$T$/=8L$$L$ L$$L$L$ L$ ^u1(Ã|$$u1|$ st $8=8D$1($(Á|$ suL$$ $4G(ËD$$@@T%D$$D$L$$ $@6D$L$ $Ӫ;D$teL$$ $/u1(ËW$W=8D$D$ D$ȉL$D$ ^T$ t1(É$B@L$$ $D$L$ L$s(ËD$$@@T%t&L$$I $L$$IL$L$ L$>(É $=8D$71(ÃЎ6 $L$$L$L$(L$\$ u1ÉD$P}ډ$T$ T$Ћt$ǃut1É4$F@D$NH1;l$ } I H E;l$ |tÉ4$F@Ћ|$ L$ $D$=8 $L$L$F2 Ã$à $ЅÃL$ $=8L$L$L$%u1ËD$@@T%t&L$ $L$L$L$IL$KËD$@@T%t]L$ $/u1ËL$ $L$D$ HL$T$ D$ tD$É$B@^$=8D$51ÃT$ J}B؋JI$ PËB t$$1NF؉Ãu$WO ÍP r  s 4ʼnl$ DDD I $O ÉI $.D$u1 ù $T$u t1 É$B@$D$D$\$T$D$ |$t t|D$D$L$ $蜃T$t$D$D$\$T$D$ t)|$^ tD$ É$B@$C@ЋT$Ɖ$B@t$C@ЋT$PFwD$T< $ D$ u1ù $ML$D$\$ A  $ML$\$ A @ L$ t!t t1É $A@ȃÃ= T<uT<$Li9D$Ãt$T$N9| 9 ȉø)9v+Ӄu1ۋF ?wsv&1ŃuÉn V^1Év1ˉ$ډ\$ tL$ t$T$\$ 랹1땹NV1à \t#I \<${ \u݃Ã\\$}(J"$~D$1Á?v ÉʼnD$J\<T$bB ZZӃ\$ Ct@J"$\$ T$C 8_ 8_IKC8_XЃÁvP1B B u t ZÉ$B@B $D$l$\$T$Mt $> l$T$뙹繬$ $Cl$\$ƒD$1ÃL$ A@T%uZJ"$D$(ËAÃ\$ T$ WC@T%urJ"$D$1Ã|C9} C Ãu J" $Wu1Ë^$L$1ÃL$T$\$A@T%u:uJ"$D$L u؉$C@˃|2A9}+A u1 u$B@u ^$J"D$ u׉$C@ʃ\$C|$ uJ"$D$=u W$J"D$ É$D$ AL$gL$ |$u Ã} σ}19~ϋD$p M9| HM9}D$ D$ 1à T$B@T%uK"$D$ É$L$L$L$L$ à \$C=u W$-K"D$1 É$D$AL$x\$u D$@ L$1 Ã\$ T$C@T%tuMK"$"D$ É$T$Gà D$$迶l$YtBT2| ,$U ÃT$tBTE tguN|KE tM u܋E $E t$@@Ћt$l$N}E $a T$l$=\P} E=$t@,$EЋT$SJTBXDBT8{U.\\<(뻃L$ $St9}UD$ D$$$eK"D$WD$ $v1%D$ D$$$kK"D$'D$ $F1ۋD$ @9D$ @ T$\$~.D$ D$$$mK"D$D$ $T$$L$$L$D$!\$T$t+ tD$ $tSÉ$B@ tLCD$ @9N8D$ D$$$pK"D$:D$ $YD$ $S1É$B@Ћ\$룃 D$D$ L$$ $ Rt~rK" $ 1D$$@uNxK" $D$ |$uD$$$RD$ ËL$ uߋD$$D$@@$D$|$tD$D$$@9D$ YA A ;U~{K" $iL$$I T$ $ D$YH |$9L$ $L$L$D$L$ =|$D$D$$@9D$]K" $D$|$D$@ D$D$$D$D$ZD$@ L$|$K" $`D$|$D$@L$I @D$D$$D$D$D$@L$I L$H|$0K" $D$|$L$ $L$L$,[D$ L$ D$$D$@@D$$D$@@D$@ÃT$11ɃuB9|ȃËL$ $J \$ L$L$R/T$\$C뼃l$ W\$|E9}E E Ãu K" $Wu1Ë^$L$M1Ã\$ T$(L$$}e19}Sʉ)ȉL$$D$$ǃu1ËD$ p L$$4o 1;\$}C;\$|ËC9~S룋C9~K둃 T$B@T%uK"$D$21 É$L$L$L$L$0 Ã$T$,B@T%u'^$K"D$B@ D$$1$ËD$(@Jȃ} B$É$ǃu1$ËD$(p o 1ۋD$(@9}CD$(@9|D$,p D$(hO ,1ۋD$,@9}CD$,@9|$à l$$\$(}1ۃ~M9EÉ\$(u$+ É$D$|$u1 ËD$p D$$@u&D$$@ (1;\$(} ,EC;\$(|D$ ËD$p D$$@ D$1;|$(}01D$$@9}\$ ED$$@9|G;|$(|ЋD$  à L$q t_iAA AM|9<t u$l$t$@@Ћt$l$M}lj4$ 1 Ã\|$h\$ll$dT$`D$<ƉD$8D$0D$,D$1ۃ19o|$h)l$d؉\$()ȉËB؉\$ u9|$,u $\ËL$, uD$,$D$,@@ЋT$`΋B D$4ȉL$$à vc1ƃD$8uJnt$8D$<9t4$ |$,uD$\ËL$, uD$,$D$,@@։4$T$4D$\$t\$hT$ |$dl$4t$8$D$D$`@)D$ߕL$` $AD$ D$E|$dt$8D$`h 1;\$(}T$0 u[ CG;\$(|l$$M| <uM}D$ u$l$@@Ћt$8l$롃~D$`@L$` $D$щL$l$ht$8D$`X L$  $\$4D$D$)D$ޔ|$dl$4t$8\$tى $ l$d\$B9zB9kjc9un$D$KL$uD$\ËL$` $L$dL$L$hL$D$lD$ T$lD$ tD$\É$B@$L"L$>|$hl$dT$`t$8D$,|$,aL$,IITt7D$,@ËL$,IITtD$,@ D$0sD$, D$,@ǃT$B@T%u!L"$D$É$L$L$L$L$L$ L$ à l$(\$$s}$&D$$ ø9~ É$Ήt$L$Ku1 Ë|$D$$p D$D$;D$(}+1;\$},EG(C;\$|D$D$;D$(|ՋD$$D$$ ؃ Ã|$t$ \$|WG9}Pu<$\$AL$t$ G (G 0MEt1É,$E@^$9L"D$ÃL$ $\L"L$L$L$L$L$ u1ËL$ $L$L$L$L$7u--1ÃL$ $L$L$u--1Ã,T$4B=$tB=W.$fL"L$;l$0ƒu1,ËHITT$4Bu% t--,É$B@M,$L$$D$ L$l$4uMEt1,É,$E@MITtQE NjD$0p L$$41;\$ }C;\$ |MEt--,É,$E@ 뫉D$4@!D$09$kNu1,ÉD$(@@pD$L$4 $L$l$0u(L$( t1,ËD$($D$(@@U9ډ\$$|D,$T$u(L$( t1,ËD$($D$(@@D$0L$$HL$( $D$Ћ\$0ŃutT$0t ,` $;tT$0BJ9}$BD$`L$( t--,ËD$($D$(@@܋CK9}CK (CW$l$l$FT$D$ t|$ &$B@L$ $L$L$à L$ $L$L$ƒuЃ tD$D$ É$B@D$L$$ $L"L$L$L$ ^\$ u1ËCu $L"D$1Ã|$}CD$|$|fC9D$}]C L$L$CH9D$u$KIL$D$$L$L$L$AL$D$ D$É $L"D$&1Ã\$T$ 9s+ *9rà $l$\$ u Eh XL$$ $D$D$D$<\$‰D$ u ËB@T%uD^$L"D$B@ D$T$ t É$B@$3T$D$ t|$ } 1$B@߉$C@ЋT$P D$$;D$,uD$,D$,;D$(\$$T$,D$ щT$)\$|$0u}L$ $D$L$D$T$\$} Ãt;T$9rT$,9v J 9wL$ D$,D$,;D$(i1 Ë\$L$ $D$L$L$0L$T$\$끃\$ T$D$$;T$u D$ / $T$JL$D$} ÃD$$T$;T$s?|$ u@ $T$JL$D$T$|t D$ ;T$rD$ Ë $T$JL$L$ L$T$뾋T$;T$sȃ|$ uC $T$JL$D$T$/uD$ ;T$s|$ t $T$JL$L$ L$T$뻋 $T$JL$\$~\$0T$ D$,D$$D$D$LL$$ $T$D$f\$} ÃWD$(+D$,D$ ;\$ }T|$0 ډ\$\$$ $L$ L$D$ \$|t\$C\$ ;\$ |;\$ ~\$ D$,D$D$,ËD$,)D$$D$D$9}_؉\$+D$L$|$0uRL$ \$$ $L$ L$D$z\$tD$ @D$D$9|؃Ë\$ 덉L$ \$$ $L$ L$L$0L$\$묉ډ\$\$$ $L$ L$L$0L$\$D$,@D$ ;\$ }B|$0u{ى\$T$$)ʋ $L$ L$D$\$Kt#;\$ ~\$ L$D$,)؉D$\$,)\$C\$ ;\$ }ǃ|$0tى\$T$$)ʋ $L$ L$L$0L$\$냋L$$ $T$\$\$\$0T$ D$,D$$D$D$P$L$$ L$D$\$} ÃfD$,@D$ ;\$ }X|$0L$ $ى\$T$$)ʋ L$D$n\$|t\$C\$ ;\$ |;\$ ~\$ L$D$,)؉D$\$,)ˋD$,)D$$D$D$9}\؉\$+D$\$Ã|$0uTL$ $ډ\$ \$$ L$D$\$t\$ D$9|؃ËD$ @D$닋L$ $ډ\$ \$$ L$L$0L$M\$몋L$ $ى\$T$$)ʋ L$L$0L$\$D$(+D$,D$ ;\$ }>|$0uqL$ $ډ\$\$$ L$D$ \$=t;\$ ~\$ D$,D$D$,\$C\$ ;\$ }̓|$0tL$ $ډ\$\$$ L$L$0L$f\$덉$L$$ L$\$J\$T$L$ сJB BBÃT$Bс9tB$8T$сJB ÃL$A 9D$ 1É $T$ vwÉ $C7T$BBt L$ J 1@D$$SÃ0\$4T$D$(t)L$,)ȃ$D$ D$D$~D$(8ÃuG)D$,)D$@D$,$D$@D$D$4~D$,L$H 18ËGD$D$0D$D$|$0lM $L$@ L$D$5t$Dl$HT$\$LlD$,D$,L$@D$@ D$D$Nt$DD$9zB^)‹D$1;l$T}6l$4T$LD$($)l$4\$(T$L t~E;l$T|ʋ$(@t|$@u@|$<t|$TD$h$e|$L6D$L$L$TT$LD$/΋W$M"D$6D$@량$C@Ћl$4nD$LD$dD$`\$\$=D$XL$d $L$`L$L$DL$L$$L$ T$Xt$dŃ|$$t4$l$ D$T$Xt$dl$ 9}CL$\9D$\4$D$ L$ L$L$DL$ t$dql$L$xt|l$ L$x̀D$xL$h $bL$ 9D$d)L$\|$\L$h $ `<$L$TD$D$DL$D $$(D$D|$D1$1$1m T$tTB@T%tD$D$D$`ƒu t1 É$B@M"$D$a ÃT$ B~B $BJ D$--à L$t6A@T%t&A~A $AI D$y1 øM"$D$ ÃL$t\A@T%tLAD$$l$ƃu1à ËD$P M| M}øM"$D$C1Ã8D$0D$<@D$,L$@ $M"L$L$(L$d L$ L$0L$d L$L$,L$辑T$<u18Ã|$0}BD$0|$0}D$0|$,}BD$,|$,}D$,\$0;\$,} B9=L^uN" $VL^u18ù $L$(L$ku18Ë L^ $D$$D$m~T$$ÉD$ t=u18ËW$\$`T$ t18É$B@$B@Ћ\$ 벋J \$4 $L$(L$L$T$<\$4~ $[8Ã}18CT$D$1ۋB9}>J \$ $L$ L$L$1T$\$~D$CB9|‹L$ $Ã}1ÃT$1ۋB9}zJ \$ $L$ L$L$T$\$~5$\$AL$D$ u--1Ã}1CB9|W$N"D$1Ãl$]K|;E tM \$ $L$L$D$Ћl$\$ tÃ1Ã(T$,L$0|$4B@T%A@T%΋BI9t#tuu "ȃ(ù(41B9} F9B9}SF9}Lu""(Ãu(4(4(ËJ $N L$|$(ËRNrt_tIt3t1(9u t (4ȃ(ù"19 19} 19t 1tu9| 19~ 1T$$J $t$ N l$ L$L$W|$4T$$t$ l$}1(ÃE(=+(=+(ÃD$L$$ $L$(L$T$ t1$É$B@$B@Ћ\$뜸X=Vt,$\$L$0L$:S$ÃtL$ $$D$ T$($L$ L$\$l$(\$,ƒd,$\$L$0L$R$B\$ Avw1u 蕻ËL$ $\$D$D$D$ T$t$1É$D$L$$L$9D$D$$ɿD$ÉBtA $?\$ oD$@D$D$ D$$A.D$D$D$ xD$ $,1ÃD$ XD$@9} 9~1D$HuȃÃt$l$F@T%t\^E@T%t:Mʉ1؃}1ȃ}4$l$6ЃÉ$(=+(=+(=+(=+Ãt$l$F@T%ta^E@T%t?M)ʉ1؃}#Љ1}4$l$6@ЃÉ$;(=+(=+(=+(=+ÃD$ \$3L$\$w $N<É4$l$6@ЃB.D$v10û~߉ÃugtV$t$L$L$L$L$ t1t10ËL$4 $L$8L$L$É$qËD$@t1L$Iщ $à L$(l$$E@T%]A@T%Q}W$]B.D$1 Ãvm M $!D$u1 ËL$(I $q!T$u t1 É$B@$D$ D$\$ T$D$ t tD$ É$C@$B@Ћ\$ щщƉ9M $ D$u1 ËL$(I $ T$u t1 É$B@$D$ D$M\$ T$D$ t tD$ É$C@$B@Ћ\$ щ4$ É,$ (=+(=+ (=+(=+ ÃL$l$E@T%]A@T%tdA}W$rB.D$1Ãt.t) |}$m1,$j(=+(=+(=+(=+à T$L$B@T%t5ZA@T%tA! $ (=+(=+ (=+(=+ à T$L$B@T%t5ZA@T%tA1 $ (=+(=+ (=+(=+ à T$L$B@T%t5ZA@T%tA $6 (=+(=+ (=+(=+ ËL$@@T%tD$1øÃT$B=1uЃËJ $L$I $ÃT$1ۃ r  s"É؃ÃL$ IL$D$$qAà L$ $L$D$ à L$ $L$D$ Ã(l$,\$0T$4D$$D$ s1t,$\$T$(É$T$B.L$h9L$ L$$L$L$ L$R ^u1(Ã|$$u1|$ st $B.D$1($n(Á|$ suL$$ $(ËD$$@@T%D$$D$L$$ $D$L$ $Q?;D$teL$$ $Iu1(ËW$B.D$D$ D$ȉL$D$ ܬT$ t1(É$B@L$ $D$L$ L$(ËD$$@@T%t&L$$I $L$$IL$L$ L$(É $B.D$踤1(Ã1 $L$ L$L$$L$ƒu1Ë@@T%T$$D$ u蟤T$umL$ $D$D$ЋT$Ãu t1É$B@D$L$ H t؃É$B@Ћ\$ t1É$B@T$BD$ gC. $L$ IL$Ã$ à $Ã(|$,w|$(}O1)É1D$ t$ƒ0MEӃuՃ}ME-,$)L$ϴ(É뱃LT$Pt$Tj*D$DD$@D$@à u $SLÉljlj)؈ʃ 0Kʈ uu,KbK0|$DtK-$L$&)ىL$LÃu|$Xt KoK0ƃ|$@uK0빃u KxK0K#D$ |$Ѓ0K ~gfff‰Ѓ0KlWF,11L$ $C.L$L$L$_u1ËD$@@T%t&L$ $L$L$L$IL$8ËD$@@T%t]L$ $cu1ËL$ $L$D$ HL$T$ D$ tD$É$B@^$"C.D$Ҡ1à L$A}#A1)‰$D$L$ $! ËQ߃-T[$}Iu$ʼnT[t8m-T[1JZx=C$|1ÃD$UU15T[11ۉуR}A=1u C R|D$l$ U U1ۃR},B=1uVtOB| B=|"C R|l$T$lD$ËB1ۉ\$Bu Z1ËJ uB$B@@Ћ\$T$ ЃtC@T%u @Y$o{;D$`돃L$ A=h)t{;$D$y1ËAà \$T$B=h)t{;$D$A Á-u>1ۉ\$Bu Z1 ËJ uB$B@@Ћ\$T$ЋC@T%t봋@Y${;D$C@ D$ Ãu1Ë_$-|;D$=T$t1ËB u!T$B B u1ËB B à ^L$\$t Ãu$c|;D$ ËC@T% u$|;D$藏 ËQ Y u1 u$B@L$t1ËAAÃ$l$,\$(t $ÃE=;#E(PKuz1D$9ЉT$tGK $9D$W$|;D$D$D$D$D$ D$D$U$ËSEk t1$É$B@C@뀋^$|;D$o$ËL$AAà L$\$t Ãt4C@T%t$QY t1 É$B@^$};D$ vL$t1ËAu --ËAAà EL$T$t Á-u1҃tB@T%t0Yu$Qu1 u$C@؋^$>};D$0 ÃT-D$H-D$D-D$@L$\ $L$`L$};L$/L$ ;#L$L$PL$\4L$L$LL$L$HL$ L$DL$$L$@L$(~5^u1TËD$H=-tD$H@@T%D$D=-tD$D@@T%D$P@(PD$@@@T%u6tD$@=-PD$@=-t4$Z~;D$1TËL$@-19t1 W $~;L$L$PI4L$T$ l$RTÃt>19}8T$@P B=ty3t4$~;L$JI L$TC9|ȋL$P $L$LL$ƒu1TËD$H=-tD$HJ t=L$HJD$D=-t D$DL$DJD$@=-t D$@L$@JЃTËB$T$;D$ׂ1 ËAA ÃD$ D$L$$ $`;L$L$L$ L$L$u ùm; $L$(L$Àu ËD$D$L$H1à 7 $D$Ө\$ƒtZЃ à L$=PtR W $#L$L$L$}1 ËA4t A4A4 -- 1΃l$\$=P W $#L$L$耿l$\$} ËE4tE4tU4E4 t-u1ۃu ]41$B@Ћl$\$1뚃 L$=PtR W $ρ#L$L$L$}1 ËA,t A,A, -- 1΃l$\$=P W $#L$L$tl$\$} ËE,tE,tU,E, t-u1ۃu ],1$B@Ћl$\$1뚃 L$=PtR W $#L$L$ֽL$}1 ËA0t A0A0 -- 1΃l$\$=P W $9#L$L$hl$\$} ËE0tE0tU0E0 t-u1ۃu ]01$B@Ћl$\$1뚃D$$L$AAÃT$ B(tB@ËJ $JÃ|$tD$@TB D$Ձ8;l$s,Et]l$E ;l$rԋB$t \$B$9s+B$9rB J J BtZB dB(tZ(B( 1B,tZ,B, B0tZ0B0 B4tZ4B4 Z\$ C@uUS@ t<|$D$HTD$@XD$@Tqg$C@뷁=4^}4^ ZJ  Z닉$(\$ z$C@ЋT$T$C@ЋT$!$C@ЋT$$C@ЋT$$C@ЋT$B$B@@ЋT$OB$B@@ЋT$%J B $B @@ЋT$ $\$@@Ћ\$T$$C@Ћl$T$gT$ B t!J $L$(L$D$$ЋT$ tËBt!J $L$(L$D$$ЋT$ tËBt!J $L$(L$D$$ЋT$ tËBt!J $L$(L$D$$ЋT$ tËBt!J $L$(L$D$$ЋT$ tËB(t!J( $L$(L$D$$ЋT$ tËB,t!J, $L$(L$D$$ЋT$ tËB0t!J0 $L$(L$D$$ЋT$ tËB4t!J4 $L$(L$D$$ЋT$ tËBh JI(I͋JI,I͉Ӂ8Ml$|@t,\$ $L$(L$D$$Ћl$\$T$ tÃMl$}B$tCZ B$9s9t(\$ $L$(L$D$$Ћ\$T$ tÃB$9r1Ã\$ C$D$C$C,tS,C, VC0tS0C0 #C4tS4C4 C(tS(C( Cp KI(I΋KI,IΉ݁8Nt$ |,EtUl$E tWNt$ }ԃ|$t.[ ;\$s%t\$ t ;\$rۃÉ$B@Ћ\$$B@Ћt$ l$\$ 됉$B@Ћ\$ /$B@Ћ\$ $B@Ћ\$ $B@Ћ\$ T$B@,XB@(HB@ ؋JIȍ8$߲Ã# $5LYu1øÃ(D$,@D$$|$$D$$@;D$4D$$pt$D$0@@=D$0h@D$0@@EM M$u|$$L$$M D$0D$4l$ L$4MD$0@utL$,M8ET$$BtB($D$D$D$L$D$1øË@=@M-t( I $@M-L$sT$u ËD$1ÃD$$\$\9\$uoE)D$$D$1MD$$LVSSul= $OD$$۩\$PXuq(4D$ L$ $-TVT$ |$fD$l$\$l$L$) St$uW$zK1ËWЃø"덋T$96+D$DS1""1Ã(D$,$i\$ D$ $D$D$aY0$\$wh;\$wD$$,(D$|$ fD$l$\$l$ L$ $(ÃD$$\$D$$޺ÁDŽ$dD$@D$ʼnD$ |$Ѓ0 7Agfff‰ՉN0$;$~J$$$ߏ$D$<|$<uF$$wzD$(ËD$<$$D$D6+D$|$4M6+D$ |$D$8+$D$0VVD$<$D$fݜ$=Vu݄$$"B1s2݄$$D$(D$@9D$<2D$<$P!W$P6+D$@ȸO6+C|c\$ 1ɉ9}1L$ \$ A9|݄$$D$ \$$#PXu 11x1qT$ B=@M-uЃB$L$ u6+ÃD$B5OtF2)t 0t1t ȃù13t 4uٹ׹йɃ8!t6t 7u뱹몹룃9t Au 뒹 당 넃bOtE.t"CtDc ^ TJFt a7롹0ct̓dtet̓f܃HD$L@=@M-L$LI $@M-L$lL$L $L$@L$}D$LHD$@$EeD$@$D$EH\$@u@$D$@\$L\9u6+ $PHù6+ $PHD$@$\$ D$ $D$4D$Q\$8+L$41)D$8$L$0L$2R\$8D$0)D$4D$(D$8|$ fD$l$\$l$ T$$nT$(шDBD$8|$ fD$l$\$l$ L$L$D$l$8\$8D.BT$(1ۃ \$,[2L$8\$8D$8|$ fD$l$\$l$ T$$\$,T$(шDBT$(D$8|$ fD$l$\$l$ L$ȉL$D$l$8\$8C \$,vD|$4}e-D$4؉D$4\$@v%6+ $L$L$T$L$4L$ WHù6+ $L$L$T$L$4L$ VHú+룸+D$4@L$L $HËD$L@\$@f\$T$t  # 8t t1øCBǃdD$L$l $L$@L$L$L$e`t1dËL$@T$ D$,L$@ ɋ ;tD$@ۋD$@-/D$@D$D$@iD$@ID$@neD$@NUL$@D$@0u(D$@D$@x(D$@XL$@D$@D$8+ $}@ùR8+ $l@ù68+ $[@ËL$ $7+L$謥u dW뉋W$7+D$,1Ã$L$, $8+L$L$ L$L$L$ u1$ËL$ $8+L$:YD$PWD$L$ $8+L$ uG1҃t;T$uD$--$ËW$d9+D$D$ D$31$ËL$ $8+L$訤u뚋L$ $8+L$臤u vW$ 9+D$+1$ËL$ $8+L$FudWD$P[D$ W$8+D$y+1$Ã$ÃL$ $9+L$L$L$eu1ËD$@@T%t&L$ $L$L$L$IL$4ËD$@@T%t]L$ $Lu1ËL$ $L$D$ HL$3T$ D$ tD$É$B@^$9+D$u*1Ã/\$ L$ $0;+L$L$PWP,(\$L$ $B;+L$L$u@PWY P[ dW=<ux<$d-D$8ÍL$ $G;+L$L$*u1뗍L$ $9;+L$L$uPW3PW$D$]]15Ytz11ۉу>}A=@M-u C>|D$l$tT ] ]1ۃ>}B=@M-u%tC>|l$T$uD$Ér։YՉ$35Yl$Ez,'D$=Su,øh"$L;+D$bL$h"$];+D$?=S~W]D$$|$$tFD$ T$$|$ >}B=@M-uu#D$ |$ >|D$$D$$|$$u,ÉT$(B$rL$D$ D$D$(T$(th"$x;+D$T$D$ L$L$xD$$vvT$(eh"$_;+D$L$uu;+D$ ;v;+(=dWD$|$8t D$4D$\$,D$'d$,\$,D$,$D$ D$';l$\$4\$0\$w\$V\$&D$ |$ | W$;+D$^&(Ã|$ D$$D$ ~D$I;l$\$4\$D$ 6L$\$D$00$\$ l$ T$ t1D$ |$ ^D$'L$ ȈD$  Ȉ%с 1(Ã|$ u\$VD$ l$\$B@Y$;+D$J%(|?0L$\$L$ D$'ID$,\$$D$$D$ D$D$$$D$-t$l$ \$4t)D$,$D$,t$l$ \$4E=dWu,|$8u%1҃}E B|1(Ã=dWuڃ|$8uу,YL$ D$t$ $L$xL$a$AD$t$S $JH$$t'$ $觰D$ L$ $L$ QA,D$ T$Qt AHAT$tnA,i D$VL$ $D$ЉD$D$$ T$D$ L$ H,u Y $\Ãt $W--Ë~Y$/D$1Ë@Y$/D$+ $D$D$+ЃD$u1ËL$$ $(t$\$,T$ u1tut1É4$F@$Ӌt$ى4$T$D$D$L$(L$ \$a\$T$u6 t t1É$B@$C@ЋT$ t؃É$B@Ћ\$$L$L$L$L$L$ ƒt0T$$L$L$L$L$pT$u t1҉ЃÉ$B@L$ T$|htzD$T$B$NT$|$uƒuiD$@=@M-t!L$I $@M-L$<M W $/L$L$GL}1,ËT$D$B@T%D$$T$T$*T$ 3t1,ËD$0@HD$VL$0I $L$L$L$ L$L$(L$ \D$$D$$L$0IH|$$t#Y$D$0@$l1,A8--,É$B@HT$$OT$D$L$ 1,Ã0L$4D$$Au [0ËAPu>/ $b0ËL$8 $F/L$D$L$ L$$L$ u10ËD$4@HD$VD$$D$4@D$UD$$D$4HHD$u,D$ u#Y$lD$4@$310Ã|$$D$$@@T%RD$($D$$D$1 t10ËD$4@HD$VL$4I $D$D$$L$4IH|$KAH}D$VL$4I $D$L$ $L$(L$L$,L$D$D$$vL$4IH|$AHD$VL$4I $L$L$L$ L$D$ t6D$D$$ D$4HH|${--01ˋL$$ $1MD$(L$,D$D$(D$ D$,L$Au AHOD$VD$ $D$@D$ D$$d\$KHD$ u,D$u#Y$7D$@$1ËC8t=KI SR9r[K $\$ u/؃K4D$ T$C8L$ $L$L$mÃt$CD$}ҋKA A %롃T$ Bu ËJ $D$L$ $Jà L$Au AHD$VL$I $%D$D$$D$HH|$t#Y$D$@$1 -- ÃL$Au AHxD$L$I $D$L$ $D$ D$$D$HHL$ $ ÃHL$LI $D$L$ $L$L$D$$D$8D$(D$ŃuNu1|$4uD$0@ËL$4 uD$4$D$4@@MEuĉ,$E@뷉D$<@D$ |$ u--D$01;\$ E \$$B@T%D$D@tET$$L$L$L$L$T$t ^$%/D$dl$<T$$L$L$L$L$YuL$ $L$L$l$<\$$T$ƃD$8 E 0C;\$ D$D@D$D@HD$V1;T$ D$<@ T$$AD$ $L$L$L$L$DIL$ RT$$;D$t9D$$D$DHHY$D$D@$Jl$ W $/L$L$$}1 ËL$I $( 1ރ=P W $/L$L$b$} Ã|$u ^$:/D$-ËL$ $(ƒD$ uPT$ u D$P1ø1댃L$A tA $4D$@ ÃT$B tB$J()ȃ|1É$L$ $;4T$B uHBHVT$D$VJ $L$ L$JL$T$ D$D$$\\$KH|$uFK $7\$t2Y$&D$@$D$$ËK K(؋S \$ H$1ÃT$ B u$L$(L$T$ }1ËB$J()ȃu$L$$L$&ËJ( $ L$D$ D$ t$(l$$T$ ÃtzCB(ډ\$)$щT$ L$u1ËL$$D$$D$ @(D$D$ D$\$T$ Z(B$9u$D$ËB(D$B D$B $L$ L$ʉT$uD$$21ËL$$D$$D$D$D$ D$}~D$$S2vT$Bu ËBLu/ $É$D$ L$8ƒtBtЃÃu1 u$B@ =0`u/ $j0`u1 ËL$ $D$D$Ћ0`ƒt4Z Z--J<--J@BDBHЃ ÃL$ $6L$ YL$Pt 6$詏`D$($6D$`D$L$ $ 6L$ `L$hPt (6$QUD$($M6D$UD$L$ $V6L$ UL$Pt _6$_D$($6D$_D$6L$ $6L$ _L$Ot 6$衎[D$($ï6D$[D$L$ $ׯ6L$ [L$`Ot 6$IL$ $6L$ \L$Et )6$詄D_D$($N6D$D_D$L$ $]6L$ D_L$hEt l6$QlYD$($6D$lYD$莾L$ $6L$ lYL$Et 6$aD$($ҷ6D$aD$6L$ $6L$ aL$Dt 6$衃LUD$($6D$LUD$޽L$ $"6L$ LUL$`Dt 16$IPD$($V6D$PD$膽L$ $c6L$ PL$Dt p6$l-1 $D$D$9Yu 6$輂61 $D$D$Zu36$臂L$$ t,ËD$$$D$$@@D$6 $訪ƒD$u6$8T$ $T$趄T$D$|$uW6$T$ tSL$ $L$L$D$T$t6$ȁT$ 0$B@ $B@렃 YtY t3=ZtZZ tÉ$B@ $A@$D$D$L$, $L$0L$;!L$8-L$ L$L$L$L$;T$(u1$É$D$ЃD$ u1$Ã|$7L$ $T$ D$|$u t1$É$B@L$ $T$ BBuΕT$ BL$ L$ $T$ B B u t1$É$B@ $-L$-L$uT$ BBu t1$É$B@Ѓ$ËD$$D$@@aMD$ @L$HE@@2D$$ET$B uhBu=Bu$BЃËJ uB$B@@ЋT$ˋJ uB$B@@ЋT$렋J uB $B @@ЋT$r T$B t!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 Ã]T$BD$Bu( $S]T$BBu1Ãu$ $T$Ã]u1ËBD$ $\$8T$Ãu1ËD$Xu\J t7J tL$ J L$JЃËB$B@@ЋT$ՋB $B @@ЋT$벹 $+|ƒuL$ t(L$ t1ËD$$D$@@D$ $D$ @@ÃL$AD$ A $@@pЋ\$ƒD$u1ËC=u$T$`ËK $l$T$ ÃD$uMEt1É,$E@D$@udJ t7J t Z jЃËB$B@@Ћl$\$T$ ՋB $B @@Ћl$\$T$ 몹 $zl$\$ƒu tMEt1É,$E@$C@Ћl$у(D$,=-uS! $L$4L$L$0 $^!L$L$L$ L$ L$iu1(ËD$ @=$ L$ $g!L$ƒD$u ` $1蜕T$t6$D$iT$D$ tD$(É$B@L$ $u^$!D$襏1(ËL$ $#T$,D$$u1(É$D$Љƒu1(ËL$$IHD$ L$ J Ѓ(1(ËL$ $t!L$XL$ƒD$ UT$1(1(ÃD$$@T$B u$BЃËJ uB $B @@ЋT$˃ T$B tJ $L$L$D$Ѓt 1 Ã\$C|MK $D$ t D$HȃË ^ $IuL ,` $6\$u5CC tS C t1É$B@l\$ T$B u$> ËJ $<u1 ËD$@@9}1ɉ $ É  $L$L$zu Ë W$L$L$T$ t É$B@ p_t#I p_l<$? p_u݃Ã=\[u% $ \[u1Ã=p_ p_p_l<CtO؉\$ $D$`D$0'\$ C1ɉK كKCZK؃ÉكKCṜ\4 $L>u1ÉD$ $D$`D$&\$ C1ɉK كKC눃,L$0t$4AD$AD$l$8#l$l$( IT$ @A9A;\[5L$ D$8D$$T$$@ʼnD$(#L$ IT$ @u|$ uȃ,ËD$ A9uȃ,Ë;D$8u A;\[uA;\[u|$ tl$$뇉L$ L$QT$ $t$L$t$4l$(T$ ÉD$ tP}1,ËD$0@9D$u D$@9tL$0 $t$L$8L$,ÃnD$,É$B@Ћt$4l$(\$T$ 듋;D$8L$QT$ $t$L$at$4T$ l$(ÉD$ tY}1,ËD$0@9D$u D$@9tL$0 $t$L$8L$,Ã~D$,D$ -$B@Ћt$4\$T$ l$(늉ȃ,Ã$T$(5\[l$,BD$BD$E=$1t .XJ$l$L$0L$e$Ë\$0#\$\$ [T$ ‹@B9B9׉T$D$0D$T$@ÉD$ #L$ IT$ ‹@uuЃ$ÉB9tX;D$0uB9uB9utl$뛉׉T$T$ J $l$|$5\[l$,\$ T$ tЃ$Ë;D$0u&T$ J $l$5\[l$,\$ u 1|$D$ $ÉЃ$ÃD$ @=\4yD$ @iL$ qAD$1;l$"l$ it$Pu.E;l$~ދT$ BB JHËB@T%@tKBt#$T$BЋt$T$l$ tB=W.B i@@@T%@U i@@t;j I $ i@@Ћt$l$  i@@=W.u i@@Ãà t$l$ \$D$@C@T%@tGCt$CЋt$l$ \$tC=W.CE@T%@tGEt,$EЋt$l$ \$tE=W.EFt蠄1(Ã|$,t$(\$0T$$l$ E D$uxl$,$T$t$\$ \$t ËC ;D$~?C@KɃ9|-$S P~S ʉL$ù1Él$,$T$t$|$ \$\$tÃ\$ D$@@T% u %$#D$YËC=$1u>S u$\$ ‹L$ $\$T$D$ L$$L$É$贯\$ ƒuŸà l$(D$$@@T% u8%$>D$軄 ËE=$1U \$$$l$T$\$CЋ\[ƒu Ë@uD$($ Ëjl$ ZZBD$H tMEt1 É,$E@$C@Ћl$ щ,$褮l$(ƒI Á$A@T% uĀËAD$tȃ9D$taD$pL$|AD$l|$pȃ$D$`D$\$|C1ɉK كKCT$t|$l~*BtL$lJ tSBu$ |$lփ|$pt D$t$ĀËJ uЋB$T$xB@@ЋT$x뵋B$T$xB@@ЋT$x뒃|$ldD$ $D$tD$`D$qD$ D$tD$|$D$`D$\$|C1ɉK كKC1 |$L$A@T% u1 ËD$}1 Ëiq9 [ @tLD$A9~1 Ã|$t [ @L$t [ @ C뚃 |$L$A@T% u1 ËD$}1 Ëiq9 [ @t]D$A9~1 Í [ L$ |$t [ @L$t [ @ C뉃L$AD$ $*YD$|$tD$@T2|D$$Ã|$tD$@TD$P|$~2Bt L$J B |$΋D$@L$9tD$@$T=p_P}D$@=\4tRD$$D$@Ѓ|$UD$HTD$@X>D$@T.`$p_p_l<L$멋J AB$T$ B@@ЋT$ #B$T$ B@@ЋT$ $L$( $5t9}$mD$D$,$P%D$:D$$ n1$mD$D$,$V%D$:D$$mD$1ۋD$(@9T\$ [L$(Iȉ‰D$HL$D$D$~.?mD$ D$,$X%D$A:D$ $`mT$J $L$,L$D$t7L$ tD$($$ËD$$D$@@lD$ D$,$[%D$9D$ $lL$ $L$,L$D${\$ T$t+ tD$($_$É$B@ tLCD$(@9#lD$D$,$^%D$%9D$$DlD$($1$É$B@Ћ\$ 룃4D$$D$ D$L$8 $D$0|$0t|$0~`% $҈41D$8@ uwf% $豈D$|$ u=|$$uD$8$^D$4ËL$$ uߋD$$$D$$@@ʋL$ uD$ $D$ @@$jD$ |$ ti% $#D$$|$$gD$0L$8 $L$0L$L$L$L$L$ D$L$ $kD$,D$,$D$$D$L$ $GD$ D$,$D$ D$fL$ tU|$,L$ $L$,L$KnD$L$, t|$8D$,$D$,@@ۋD$$D$@@떹l% $ D$,|$,QD$ @ D$(D$,$D$(D$D$ @ L$,|$,n% $踆D$,|$,D$ @L$ I @D$(D$($D$,D$RD$ @L$ I L$(H|$(p% $MD$,|$,L$, $L$ L$D$L$, hD$,$D$,@@PD$@ à \$(C=$1S L$$ $\$T$D$$@ЋT$$u1 ËHB=\4tq$s%L$PL$tBD$$L$(L$D$T$D$ tD$ É$B@Jrt1 ËD$($j1 ȃ É$֣\$(ƒ!1 à l$\$T$u$T$ É$T$l$O à T$$B D$$fT$$Ãu1 ËB 9D$t uΉ$C@ЋT$$뽋BD$BD$ 11;l$ ; iT$ @t iT$ pC 0GE;l$ ~ʼn؃ à T$$B D$$SfT$$Ãu1 ËB 9D$t uΉ$C@ЋT$$뽋BD$BD$ 11;l$ ; iT$ @t iT$ pC 0GE;l$ ~ʼn؃ Ã(D$,@ D$$eÃD$$u1(1t$ ;t$}K $Yt$ \$$Ńu t1(É$C@C (Ft$ ;t$|D$,@ 9D$t k$C@[D$,@D$D$,@D$1D$;l$J iT$ xt, iT$ pC L$r zD$E;l$~؃(ÃD-D$ÃL$ I $L$L$?ÃL$ I $L$L$sà L$I $L$L$U}1 É$; à -D$L$( $,-L$L$L$ L$L$L$L$4u1 ËL$$I $0-L$4-L$L$L$ L$L$ à L$I $9-L$D$Ԅ à L$I $>-L$D$譄 à L$I $E-L$D$膄 à L$I $K-L$D$_ à L$I $T-L$D$8 à L$I $_-L$D$ à L$I $i-L$D$ Ã\$ ڃBB JHK t $:ËC$C@@Ћ\$ ݃L$I $~ÃL$I $0WÃL$I $Tu1ù[- $D$ L$4QT$ D$ tD$É$B@T$BtJ $L$L$D$Ѓt1ÃL$ I $L$L$"aà L$I $L$L$L$L$Vc à # $>T$-8_ÃtLSډ\$T$Btt-$-8_\$T$B*MJBU؃ ÃD$ $T$ YtAT2| $ÃL$tATBuVB u+$WL$tITAXtċAT 뵋J uɋB $B @@ЋT$ 벋J uB$B@@ЋT$ 뇃T$ \$BK9uJ $K L$_ËJS9s ø L$I $ReD$u ËL$I $eu ËD$1ȉuȃ ÃT$- $JI L$J II L$J L$ NÃD$@@ÃD$ @@$+FÃD$ @@@u--É$EÃ\$(T$ B@h l$r t$B@@t4$L$$L$JIL$\$ ՃÃtRC@T% t$l$t$T$ t)^$-D$B@D$91É4$L$$L$JIL$ՃÃT$Bt%T$ J $L$L$D$ЋT$ tËB tJ $L$L$D$Ѓt1ÃD$D$1 $t$T$-8_ÃtQsS ډ\$ T$Bt-$&-8_\$ T$B*MJBU؃ÃL$ $L$L$D$D$ xÃL$ $D$L$L$D$ MÃL$ $D$D$L$L$ "à T$\$CC KHBB upBuABuD$$D$@Ѓ ËJ uڋB$B@@NjJ uB$T$B@@ЋT$똋J uB $T$B @@ЋT$fJ NB$T$B@@ЋT$0L$\$tI-tAAu`$^-D$f/1ËI $s-L$\${ȃÃl$$\$(D$ Pu,`$uw-D$/ø-uA$-L$l${ƒu  t1É$B@$-L$l$\$ ={빋P d(T$,T$$$3t$4l$$\$0T$8D$|$u1(Ã?-3--Et-unMt_EŋL$ $-L$\$t$ T$l$|zT$ÉD$ tu1(É؃(É$B@Ћ\$ ޸-락-똃uMt Ed- uމ$B@Ћt$4l$$\$0ŃuM tE ƉD$4 -uډ4$F@Ћl$$\$0T$8uMtEÉD$0- uډ$C@Ћt$4l$$T$8$ $L$4L$}$ĀË W $`3L$L$ $JD$ D$ \$<$t$L$(D$$1 Ë@@T%tY$\\$\9\$u Au(<$t$BL$(D$$1 ø Ë@=@M-te I $@M-L$6T$(uF@==9t( I $=9L$5T$(u  ËD$$1 Ë$Ѥ\$<$t$L$(D$$1 Ã4|$@t |$@`D$8@==96L$8I $=9L$A5L$8 $L$ L$?}D$84ËD$<@@T%pD$<@@T%XD$<@=@M-L$L$L$ $؈)L$OL$D$ $D$(D$L$L$ I $ )L$`\$ ‰D$CC@@T%t|K $\$ T$ʼnD$tEB@T%t5$D$*) $L$L$L$L$L$ L$ ù) $l$\$ý)l$뒃$L$(I $>)L$蕁\$(‹KA@T%B@T%T$ ZL$I$L$ى\$AL$atWȉL$D$ $D$ D$D$D$pL$ D$A. $D$D$D$D$|pL$ȃ$ȃ$É$:$à T$Bt!J $L$L$D$ЋT$t ËB t!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBt!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 Ãl$ T$9u ËE@T%tPED$1;\$};$ډ\$ I L$l$ T$\$t C;\$|1ÃtsB=4uiT$ J $訾D$1;T$}HL$ I $T$T$¾D$L$ $L$ L$/T$t B;T$|11ÃL$D$@=4tR)$ D$V1ÃFD$u1ù$ $t$-8_T$Ãu t1É$B@@pP ‰D$ T$Bt)$N-8_\$ T$B*MJBU؃ËA@T% uk)$D$s13=Wu) $̖Wu1ËL$ $D$u1ÉD$$ WL$l$$\$ T$t t1É$B@t%C@T%tA$vl$$T$u,t!E@T% t,$mT$uЃË^$)D$T$ t1҉$B@D$$L$ L$L$$L$>l$T$ÉD$ MEu t1w$B@-t.^$ˉ)D$zT$\$ t'1҉T$ '$C@ЋT$$B@Ћ\$ ȉ,$E@Ћ\$ T$^-D$L$$ $)L$4L$L$L$ L$L$u1ËD$=-u D$L$ $L$L$yËD$@@T% uԋ^$)D$~1Ã$T$(ӃBB JHCt $ل\$(D$ $D$D$D$D$m^u,() $Γƒ^uD$($^tL$( $T$D$ $D$D$D$D$z-8_T$( uyBtB$i[T$(BuJ t7B u $K$ËJ uB $B @@ЋT$(ыB$B@@ЋT$(벋T$ Bt0)$θ-8_T$ B*MJBUvD$$D$D$;\$ƒu)$\$ $C@uډ$B@Ћ\$ɃT$ B@T%u^$J)D$91É$u\$‰D$_u B_t_$L$ L$D$|$u 8tD$Ë`$)D$D$@@D$D$D$ LƉ$j)L$9Eu79L$t_$s)D$v1ËA A ËL$ $)L$D\$2CCÃL$ I $L$$L$LtËL$ I $L$$L$L$L$l$ ƒtJJITtJBt)T$$l$ML$ЋT$D$ t T$ ЃÉ$B@1뻃L$ $L$ L$ÃuD$@@D$u؃Ë ` $Xu1 $L$L$L$ L$~u1ËL$ $D$ D$D$8T$ ÉD$ u$B@Ћ\$qD$D$ H $L$ L$Ju!L$ I $L$ L$L$L$IȃÃl$ \$T$uWK $T$LD$}7`$ڊ)D$D$@@D$D$D$ L$ȃËK $T$l$KÃ(T$0B@T%u ^$)D$(É$|$4l$,_uL$A_EHL$$u,$L$0L$|$(à $l$L$0L$讶ƒu (ËL$$ $T$ T$D$#7\$ ‰D$ t*u ( t1(É$B@$C@ЋT$Ź $l$L$0L$|$ dEHL$0 $|$4t$l$,Í@_@_4$#)L$@5L$,\$4t _$,)D$(Ãt4C@T% t$Q Y t1(É$B@^$W)D$(ËL$ $|)L$@@|$4l$,4L$,\$4t _$)D$m(Ãt.C=4u$QY t1(É$B@^$)D$(Ã(_u Ӌ) $‹ƒ_u1(ËL$, $T$Mƒ ` $u1(:T$,B@D$JI $܋)L$ r\$‰D$tC@T%up)\$tEB@T%t5$D$) $L$L$L$L$L$,L$ (ù) $\$L$,L$b(É$8T$ÉD$녉T$$$D$D$3T$$D$ tD$ (É$B@Yu ) $QƒYu1ËL$ $T$u. ` $fu1L$ $"ÉD$$D$D$3T$D$ tD$ É$B@^u#) $螉ƒ^u ËL$ $T$&< ` $u Zu#') $6ƒZu ËL$ $T$ƒ ` $Bu `u#.) $̈ƒ`u ËL$ $T$Tƒu1 ` $u BL$ $QÃu ^$6)D$ u׉$B@ʉD$$D$D$V1\$‰D$ u ËB@T%uQB@T%uA^$J)D$T$D$ tD$ É$B@$B@<ЋT$D$ ͉$C@ЋT$h T$Bt!J $L$L$D$ЋT$t ËB tJ $L$L$D$Ѓt 1 Ã\Uu#j) $ƒ\Uu ËL$ $T$zu ÉD$$D$D$/\$‰D$ u ËB@T%$T$ÃD$ u\$ T$uI}$W$r)D$XT$\$ t؃É$B@Ћ\$ t É$B@^$)D$T$\$ 뛉$C@ЋT$_u ) $胅ƒ_u1ËL$ $T$D$u1ù $L$ L$ڭT$u t1É$B@$D$D$D$>.\$T$D$ t tD$ É$C@$B@Ћ\$у|VZ|$$Hu#) $菄Ã|Vu ËL$ $\$L$u Ã|$$ $L$ L$Ӭ\$ƒu t É$C@$T$T$D$2-l$\$‰D$ tFMEt*u  t1É$B@,$E@ЋT$ ʼn$C@Ћl$T$ 륹 $L$ L$L$$L$\$*u#ƌ) $GƒZu ËL$ $T$_u Ҍ) $ƒ_u1ËL$ $T$u1ÉD$$ތ)L$L$L$ T$D$ tD$ É$B@Yu ) $sƒYu1ËL$ $T$ƒD$ ` $~u1_u ) $ ƒ_u1ËL$ $T$D$u1ËL$ $L$$L$oD$) $L$L$\$ƒu t1É$C@$T$T$D$*\$T$D$ t tD$ É$C@$B@Ћ\$у=Ptm W $)L$L$=T$} t1É$B@4) $L$ L$L$$L$\$ 1볃|VZ|$$Hu#9) $胀Ã|Vu ËL$ $\$ L$u Ã|$$Q) $L$ L$V\$ƒu t É$C@$T$T$D$&)l$\$‰D$ tFMEt*u  t1É$B@,$E@ЋT$ ʼn$C@Ћl$T$ 륹U) $L$ L$L$$L$\$*u#E) $;ƒZu ËL$ $T$]TW|$,u#Z) $~Ã]u ËL$ $\$jƒD$^ ` $u P|Vu#g) $t~ƒ|Vu ËL$ $T$D$u ËL$$ $L$(L$ҀD$ s) $L$ L$<ƒu+L$ t ËD$$D$@@L$ $T$T$D$'l$\$‰D$ tFMEt*u  t1É$B@,$E@ЋT$ʼn$C@Ћl$T$륃=Ptl W $w)L$L$cT$} t É$B@깮) $L$$L$L$(L$1봃u#) $|ƒTWu ËL$ $T$LƒD$ ` $̹u 2Zu#) $V|ƒZu ËL$ $T$D$u ËL$$ $L$(L$~D$ ̍) $L$ L$L$,L$=Ptt W $э)L$L$T$} t É$B@) $L$$L$L$(L$L$,L$ X1묃@Wu#) $F{ƒ@Wu ËL$ $T$D$ $L$$L$蜣T$u t É$B@$D$ D$D$#\$ T$D$ tX tB|$u ËL$ $T$D$ tD$É$B@$C@뱉$B@Ћ\$ 뗋 ` $}t9L$ $L$$L$L$|~ 1ÃL$ $L$L$u1ÉD$$D$D$"T$D$ tD$ É$B@L$ $L$$L$;D$ u- ` $褶u1 (=+(=+ù $L$ L$áT$ u t1É$B@$D$D$D$'"\$ T$D$ t tD$É$C@$B@Ћ\$ у ZD$$@=$t(=+(=+ Ãu ) $lxƒZu1 ËL$$ $T$eD$u> ` $}u1 L$$ $L$(L$L$,L$ ù $L$(L$苠T$u t1 É$B@$D$D$D$ l$\$‰D$ MEu1 Á-c(=+WB@T%$菝T$$D$话D$L$ $L$薝l$$T$ÉD$(BM9uE=$ YA A ;U~M) $詪\$(T$u^|$4tD$T$D$0ЉD$ YH L$ tD$ ËD$$D$@@$\$D$0ЉD$ 1 É$\$L$,L$D$ t^$&)D$S1 É$B@ t L$$ $L$(L$L$,L$` É$B@Ӊ,$E@ЋT$<$C@Ћl$T$L$ $L$ L$L$$L$L$,L$ D$=(=+u8 t5L$ $L$L$L$(L$L$,L$ L$‰ЃÉ$B@뾃L$ $L$ L$L$$L$L$0L$ D$T=(=+u7 t4L$ $L$ L$L$(L$L$,L$ L$0L$‰ЃÉ$B@뿃 ZD$$D$D$(D$u#]) $vtƒZu ËL$ $T$lD$u* ` $脱u  ù $L$L$覜u ËL$ $D$D$D$l$\$‰D$ MEu Á-(=+B@T%tn$辙T$ u]$D$L$$L$ $L$Ǚ\$(T$ D$$ t1 É$B@ t ^$h)D$$ É$B@ t  É$B@,$E@ЋT$ $C@Ћl$T$ DZu ) $trƒDZu1ËL$ $T$fÃHZu ) $2rƒHZu1ËL$ $T$$ÃLZu ) $qƒLZu1ËL$ $T$ÃL$ $L$L$)L$)L$ L$ÃL$ $L$L$)L$)L$ T L$ÃL$ $L$L$ǎ)L$ώ)L$ ' L$ÃL$ $L$L$؎)L$)L$ L$KÃL$ $L$L$)L$)L$ L$ÃL$ $L$L$)L$)L$ b L$ÃL$ $L$L$)L$)L$ L$ÃL$ $L$L$()L$0)L$ L$sÃL$ $L$L$9)L$A)L$  L$=ÃL$ $L$L$J)L$R)L$ L$ÃL$ $L$L$[)L$f)L$ 5 L$ÃL$ $L$L$r)L$)L$ Y L$ÃL$ $L$L$)L$)L$ L$eÃL$ $L$ L$)L$)L$ )L$L$ÃL$ $L$ L$)L$Ə)L$ Ώ)L$9L$jÃL$ $L$ L$׏)L$)L$ )L$oL$+ÃL$ $L$ L$)L$)L$ )L$L$ÃL$ $L$ L$)L$ )L$ +)L$L$ÃL$ $L$ L$7)L$@)L$ H)L$L$nÃL$ $L$ L$Q)L$Z)L$ b)L$L$/ÃL$ $L$ L$k)L$t)L$ |)L$L$ÃL$ $L$ L$)L$)L$ )L$GL$ÃL$ $L$ L$)L$)L$ )L$L$rÃL$ $L$ L$)L$ǐ)L$ Ԑ)L$}L$3ÃL$ $L$ L$)L$)L$ )L$L$ÃUu#) $kƒUu ËL$ $T$D$u* ` $ u pù $L$$L$,T$u t É$B@$D$D$D$l$\$‰D$ MEu Á(=+u t É$B@$T$ÉD$ tQuF\$ u} Ã~1^$)D$É$B@Ћ\$ 랉,$E@ЋT$:$C@Ћl$T$ L$ $L$L$e} ÃD$@=$tD$@=$LD$@=$ukL$ $L$L$D$|$LL$ t*L$ tD$ ËD$$D$@@D$$D$@@D$@=$uxL$ $L$L$FƒD$YL$ t3L$ t |ډЃ ËD$$D$@@ЋT$ڋD$$D$@@ЋT$봋L$ t+L$ t  ËD$$D$@@D$$D$@@L$ $L$L$D$L$ tWL$ t5L$t Ã} Ã~1D$$D$@@붋D$$D$@@딋D$D$P^u#1) $gƒP^u ËL$ $T$wƒ ` $u a\Uu#=) $gƒ\Uu ËL$ $T$ ƒu* ` $蕤u ÉT$$D$D$Q\$‰D$ u ËB@T%u6 t ^$E)D$É$B@Ӊ$`T$ÉD$ t7} W$f)D$褡Ã~ 1$B@Ћ\$ 븉$C@ЋT$5HSu ) $fƒHSu1ËL$ $T$u; ` $*u1蓦^$)D$1ÉD$$D$D$T$D$ tD$ É$B@PZu ) $UeƒPZu1ËL$ $T$GÃXZu Ñ) $eƒXZu1ËL$ $T$à x^u ͑) $dƒx^u1 ËL$ $T$T$t$ x^L$ É$Y$Ց)L$ ÃdZu ) $WdƒdZu1ËL$ $T$4T$ t$ dZL$.É$!ÃTZu ) $cƒTZu1ËL$ $T$Ã\Zu ) $cƒ\Zu1ËL$ $T$Ã`Zu ) $jcƒ`Zu1ËL$ $T$\à L$ $L$L$-L$' à T$$D$,=-u/$L$(L$&)L$.)L$ EL$8 É$7)L$D$u1 ù $L$(L$L$,L$?T$u t1 É$B@$D$D$D$ \$T$D$ t tD$ É$C@$B@Ћ\$у L$ $L$L$-L$ Ã$T$(D$0=-u8$L$,L$?)L$H)L$ P)L$FL$$É$Y)L$lD$ u> ` $՞u1$>L$( $L$,L$L$0L$?$ù $L$,L$L$0L$ۉT$ u t1$É$B@$D$D$D$? \$T$ D$ t tD$$É$C@$B@Ћ\$у b)D$i)D$p)D$ w)D$~)D$)D$ $襤(Zu 1ۃ}2\$L $K`(Z\$<u C|1 Ã-(ZT$uP-(ZT$}1ËB@$T$$ L$L$u3?t ` $u1d(=+ù $L$ L$T$u t1É$B@$D$D$D$\$T$D$ t tD$ É$C@$B@Ћ\$щ$T$$ L$D$@=$u4L$ $L$L$L$L$=(=+tЃteD$@=$u;L$ $L$L$T$ .L$J=(=+tЃt(=+(=+É$B@$B@뎃<[u ) $^ƒ<[u1Ã=_u$) $]<[_u1ËL$ $T$oD$$D$D$\$‰D$ trtKB@T%t B@puC^$)D$B@ D$T$ t1҉ЃÉ$B@B@p=tމ$C@ЋT$ z ` $@u1詝L$ $ _L$}ƒu^$ђ)D$1tL$ $É$B@\u ) $j\ƒ\u1ËL$ $T$toD$$D$D$eT$ÉD$ t/t؃Ë ,` $Et 贜11É$B@Ћ\$ ^$)D$1ÃL$ $)L$iƒD$uaD$ D$ ` $Șu11L$II $ٻD$ `$)D$D$ D$1Ë YA A ;U~@) $T$uG$L$$L$L$(L$lT$D$YH tD$É$B@D$؃ l$\$UB Up6J `BD$L$Juhj u\ZӉT$\$CtV)$E\$T$C 8_ 8_IKC8_XЃ E듹p6 $?Gl$\$ƒZ1 ÃYu ) $YƒYu1ËL$ I $T$Ãl$ l$]1ҋCT%t<u\$$ \$}1É$L$$L$l$ ƒt?JITt*Bt$l$ML$ЃЃ1ۋL$I $L$$L$Ã(D$) $L$4L$Fu1(ËL$0 $ϔ)L$L$L$ L$$L$L$ L$L$L$襐u1(ËL$$ $ ^u $ޔ)D$n1(ËD$ =-uD$ |$ u|$t L$$ $L$ L$L$L$@(É $)D$1(ÃT$ ӃCC KHBt $qHT$ J B uZBu/=`} UJ U`É$wEJ uŋB$B@@ЋT$ 뮋J uB $B @@ЋT$ 냋B$B@@ЋT$ a L$I $L$IL$нT$\$t ËB K 9u1 ËB tC tJ $K L$荽 ËJ S 9s ø4L$8A D$0QAD$(D$*)D$,)D$$.)L$ƒD$$ ` $^u14ǖ|$(D$ |$0u{@) $L$L$L$L$hD$|$$u1|$ uD$4ËL$ uD$ $D$ @@֋L$$ u‹D$$$D$$@@뭋L$0 $cƒt@@T%u v$B@fW) $L$L$L$L$щT$L$ 蠫T$D$ '$B@L$( $7)L$ƒD$ u# ` $u14e@@T%u# t D$ $B@ЃD$k@@T%u# t D$$2$B@ЃD$ T$B uX- $3L$u ËL$I $u ËD$1ȉuȃ ËJ $먃 T$Bt!J $L$L$D$ЋT$t ËB t!J $L$L$D$ЋT$t ËBtJ $L$L$D$Ѓt 1 ÃD$$r)D$(T$uÉ$t)L$Ãu 袓Ë@@T%t4D$$؉\$ D$D$D$\$ L$T$ @ tÉ$C@T$uD$$})D$j'É$)L$uD$HL$ $D$D$D$D$T$ u u$B@4$<$8Y A$,A$8$0$w$0$<|Z $0*1Ƀ$,$$$D$D$;$0$D$$D$D$$8 $ZD$ $8 $D$^$)D$D$ D$D$D$ $$D$D$$D$$0u)D$蕓14ø)$8 $$<T$$@L$ $<$( t$(4É$B@$$,L$$<14É$qv$$A $u$0$$ƃu 14P 19}$<h uhC9|E\$T$B tЃËBtuJ $L$L$\$É$JL$\$T$}1ÃuЃà U`D$t"A U $N= U `uދD$ à ty3 $M<-8_T$Ãu1 ÉPuMډ\$T$Bto/$t-8_\$T$B*MJBU؃ 믃L$ A=ty3to/$D$1ËAuAËA L$\$A=ty3tp/$$D$螐 ËQu$Yu1 u$B@؃\$ ڃBB JHCu $;ËK uC$C@@Ћ\$ у T$=P W $&p/L$L$T$} ËD$@uBu1 ø ËBu  ËL$I $JL$ 1렃T$BuLp/ $T$iù`p/ $T$JII L$JL$ @à T$BtJ $L$L$D$Ѓt 1 ÃL$ AtQA t1É$B@L$ AuW$p/D$G1ËAAÃL$ t A=X!$tW$D$D$ 1ËAtܸÃ\$ T$t#t$T$ju 19u 1|$uW$:6D$荆1Ë h!$ $̜D$L$ $X!$L$áu1ËL$HL$H @L$Hà D$t HX!$t1 ËHtP $T$T$ tڸՃ D$D$$ ;6L$u1 ËL$ $L$I L$uW$E;6D$藅1 ËD$@ à D$D$$u;6L$5u1 ËD$@ à D$D$$;6L$u1 ËD$@ à D$D$$;6L$u1 ËD$@ à D$|$u W$#<6D$˄ ÉD$$Q<6L$xu ËD$L$H1 à D$D$$<6L$=u ËD$L$H 1 à D$D$$<6L$u ËD$L$H1 à D$D$$<6L$u ËD$L$H1 Ã(D$$D$ L$, $@=1u1(ÉD$$D$,D$T$T$$\$\$$.L$o\$$T$D$tAL$|$0$ƒT$$u6u|$t D$$uD$ ( u܉$B@ϋ\$f$L$,L$T$$t BD$ 뛋`$g=6D$D$,D$8T$$s$ƒD$$S4_$9=6D$D$D$T$$+$T$T$$D$ t T$ $B@D$t $ T$ZT$ Bt $BЋT$ $à \$$C t)=6k =6 $T$l$T$ \$ ú=6=6øÃT$B=$1uABtW$<9<D$_1ËD$JɉËB@T%B@T%$u^$U9<D$芈1ÉD$$\\$‰D$ t9|}D$ËW$9<D$虀1É$C@ЋT$ 붉$몃T$ |$t @Y$9<D$QËJtBL$Bø`T$ |$t @Y$9<D$ËJtBL$Bø`L$t ȋL$IÃT$ |$t @Y$9<D$ËJtBL$Bø` l$(T$$u B 1 ËJt>B,$T$D$JL$ D$L$,L$|D$$@ ȃ ø`뾋D$H Ã\$CPPt9Bt1$L$L$D$BЃ} ËD$@Ë^$ :<D$C@ D$4ÃD$ @ ~^$8:<D$l~1øà V# $L$L$D$ Ã|$}@Y$l:<D$~1ùV# $譙\$ƒD$u1Ãu&@D$ ZL$ JB ЃÉ@D$ $kl$\$T$BBu t dÉ$B@t B둋B$l$\$\$T$ڋD$@ËT$JtBø`T$BD$B9D$u1É$z\$L$T$u Éȁ9}KBK $T$T$l$\$u莂ÉCkL$KC19}SC1ÉL$D$ Ь1ЉT$D$ٛw% }ȉȉdBWD$D$PD$$ $L$HL$$ $L$L$D$PD$}6蚁|$Pt D$H$K|$t D$$8D$Ā$D$MD$|$tD$@$D$HD$D$PD$L$IT$P $D$D$D$D$kj^$:<D$$@@ D$$@@ D$ 葂,D$@ÃLL$T $L$L$T$P}5^$:<D$D$T@@ D$B@ D$ 51LËjl$H\$}D$$FLËB9}DZBJJ $D$D$D$D$oD$$őD$PLÉ$\$l$HT$P}D$$薑1LÃL$$}1ɋD$ h݉l$L$$t ؙ9$\$\$xL$T$D$|$tuD$Ãu#D$@$D$ @D$L$"1;L$$}ȉL$ L$I $D$ @D$T$mT$L$ A~Ã|$ \$}1kl$|$ t 9C9}usCKu%C$CD$t$t\$؃ù9}L$ K $CD$l$|$ L$ l$\$Aȉ$t$t$3|$ t$l$\$p1~Ã\$ L$}C|C9}S  $菹Ë^$:<D$w1Ã[1 ù $DD$u1 ËL$( $L$,L$L$4L$L$8L$ L$L$}W$D$L$A $D$yL$AL$( $L$,L$^T$BЃ ËL$( $D$D$=\$T$0l$C SD$8ŋT$(  $L$,)L$L$A}ZT$t t1 É$B@Ѓ ÃT$,D$ I $iO\$$t$(D$ |$ u11D$,L$,~/9}#% ;999}#% ;9taډ  $)L$ Ãu(L$ t1ËD$ $D$ @@|$ }'D$ @ L$D$D$ L$HD$ ËL$ $D$D$RT$t u$B@t u$B@EE9}#% ;  $l$)L$\$$t$(l$ǃ|$ }D$ @ L$8D$SL$ $D$D$RT$\$$t$(l$t $B@ u$B@Ћ\$$t$(l$EEAT$0D$  $M|$(D$ |$ u119}D$0L$09aT$$  $)L$Ãu(L$ t1ËD$ $D$ @@|$ }'D$ @ L$D$D$ L$HD$ ËL$ $D$D$PT$t u$B@t u$B@9L$$ :D$,T$$  $l$)L$|$(Ã|$ } D$ @ L$D$l$EL$ $D$D$P|$(T$t $B@ u$B@Ћ|$(E5A30L$DT$HD$ uW$=<D$U10Ãu/L$4 $L$8L$L$Vù`\$ StK $KL$Vù`\$ StK $KL$Wù`\$ StK $KL$Wù`\$ StK $KL$Xù`\$ StK $KL$Xù`$L$IL$\$u1ÉD$ Ht0@$KtCD$CD$YD$ ø``̃$L$IL$p\$u1ÉD$ Ht0@$KtCD$CD$#YD$ ø``̃$L$IL$\$u1ÉD$ Ht0@$KtCD$CD$+YD$ ø``̃$L$IL$\$u1ÉD$ Ht0@$KtCD$CD$kYD$ ø``̃$L$IL$,\$u1ÉD$ Ht0@$KtCD$CD$YD$ ø``̃(D$ L$0 $=<L$L$ L$A=WT$,u1(1ۉދJBJȉD$$JlB;l$$sJE |$ ~/1t$ L$ )ˁv<$=<D$fG1(E;l$$r=v<$><D$=G1($ىL$T$,ǃu1(1Ht~GŋJtjB;\$$s< u:|$ ~&1t$ L$ )ΉItE IuC;\$$rĉ(FE  t u1ָ`뒸`{CE t E  1ہ<$=<D$HF1(ø``kl$T$\$}1}1҃u $l$щT$SщL$t$l$Ãt4\$ KC$D$ D$t$Yt$l$\$ \$ StyK$MtaED$ED$l$\$ t4St2KT$RыT$ $D$ D$l$\$ ؃ù`ʸ`뛹`냸`IC=V#StK $KL$ù`D$ L$ $%><L$L$L$L$L$ \$u1ËC;D$| C=V#t*$D$KT$)ʉT$L$L$ *ËStK $KL$ù`D$ L$ $/><L$L$L$L$L$ X\$u1ËC;D$| C=V#t*$KT$)ʉT$D$L$L$ ËStK $KL$cù` D$ L$( $9><L$L$L$L$L$ \$$u1 ËC;D$| C=V#tDCL$)ʉȁ#L$ȉ$D$)L$L$L$ ËStK $KL$ ù` L$( $D><L$L$L$\$$u1 ËC;D$|TC=V#u%StK $KL$D ù`StK $KL$ ù`CT$)‰$T$T$D$0L$ |$ƃu1 ËHt*F+t/-t  /M/0`҃\D$ D$L>< $L$dL$L$XL$L$ L$ L$L$u \ËL$X $L$$L$p\$`} \Ã|$h~YStJK $KL$L$$L$L$,L$ L$ L$L$L$D$D$$$XD$\ù`벋St8K $KL$L$$L$L$,L$ L$ L$L$L$D$륹`ăL$ $L$L$L$u1É$衂Ã`T$dJ-BD$XD$TD$Pd>< $L$hL$L$\L$L$TL$ L$PL$Yu1`ËL$\ $L$L$ L$d}1`ËA9D$PAD$P|$T}AD$T|$T}D$TT$X\$T  $L$P+L$TL$L$L$L$$L$ L$D$L$ $蟁D$D$$WD$`Ã|$PxAD$P|$PfD$PY`L$ $L$L$L$Du1ÃuW$j><D$>1É$ÃL$ $L$L$L$u1É$ǀÃL$ $L$L$L$u1ÃuW$><D$f>1É$nÃPL$X $ WL$Mol$TÃD$Luo>l$T\$Lud|?}7Ut(M $\$ML$t P1`ԋW$><D$=PACL$X $L$L$薾\$T} PËStNK $KL$L$L$L$ L$ D$D$D$$T|$| P1`뮃LT$PBD$HD$ JBD$DL$T $L$L$\$HT$\L$X} L9ڃ} ك}1Ƀ|$`}[D$9~D$$9TD$ LÉ);D$|T$D  $L$L$L$L$u D$ 1);D$|9+D$9~+L$룃gڃ\1U`(D$$D$ >< $L$0L$L$L$L$$L$ L$ L$u1(ËD$@@T%1ۋD$@9}hL$, $ډ\$\$ I L$L$$L$L$ L$ L$A\$u1(Ãt(4(4(CD$@9|""(ËL$, $L$L$L$$L$L$ L$ L$u1(É$g>(Ã(D$$D$ >< $L$0L$L$L$L$$L$ L$ L$u1(ËD$@@T%1ۋD$@9}hL$, $ډ\$\$ I L$L$$L$L$ L$ L$\$u1(Ãt(4(4(CD$@9|""(ËL$, $L$L$L$$L$L$ L$ L$u1(É$<=(Á$$DŽ$DŽ$$ $><L$L$L$ $L$$L$\6u 1ĬË$=-cDŽ$DŽ$$*$ $L$L$}$t D$L$yP1ĬË$@$$D$$$u:$t D$L$(P$t D$$P$ĬË$ $$ʼn$JNBƃ|$ u$$1ҁ}%B|1;\$ }'L$ %$C;\$ |ً$O|:FۃtE%9tO}ƃ$$$+$D$%1ہM$ %C׋$OnF ɉE$ ո`D$D$ $ $L$LL$跷} 1ĬÁ|$Tt,W$><D$6D$L$N1ĬËD$L$H\$ StK $KL$ù`\$D$T$ D$ $L$$L$L$ )ىL$L$Ãt AL$;L$(|ȃCƃ,\$<|$85WD$0HA9}ىÙ9ȉL$t4$><D$51,Él$ }4$?<D$51,$D$3\$0ƒu1,ËKCD$(T$ JBD$$$D$4D$D$8D$N\$8T$$L$1ɉL$;L$}ABL$(D$( T$$$D$4D$\$ L$\$8T$$AL$;L$|$D$(D$D$ )ȉD$D$ ,ø`]`<4T$8ZJBD$0$\$\$L$@L$ $D$D$胤T$ }BL$( t t1,É$B@D$($D$(@@ЋT$ ˋJt BD$`$B@Ћ\$aL$( L$ $L$L$\$0T$ } t1,É$B@$KL$KL$T$ תT$ u t1,É$B@ t--,É$B@D$($D$(@@G`B@P@$KL$KL$T$ ?u1,--,ÃD$D$@D$ L$ $@<L$L$L$C ^T$u1Ã|$ u $@<D$1Ã|$}BD$|$B9D$$\$u1ËKT$ D$KT$ $KT$ @D$D$ +D$D$'L$ $L$ IL$}1ËL$ɉ $`É $2@<D$1ÃD$@D$ L$ $L$L$Ft$l$ u119}N ;D$\$9uW$I@<D$1É4$l$\$u1ËM $M @D$D$ )؉D$.L$ $L$ IL$}1--CS1;l$}/L$ $T$l$  L$L$ L$訹l$ uEƒl$M|/L$ $T$l$  L$L$ L$cl$ u@Mƒ`-D$DL$h $f@<L$L$DL$u1`ËD$D=-o@<D$dpD$d@t$L4$D$TD$\$H\$T$PT$ T$TʼnD$\9uAD$XD$D=-tD$$y4l$\T$dR  $L$X)L$臞`ËL$L $T$L$HL$L$PL$ l$\D$X뙋L$D $L$L$w}1`Ë\$T$)`-D$DL$h $v@<L$L$DL$u1`ËD$D=-u{@<D$dhD$d@,$D$TD$\$T$ ʼnD$\D$TD$XD$D=-tD$$i3l$\T$dR  $L$X)L$w`ËL$D $L$L$葜}1`Ë\$T$c`-D$DL$h $@<L$L$DL$u1`ËD$D=-uu@<D$dpD$d@D$\4$D$\$T$ =D$XD$D=-t D$$2T$dR\$\  $L$X+L$\L$藜`ËL$D $L$L$豛}1`Ë\$T$i D$D$L$( $L$,L$@<L$)L$ L$L$L$L$ u1 Ã|$u vD$L$$ $L$L$L$L$ ÃL$I $ \Ã1L$TL$D)ƒut ËD$ ÉT$$D$IT$ÉD$ u< ^ $:u ` $'t D$ øÉ$T$t.$=T$D$ tD$ É$B@D$ ؉$B@Ћ\$fÃ\$T$Ch8t EC@4t>B@0tB@T%u8C@4@ tN1 $T$ù{1 $\$ËB@0t$ ^L$(ƒD$uT$uL$ $T$k61É$T$EЃÃt$ \$T$tuxÃtCh8t EC@4tCB@0tB@T%uBC@4@t1$T$øװ1$\$ËB@0t$ ^L$'ƒD$ uT$ uL$ $T$L$ L$6øÉ$T$t$EЃÃ\$T$Ch8t EC@4tCB@0tB@T%uBC@4@t1$T$ø51$\$ËB@0t$ ^L$&ƒD$ uT$ uL$ $T$i6øÉ$T$D$EЃdÃT$|$tUtP$ku ËL$ $D$ D$T$ D$ tD$É$B@Ã\$t|$ uÃ|$$tCPPtB u ^$d1D$ËBt؉$D$T$BЃt ^$1D$SËL$ $D$L$L$D$@ Љƒ} ËD$ L$D$$1à \$CPPtu1 ËBt$D$BЃuݸ Ã\$t|$ uÃ|$$tCPPtu ^$1D$nËBt؉$D$T$BЃt ^$ѱ1D$-ËL$ $D$L$L$D$Љƒ} ËD$ L$D$$1Ã\$t|$ uÃ|$$tCPPtBu ^$1D$ËBt؉$D$T$BЃt ^$1D$LËL$ $D$L$L$D$@Љƒ} ËD$ L$D$$1à T$B@PtB@T% u*^$D1D$B@ D$S ËB@P@tȉ$L$L$L$L$B@P@Ѓ à \$Cu  ËC uCu  1s Cu K tK 9t1 ø1C9}3C8u  ËC 9t1 EC9|͸ à t$Fu  ËF u  Ën Fu N tN 9t1 ø^K|1F8u  ËF 9t1 K}ϸ ÃL$ \$C$t1Cu $@Fu $Au+$uT$$bu1ø1Ã|$l$ u1ۋE9}+E ƋE$t E$}CE9|ՉËE$6l$ 1;\$}T$H9} ÉCփl$ \$K|T$H9} ÉK׃$T$,B9D$0~BD$0$L$4L$T$,t D$($D$D$0D$1$ËJ $c=\$,Ńuq$1ҋC9}BC9|D$4FD$D$(D$S T$D$0|$IL$taC$l$l$CD$D$ЋL$, $L$L$DD$$L$D$,@ D$'L$l$\$,C D$듉,$<1$øD$]$T$(B9D$0~BD$0$L$4L$TT$(t $D$,D$D$0D$諈1$ËJ $<\$(Ńu%$1ҋC9}BC9|D$4FD$D$,D$S T$D$0|$IL$t_C$l$l$CD$D$ЋL$( $L$L$$D$D$D$(@ D$݇L$l$\$(C D$땉,$;1$øD$_$$B@PtB@T% u#^$o1D$1ĈËB@P@tϋA@PtċA@T% tA@P@t$L$TL$L$t ĈË$ $L$ L$L$tD$T$*ĈËD$\;D$(};^$1D$fD$T$D$ $ĈÍL$T $CL$tWL$ $CL$t=D$T$D$ D$D$(D$'D$T$}D$ $q1ĈÍL$T $FL$wtL$ $FL$]uL$4 $C9Ńu)UD$T$ D$ $Ĉ1;T$4}B;T$4|1;\$4}T$< C;\$4|IL$tlD$4$l$l$D$\$$1L$ `L$u8.^$1D$D$4@@ D$QzD$$L$8L$D$ 5T$D$( B$B@2A@T%t D$$^$1D$A@ D$T$t JI0u1ËJI0IHuJI0IPt܃ l$,11ۋD$$@@0tD$$@@TD$(@L$$I9tD$(@@0-t$ta\$t'L$(I $L$$IL$t$L$$ $L$(L$֋\$=(=+tЃ `t-L$$ $L$(L$Ӊ=(=+tЃ D$$@@Tt!D$(@@Tt(=+(=+ ÍL$$ $L$(L$!}1 Ãu͋D$$@@0tmT$,taL$$ $L$(L$ЉD$L$$ t*L$( tD$ ËD$($D$(@@D$$$D$$@@L$$ t)L$( 3D$($D$(@@D$$$D$$@@‰$B@$B@Ћ\$L$$ $L$(L$D$Ћt$=(=+tЃ t D$$B@Ћt$D$(@@TL$(II0 91L$$II04 f^$1D$D$ D$D$@@ D$ D$@@ D$1ÃL$ $L$L$L$L$=(=+u6t L$ $L$L$L$ L$oÉ$B@ӃÃDD$4D$01D$H@P0D$L@X0tD$H@@TD$L@L$HI9t |$0tml$,t#L$LI $L$HIL$`NL$H $L$LL$L$PL$D$0Ћl$,=(=+tЃDÉD$4tAL$H $L$LL$L$PL$l$,Ջl$,=(=+tЃDÉD$4D$P@P0tD$P@@TD$H@@TtD$L@@TL$H $L$LL$D$|$|$|D$4DËD$P=-u9^$21D$D$H@@ D$D$L@@ D$ H1DË^$u1D$D$H@@ D$D$L@@ D$ D$P@@ D$뷋D$P=-D$H@@0L$HII0T$T thL$H $L$LL$L$PL$ЉD$4L$H t)L$L D$L$D$L@@D$H$D$H@@D$D$롋D$HD$$D$PD$ L$$ $L$ L$CD$|$nD$LD$D$ D$L$ $L$L$D$|$tKL$$ t)L$ !D$ $D$ @@ D$$$D$$@@‹D$$@@0L$$II0T$T thL$$ $L$L$L$L$ЉD$4L$ t)L$ QD$$D$@@9D$$D$@@D$D$롋D$P=-dD$P@@TIыT$T ;T$0tV9tRL$H $L$LL$L$PL$҉=(=+tЃDÉD$4$B@1몉$B@Ћl$,M$B@Ћl$,L$H $L$LL$L$PL$D$,Љ=(=+tЃDt D$,p$B@D$L@@TT$T,;l$0 1ыT$T D$0L$ $L$L$@L$1L$ ÃL$ $L$L$<L$1L$ ÃL$ $L$L$8L$1L$ ÃL$ $L$L$0L$1L$ ÃL$ $L$L$4L$´1L$ RÃL$ $L$L$L$Ŵ1L$ %ÃL$ $L$L$ L$Ǵ1L$ ÃL$ $L$L$L$ɴ1L$ ÃL$ $L$L$D$l$=(=+u;EX4\$ tBtCu!,$L$L$Ҵ1L$‰ЃÉ,$L$L$CЃÉ$B@Ћl$\$ 멃 T$B@0tB@T%uԴ1 $T$ ËB@0tډ$ WL$ ƒD$uT$uL$ $T$D$Ѓ 1 ÃL$ $L$ L$L$u|$t$ =(=+uNGh4l$FX4\$ tetEuAtCu<$t$1L$‰ЃËK $t$|$ËM $|$t$É$B@Ћ|$t$ l$\$ {L$ $L$L$L$ 1L$ ÃL$ $L$L$L$ 1L$ zÃL$ $L$L$L$1L$ MÃL$ $L$L$L$ L$L$ 1L$zÃ\$CP0tC@Tu$L$ L$L$(L$ÉыT$$ t։$L$ L$Ћ\$=(=+tЃu$B@Ћ\$뜃L$ $L$L$L$ L$L$$L$ U=(=+u6t L$ $L$L$L$(L$É$B@ӃÃL$ $L$L$L$@L$ 1L$dÃL$ $L$L$L$<L$ 1L$.ÃL$ $L$L$|L$8L$ #1L$ÃL$ $L$L$tL$0L$ &1L$ÃL$ $L$L$xL$4L$ *1L$ÃL$ $L$L$`L$L$ .1L$VÃL$ $L$L$hL$ L$ 11L$ ÃL$ $L$L$L$L$ 41L$ÃL$ $L$L$L$L$ 81L$ÃL$ $L$$L$\L$D$ l$ =(=+udEX4\$ tWt11ҋE@TtS uSt,$L$$L$҃É,$L$$L$;1L$e‰ЃÉ$B@Ћl$ \$딃 L$$ $L$(L$dL$L$ Ol$$=(=+1ۉ\$Ex4|$D$(@p4t$ tWE@Tt_$u_t$l$L$(L$ É,$L$(L$>1L$‰Ѓ ÃtڋFtҋN $L$(L$l$v É$B@Ћ|$t$l$$\$\L$ $L$L$lL$L$ A1L$Ãl$\$ T$B@Tt B@0u&$l$\$L$ H1L$eËB@0@pt̉$l$\$pL$ D1L$1à \$u ËCP0tBuL1 $\$P É$BЃ à \$u \ ËCP0tB us1 $\$ É$B Ѓ à \$u  ËCP0tB,u1 $\$ É$B,Ѓ à \$u ËCP0tB$u1 $\$u É$B$Ѓ ÃL$ $L$L$ L$8ÃD$ u1ËL$T$ 9D$t7W$1D$5T$ t1É$B@؃ÃT$D$ u ËB@T%B@T%B@0tB@T%u+^$61D$B@ D$'L$ ȃËB@0tĉ$B@0ЉtыA@T%uA@T%u^$1D$L$ A@ D$T$ t1É$B@ЃÃL$ $u ÉD$ $D$|$u!t$ WL$u*L$ tD$ËD$ $D$ @@L$ u%L$ $L} D$D$룉 $h1D$D$@@ D$낃YT$u$1 $ȒT$ÃYu1ÃB@T%B@T%$\$T$ÃD$ u^$T$B=$uCBH^$D$D$L$T$ t1É$B@BH tk$D$D$%;\$ ‰D$ t/t$B@T%uB@T%NЃÉ$C@ЋT$$B@Ћ\$ 넃 -HTT$$u$1 $cT$$ŃHTu1 Ãu z ËB=1uЃ ËBX0t CH1B@T%tJ $ É$l$tSD$$D$D$:T$D$ tL$ $Ѷ1L$ É$B@QT$$B@T%tу $JL$ ËB@T%tJ $JL$ L$ É$L$L$L$L$huL$ $L$L$ ù1 $L$$L$ É$CHЉteA@T%uUA@T%uE^$1D$L$ A@ D$]T$ t1 É$B@ȃ ÃL$ $L$L$ L$kgÃD$ u1ËL$T$ 9D$t7W$91D$ET$ t1É$B@؃Ã(-PT\$,u$Z1 $̎\$,ŃPTu1(Ãu (ËCP0t BLxC@T%t $@(É$l$D$ $D$D$7T$ D$ t_L$ $1L$6ƒtB@T%uЃ(ËBD$ tL$ $?(É$B@$B@T$,B@T%tу $JL$/(ËB@T%tJ $JL$ L$m(É$L$L$L$L$uL$ $L$L$(ù1 $L$,L$'(É$BLЉƒu1(Ë@@T%t-BD$ tL$ $>(É$B@B@T%uE^$d1D$T$B@ D$^T$ t1(É$B@Ѓ(ÃT$u ËBX0tCPuJB=@M-t1J $@M-L$T$u$D$bB$aÉ$CPЉƒtlB=@M-tbT$ J $@M-L$`T$ uA^$1D$B@ D$kT$ t1É$B@ЃÃD$L$ $\$ ƒu1Ë@@T%tOT$$\$D$L$ \D$L$ tD$ËD$$D$@@T$B@T%t$\$L$"D$맋W$!1D$뎃T$ u1ËB=$u$H1L$ËB@T% t1ËJI4tJI4I u1ø \$uc ËCP4tuT1$\$ É$Ѓ ÃL$ $Ãl$\$CP4tBux$tL$ $uy1 $L$L$ËL$ $L$L$D$=(=+tЃu$B@릉$l$BЃSÃ\$u >ËCP4t B$:t^L$ $u1ËL$ $D$D$L$\$‰D$ t=(=+tЃ t1 $L$L$vÉ$B@ډ$C@ЋT$ 벉$L$ L$BЃÃl$ \$CP4tC@Tt B$9tL$ $(u1 $L$L$ËL$ $L$ L$\L$D$ =(=+tЃu$B@띉$l$BЃËB R$l$B ЃpÃl$$\$ u WËCP4tC@Tt B$<tgL$$ $u1ËL$ $D$D$dL$L$ \$‰D$ t=(=+tЃ t1 $L$ L$oÉ$B@ډ$C@ЋT$벉$l$BЃËB$($l$B$ЃÃl$\$u 9ËCP4tB u 1 $\$Ã}+t$$T$ Ћl$\$T$ }1ʼn$l$B ЃÃt$$l$(\$ u ËCP4t BCH8t L$Au31 $\$DÉ4$l$Ӈu1ËL$ $D$ D$D$@ЋT$ D$ tD$É$B@||$t$l$BЃËt$T$Ћt$$l$(\$ T$}1Ã}΃}뭃l$\$uËCP4tBuR1$\$LÃ}.t'$T$Ћl$\$T$} ʼn$l$L$ L$BЃÃl$\$uËCP4tBu1$\$Ã}.t'$T$Ћl$\$T$} ʼn$l$D$BЃà t$(l$,\$$uv ËCP4t BCH8t L$Au1$\$ É4$l$苅u ËL$$ $D$D$L$0L$D$@ЋT$D$ tD$ É$B@|!|$t$l$L$0L$ BЃ Ët݉$T$Ћt$(l$,\$$T$} Ã}΃}뢃t$ l$$\$uDËCP4tBu1$\$Ã|!|$t$l$D$ BЃËt݉$T$Ћt$ l$$\$T$} Ã}΃}뢃 T$$D$u ËB=W.uЃ ËB@T%t $ É$D$u1 ËL$$ $ L$#uQ|$u(L$ t1 ËD$$D$@@L$ uˋD$$D$@@붉D$$薥D$|$tD$L$ $T$ÃD$ u[޻T$c;T$}L$ $T$?DL$ tD$ ËD$$D$@@D$9|pу 9}&T$ $B@L$ $T$T$躷\$ t $C@L$T$X D$|$u 覿$u1ÉD$ $L$L$\$ ƒu t1É$C@t؃É$B@Ћ\$ T$u  ËB=$txB=W.tn$\u/ ^ $t^$D$D$͹1 ÉD$$ T$D$ tD$ É$B@Ѓ à T$$|$($D$|$u1$D$$D$! 1D$D$L$ $\u\it2D$L$ tD$ ËD$$D$@@|$,uϋW$u1D$̸뮋L$( $D$ D$L$T$ ÉD$ q~D$,tdt8t&|$,3|$uD$D$D$.|$#W$X1D$ |$uW$;1D$D$w$B@Ћ\$B׼ à L$ $L$L$L$ Ãl$\$C@TtCP4tBu$l$L$É$l$BЃÃL$ $L$L$à L$ $L$L$L$ ÃT$ t B=$tDt JI8u1ËJI8ItJI4tJI4IuӸΉ$1L$à \$u薻 ËCP8tu1$\$= É$Ѓ ÃL$ $ÃT$u 2É$Qu1ËL$ $D$ D$pT$ D$ tD$É$B@T$uкÉ$u ËL$ $D$D$L$ L$T$D$ tD$ É$B@ L$ $L$L$ƒtt  É$B@蹺1 à L$ $L$L$yƒtt  É$B@q1 à L$ $L$L$D$" ÃT$B@@D$ YA A ;U~˺1 $(T$uX$L$L$L$ L$D$ЉD$ YH |$ u 芴tD$ Ë@Y$1D$1Ë^$1D$B@ D$莻1ÃT$u1ËB@T%u7 $荝\$ƒu t1É$C@X L$ $T$T$D$T$D$ tD$É$B@\$|$u EÃtu"$‹L$ $T$#ÍD$$D$>؃\$|$u Ãtu"$藜‹L$ $T$ÍD$$D$؃\$T$ D$$T$u`$D$ D$T1ÉD$ $7\$$u<51$D$ D$T$ uD$ u$B@tu($豛‹L$ $T$T$ D$먍D$($D$賶Ã\$T$ D$$T$u`$D$ D$_1ÉD$ $B\$$u<`1$D$ D$T$ uD$ u$B@tu($輚‹L$ $T$T$ D$먍D$($D$&辵Ã1ҋL$At BAuT$$W|$ƃt|$1;\$}oh EC\$T$ $T$D$u1ÍD$$$^T$u t1É$B@$D$D$D$\$T$D$ t tD$É$C@$B@Ћ\$蒴Ã|$u ÍD$ $u1ËL$ $D$D$D$T$D$ tD$É$B@ Wu 1 $sƒWu1 ËL$ $T$ƒu ` $tQ1 Ë@@T%u t1 É$B@Ѓ ÃD$D$;D$ u ËL$ $AT$Ńu藮t 1Ë@D$ |$ uMEt1É,$E@|$ u&E D$MEt,$E@d1;L$ }3L$l$ I $L$ L$1L$l$ƒD$t"MEtЃÉ,$E@ЋT$A뢃 L$ $Uƒu&语u^$D$D$L1 t É$B@Tl$\$u+1 $ql$\$ƒTu ËC=4uE=$HC@T%M9U$\$Tl$u|1D$ |$ u,$T$`ƒu D$ ËD$@9tB@T%u uԉ$B@ljT$$L$L$T$D$ ̸|$1L$xu ËL$ $ TL$u\D$ SD$$L$L$"T$D$ *$B@E$\$MD$ l$$D$ @9u ËE@T%1҉T$ YA A ;U~1 $ãl$$T$uLED$1;\$}+\$@ L$ $D$rl$$\$ƒtYH ЃC뽸ËE=4t E=$uL$ $l$kÉ,$1L$TL$5ƒD$D$ YA A ;U~1 $T$ux$L$ L$D$T$ÉD$YH t3t$T$D$ tD$É$B@$B@Ћ\$ tD$É$B@l$$à \$T$C@T%tB@T%B=4u2C=4u(9u u$\$ȃ 1$%1L$u ËL$ $H1L$au ËL$ $L$L$8뜉$\$ Ãl$$E@T%1҉T$ YA A ;U~1 $l$$T$uLED$1;\$}+\$@ L$ $D$l$$\$ƒtYH ЃC뽸ËE=4t E=$uL$ $l$cÉ,$1L$TL$ƒD$D$ YA A ;U~1 $:T$ux$L$ L$D$T$ÉD$YH t3t$ST$D$ tD$É$B@$B@Ћ\$ tD$É$B@3l$$ÃL$ $L$L$ÃL$ $L$L$!Ã\$K1ҋAT%tQlu2$T$t $Kù1 $T$'É$҉tOA@T%t A@puG^$ݼ1D$L$ A@ D$虭T$ t1ɉȃÉ$B@A@p=tރT$ $B@pЉD$|$u uD$Ë ,` $詧tރ=\Wt\WVD$ $dlL$ $L$L$L$ L$ht1ËL$ $ljtD$ $ lÃ=V u0Z$0-D$ ܚ|$ \.t øÃdT$1D$u1ËD$ $hL$$th"$|8D$L$ogh"$hL$ $L$L$L$L$T$ttt '$=\$Ńv +@ u1Av1É$BtAL$誮l$1D$u1Át$ v#W$|8D${L$t$ l$ $t$L$L$\$l$Jډ  $<\$l$$t$ tL$t$ l$N$X1Ãtщ $ԫ4Z;Yu_$|8D$襢1Ã=Vu V?V=Tu 7TYZXD$ T$D$[L$ $eD$L$ $sT$tl$}eD$L$ $RT$tKL$ $T$L$ L$VЉD$D$ $T$ZD$ËL$ $T$L$ L$D$붃L$ $D$L$ L$L$$L$ L$(L$D$?ÃL$ $D$L$ L$L$$L$ L$(L$L$,L$ÃD$4D$L$ $L$$L$L$(L$L$,L$ L$0L$L$L$ÃD$,$D$ D$LL$ $|$(L$l$  _ƒu"۠tL$,1øtk鉈u5=Su,$L$$L$L$(L$L$,L$ L$0L$ÉЋt|1"1F L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$L$D$$$D$D$D$(D$D$D$L$,D$ l$,\$D$+guCD$D$$$D$D$D$(D$C\$D$ l$,\$D$+dthtUit D$D$D$$$D$D$D$(D$C\$D$ -l$,\$HD$D$$$D$D$D$(D$C\$D$ l$,\$$L$, $ :-L$L$L$XEu1$ËL$ $L$L$L$ L$Qu^$:-D$迆1$Ã|$ $D$L$L$L$ AL$ S‹D$ @9uD$D$$$T$T$t1IȉL$$D$D$D$D$D$ @D$ L$ȃ$ø뎃 \$8D$1;l$<D$ itmuuuPD$D$,$D$0D$D$4D$El$D$ ;\$8l$;l$<rD$0 D$Scv- ./tUat D$D$D$,$D$0D$D$4D$El$D$ \$8l$D$,$D$0D$D$4D$El$D$ e\$8l$D$D$,$D$0D$D$4D$El$D$ \$8l$TD$D$,$D$0D$D$4D$El$D$ \$8l$D$D$,$D$0D$D$4D$El$D$ \$8l$lntLpD$ D$,$D$0D$D$4D$El$D$ B\$8l$tD$ D$,$D$0D$D$4D$El$D$ \$8l$1D$D$,$D$0D$D$4D$El$D$ \$8l$xuD$ED$tdouCD$D$,$D$0D$D$4D$El$D$ :\$8l$lD$_D$t.t /tMD$$$ЃD$D$ T$ t1 É$B@^$:-D$FqT$ t É$B@$C@ЋT$\$B@Ћ\$B@Ћ\$Z4$<[=@| W$:-D$p14Í$4 $D$$D$$8L$\$ OL$ $$4L$D$0IL$u 14Í$4@ $L$$L$$9L$L$0L$ )L$4 $L$$L$$4@L$D$ L$4 $D$L$L$4Ã$L$, $:-L$L$L$.u1$ËL$ $L$L$L$ L$ Su^$:-D$}o1$ËD$ 9ʃ@9iD$ @9uD$D$$$T$T$t1IȉL$$D$D$D$D$D$ @D$ L$ȃ$ËL$ $L$ AL$|$ t2$D$L$L$L$ AL$ f S>X$D$ D$n1Ã1 $à 1 $Ã1 $Ã1 $------Ã8D$,c1D$k1D$ u1D$$D$(L$@ $L$DL$|1L$L$L$ L$4L$L$0L$L$,L$T`l$<u 8ËL$4MD$4|$,ub1 $n,l$B tZ B t$BЃÉ$C@ЋT$ ݉$C@ЋT$ 뱃 L$u ËA@T%uD^$1D$A@ D$sT$ t É$B@1 ÃH\$PT$LBuW$1D$k1HÉT$HD$0$T$0ÉD$, iL$@ $L$1HËL$L $ST$L}1HD$0D$B@IB@@:$D$>D$L@PtD$LPPD$L@P 1l$,|$Dt%D$L+L$,HDD$D@9|$<|$@$2D$@|$@|$@uX|$<u/|$Du1HËL$D uD$D$D$D@@؋L$< uċD$<$D$<@@믋L$@ uD$@$D$@@@놋L$@ $L$1ËL$ $ WL$hD$ |$ u ,7uL$ $L$ L$X1Ã0L$8 $lu 0ÉD$$L$L$L$L$ D$ T$} t 0É$B@ D$4$D$D$D$YD$4$D$#D$D$9D$4 $D$'D$D$D$4$D$+D$D$D$4$D$/D$D$10É$B@M(D$$D$,D$D$D$$D$,D$D$D$$D$, D$D$cD$#$D$,D$D$CD$'$D$,D$D$#L$ $L$L$D$ س(Ã\$T$ Ju uBtYK $l1L$u1L$|1L$ JL$ʂƒu  t1É$B@K $ \L$D$ԃ뵃\$T$Ku uCt[J $ ]L$ ,VL$D$ 臃‹D$@<u  t1É$B@J $ \L$D$6‹D$@<뭃HT$L WD$$B2B t $}1D$L31HÉ $1D$53L$P $1L$L$DL$L$$L$ dT$Lu1HËB=`0BTJT $Ã~W$1D$21HËD$DD$L@4uFY$1D$2|$Du1HËL$D uD$D$D$D@@؃|$$RL$D $ ,VL$L$qa|uY$1D$2넋L$D L$L $41L$D$7D$D|$DGL$D $ ,VL$D$` u\L$D $hPW$1D$ȉL$D$9T$ $B@L$L $ L[L$D$ՀƒL$( $L$DL$@lL$( $L$,L$躵OL$LI $ l_L$D$@D$D$ Z\$@‰D$ _ 9D$L$D$\$LCPtSPCP C t$L$(L$r\$L|$8K $1L$1L$L$4L$ N~ƒb@@T%uF^$1D$T$B@ D$R7T$ $B@ 1 $L$0L$T$T$R\$LT$CPCPu $B@K $1L$ 1L$T$ L$L$dI $1L$D$wL$dD$X|$XmA APD$@$D$XD$8R)3L$dIP $1L$L$HL$L$\$D$u1|$ uD$ËL$ uD$ $D$ @@ uƉ$C@빃u!u1 u$C@ u։$B@Ћ\$ ŋL$ I $(AD$ L$ $A1 $D$L$L$ L$=\$T$D$ $B@Ћ\$ WT$B2B t $A1D$!1 É $e1D$!J $1L$D$o à WT$B2B t $1D$d!1 É $1D$M!J $1L$D$o à WT$B2B t $1D$ 1 É $ 1D$ J $/ 1L$D$o à WT$B2B t $8 1D$ 1 É $\ 1D$ J $ 1L$D$n à WT$B2B t $ 1D$/ 1 É $ 1D$ J $ 1L$D$On à WT$B2B t $ 1D$1É $!1D$B=`0BTtyJT $ Ã~W$&!1D$p1ËD$L$I4H5L$ $}1ËL$I $D!1L$D$ymÉ$D$;u1ÉD$ $]T$ ÉD$ tQ1É$B@Ћ\$$(4L$B1Ã$ WT$(B2B t $J!1D$x1$É $n!1D$a$D$zu1$ÉD$ $F\T$ ÉD$ {}1$Ã~--$D$L$( $!1L$D$2lƒD$$D$D$D$D$ #L$(I $!1L$D$kD$ |$t?|$ tM|$ tT$ D$ t$D$$D$D$D$D$D$ $É$B@ϋL$ tR|$u)|$tЋL$ uËD$$D$@@뮋L$ uʋD$$D$@@뵋D$$D$@@$B@$B@Ћ\$q WT$B2B t $!1D$d1É $!1D$MB5B=`0$L$\$ƒu1ËBuS t9CPtSPCP t K4K51É$B@Ћ\$$B@Ћ\$붉ЃÉ$ (`L$D$Dk\$ƒkB@T%WY$!1D$T$B@ D$"T$ t1É$B@ WT$ B2B t $&"1D$1É $J"1D$J $p"1L$pMà WT$ B2B t $u"1D$1É $"1D$J $ ZL$aNà WT$B2B t $"1D$G1 É $"1D$0B u-- ËJ $ (\L$Mu- ` $ts-- 1 Éȃ ÃWL$ A2A t$ #1D$1É$-#1D$A(A(à WT$ B2B t $S#1D$G1É $w#1D$0J $џà T$ WB5B t $#1D$ É $#1D$L$ $ ^L$IƒD$uT$u2 W$#1D$ ËD$P1 ø Ã\$KT$Bv W$7D$=É9sHB?wϋK $щT$ L$f\$uËL$ KC19s1ÉL$D$}< Ь1ЉT$D$}<ٛw% sȉȉ[BN T$(\$$CK $T$L$"\$$‹C$tCT$$ YL$K$L$L$ {T$\$$D$ 6T$u ËB D$T$jC )9~?W$7D$T$u u$B@C l$K9~"$K L$T$l$\$$|C K9~0CK$D$C K)D$l$\$$C K$D$D$D$7\$T$$L$J BJ 9}J J t1 É$C@$B@Ћ\$$h WT$ B $7D$1Bt $ 8D$e1ËJ $JL$_à WT$ B $(8D$"1Bt $N8D$1ËJ $蟛Ã-D$ D$ @W$k8D$1ËL$$ $8L$L$ L$u1ËD$ @tW$8D$k1ËL$ $*0l$ twL$ $ WL$LEl$ ÃD$unl$ \$u:EM )ȉ| 9U M] $\$É˃}11ËD$ =-u뮋^$8D$D$ @@ D$;1Ã,l$4\$0C K9|8 $|,Ës K4CK )9xl$4‹D$ K $KL$K L$t$(t$ T$$T$L$L$‹D$$L$ }T$4D$0P L$( $T$,ËkK ){-D$D$ D$@W$8D$1ËL$ $8L$L$L$u1ËD$@tW$ 8D$I1ËL$ $.tIL$ $ WL$.CD$ |$ u TuL$ $L$ L$W1ËD$=-t׋^$*8D$D$@@ D$R1à WT$B $N8D$1Bt $t8D$l1ËB=$U/uH$L$ƒu1ËBu t1É$B@ЃÉ$ (`L$D$`ƒtB@T%uY$8D$T$ B@ D$WT$ t1É$B@-D$ D$@W$8D$n1ËL$ $8L$L$ L$u1ËD$@tW$8D$1ËL$ $+L$ $ WL$@ƒD$u#T$ug}!W$@8D$T$K1ËD$@9}*L$ $T$T$"T$}1ËD$P$1ËD$ =-u D$P |^$8D$D$ @@ D$1ÃD$D$ @W$X8D$1ËL$$ $~8L$L$L$L$L$ u1ËL$ $ WL$? W\$ ƒD$u W\$ T$Ct $8D$]1Ã|$t|$ux}|$tQ|$tu(|$uS S K $ǔÃ|$uSY$8D$ 1É $8D$T$p1Ã|$t $8D$D$D$J11à W\$T$C $ 8D$z 1ËB@T%u'^$28D$B@ D$1Ct $V8D$# 1Ëjl$ ~$T$l$ | ,$袓1à T$B$D$dT$}1 ËB tZ B tcB$tZ$B$ t7BtZB t-- É$C@$C@ЋT$븉$C@ЋT$댃 T$B(tJ( $L$L$D$Ѓt 1 ÃL$ A(tQ(A( t1É$B@T$ ӃCC KHBBtB$ZT$ BB tZ B B$tZ$B$ t~BtZB tRB(tZ(B( t&B,t $T$ $BЃÉ$C@ЋT$ ɉ$C@ЋT$ 띉$C@ЋT$ n$C@ЋT$ ? T$$D$ЃD$u1 $ YT$BBu t ! É$B@Ѓ Ã0s8D$$8D$(D$,D$ 8D$L$8 $L$D$ u D$@ t(W$8D$D$D$J0ËD$@uT$ WB $8D$o1Bt $ 8D$O1(4(4ÃT$ WB $*8D$1Bt $P8D$1(4(4ÃT$ WB $m8D$1Bt $8D$1(4(4à L$$ $l$$ƒD$u1 ËE(uc--8 $T$U t=M L$M L$ \$<(T$D$ tD$ É$B@빴-뿋M( $T$l$$Ãu1 Ã(L$,T$0AtW$8D$1(ËB@T%,B $D$L$_u1(ËL$, $D$$D$D$ T$$} t1(É$B@ D$0@ @ D$D$0@ @L$, $D$D$y}1(ËD$,@$D$D$D$D$D$,L$HD$0PB@0tB@T%u'^$8D$B@ D$ 1(ËB@0tȉ$ WL$R4\$,ƒD$ut\$,T$}W$B8D$1(ÉS D$0P-tYB@T% u'^$d8D$B@ D$O 1(ËC(t)K( $T$ݚ}1(--(S(1(É$B@R^$8D$A@ D$B@ D$ 1(ÃT$ BW$8D$ 1J $nÃT$ WB $8D$1Bt $8D$1""à WT$ B $8D$q1Bt $'8D$Q1ËBu--ËJ $ (\L$5à L$ $D$D$ ÃD$D$L$ $D$L$L$à $k1D$t$$|yz ÃT$ uT$ t$4L$øÃL$ $L$L$L$L$D$ ÃT$X $Ћl$ƒtӃ M MKMKuЃBB ǂ|| $T$ B ЋT$ u$B1ù $B Ћ\$ T$ B,B,u $BЋL$ $A1ËJ,J0&dǂxǂpǂ0ǂǂB|ǂƂ!ƂƂǂǂƂ$Ѓ D$rL$ $ȃ D$VD$ $D$D$L$ |$t tA|$t)Ɓ*T$ L$ Ѓ(T$ $1Éу $^T$ ddB,$BЋL$ $AЋL$ $A1ù $ƒӃ  KzK D$-$rC\$T$Zс $\$]T$ǂh$D$D$)(D$@@4@8@<@@@D@H@L@P@T@X@\@`@d@h@l@p@t@xǀǀǀǀHHHH@$@(ǀXǀ\ǀ<ǀ@ǀDǀHǀLǀPǀTƀ`ƀa$D$D$nL$ǁǁ ǁ$ǁ(ǁ,Ɓ4ǁ8ǁlǁtǁǁǁǁǁǁƁƁǁǁ 1l$T$ tӋRxKxuÃT$t1Ëlt?D$p $\$C,D$l$\$T$E,pu,tm0K0u$tD$;L$$AЋL$t$ЋL$$D$$ѝD$$D$D$@L$d$ȃ D$9Ã\$T$ tRtGuǂÉс $\$pT$ u11Á$$1ۋd$B4$B8$BL$ud$AЋL$$AЋL$A$AЋL$A,$AЋL$$AЋL$$AЋL$t$ЋL$ $AЃËd$u#D$ȃ D$L$71ދ0ǁ0BD$$AЋT$L$pǁpD$T$ B$$AЋD$ @,$D$D$D$ $D$@ЋT$L$T$RËL$ttL$1øËL$t$tȃ|$t 1Ël$\$C 9u+kÉ+\$T$ t5dP $\$ƒu1ËD$ hǂhD$hËD$ËD$ËT$L$J4L$ J8ËD$L$H4ËD$L$H8ËD$L$H<ËD$L$H@ËD$L$HDËT$L$JHL$ JLËD$L$HHËD$L$HLËT$L$JPƂ4ËT$L$JPƂ4ËT$L$JTL$ JXËD$L$HTËD$L$HXËD$L$H\ËD$L$H`ËT$L$JdL$ JhËD$L$HdËD$L$HhËD$L$HlËD$L$HpË\$T$tZtÉRtD$L$HxËT$L$J|L$ ËD$L$ËD$L$ËD$L$ËD$L$ËL$ttȋL$1ËL$ttȋL$1ÃT$nUǂ|$ L$$|$$u ËJ(JJ($JL$J(L$уL$ ЋT$uptYtTt Ë$(D$BD$D$ @4ЋT$J(ǂ륋 $^1É$L$ L$u1É$D$D$D$ D$sL$ $L$ L$L$$L$Xǂ!1ǂ$1Ë|$IT$gǂ1ÃT$D$1ǂZ(L$ JJJ(L$ J$L$$$\$J(L$уL$ ЋT$t $^1ËtYtTtE$(D$BD$D$ @4ЋT$J(D$D$뱃|$$tǂD$ǂ!1ǂ$1Ë$T$ǂ1à T$(l$$E M)9u֋M)΋]M)ˁ~ދE M)9nEM)9}?u)ދM)΋E$Mt$D$E؋M)ȉD$萇T$l$$)U)UDž$1ɉ Dž(E ËU M)ʃu9|T$$E Ћl$$ƃuDž1 Ë\$ M Et|EM)ȉ=~t$4$E)ȉD$EȉL$ M)ȉD$ L$$A$AЋt$ l$$L$MMMȋM)ȉEU MMM)ȉEuuDž!1 Dž$1 ÊT$L$t]t:t)t ǁ%1ǁǁt ǁ!1ǁǁ$1ÃT$D$tǂ"1ǂ$JL$J(L$уL$ ЋT$t $^1ËtYtTtE$(D$BD$D$ @4ЋT$J(D$D$tǂD$ËL$T$AËD$ËT$ tB$ ȋJ()øËT$$t u1Ë$ )ËT$ tBu1Ë J)ȋL$BJ)ȋL$ BÃT$ t (9s @Ë$(D$ D$D$ @4ЋT$ (밃T$ t (9s Ë$(D$ D$D$ @4ЋT$ (뱃D$ $D$@ЃÃL$ $D$@ ЃÃL$ $L$L$D$ @ЃÃD$ $D$@ЃÃL$APt6,t/ $D$,D$,@D$ nÉ $D$ D$$D$ onԋT$~)|1Ë_6ø"à $D$D$|$4$ ø .à D$$lt]CM$ ‹E9u  ËEى\$ˋE(M$)9~el$M$ $\$\$D$$@Ћl$ƃu1 ËE M$9uu EtMM$)ȉEu$\$ 3M(T$2‰T$$ED$l$ED$薁T$L$J*. T$$$D$L$L$(L$ L$,L$L$0L$u@ɉL$D$uL$$ $L$u  Éȃ 1L$ $)T$tù$L$L$L$ L$L$$L$ Ã\$ T$\$ $\$L$$L$L$L$ @Ћt$$l$(\$ T$txtOt#x$\$t$l$ sËD$9u t\$ËL$M1u ]1É u ]1É Ã\$$T$ \$  $\$L$(L$L$L$ @Ћl$,\$$T$ L$$ t1ǂ8$\$L$(L$l$ É$L$\$L$L$ (l$,T$ tËtt\$닋L$M1ø#u ]1øu ]1øà T$$$L$L$L$(L$ L$,L$L$0L$u@ɉL$3D$uL$$ $L$u  Éȃ 1Xl$dL$\dD$T9ʁ $D$LT$PL$h D$hD$H,$L$hL$L$lL$L$HL$ EЋ|$`\$tl$dT$\ƋD$LL$HBtgBPt$$l$D$hD$D$HD$ hl$dT$\D$PL$HL$ht0D$pL$H1Xø#XÀtD$pL$h1XøXÀtD$pL$h1XËD$LL$lB<tZD$C B$D$CD$D$B<Ћ|$`T$\u XË89t XËD$pL$l1XËBPtlj$l$D$hD$D$lD$ g|$`T$\례tD$pL$h1XÃ~#89t XËD$pL$h1XøXÀtD$pL$h1XËB<EHB,D$@,$D$hD$D$lD$D$@D$ B0D$E<ЋT$\B$B,D$B,L$@)L$B<Ћ|$`T$\uD$PL$lXË89tD$PL$l XËD$pL$l1XËB$D$hD$D$l+D$hD$B<Ћ|$`T$\뒋BPt$l$D$hD$D$lD$ zf|$`T$\atD$pL$h1XøXÃsMDT$h D$8D$7,$D$@D$E ЋL$@L$L$\ $L$dL$T$L$L$ )T$\D$|$u XË$L$dL$L$hL$L$L$ L$8L$ \$7T$\tXËB4t#B$D$D$D$B4ЋT$\B8t-B4t D$PL$L B$D$D$B8ЋT$\t BP$l$dT$\|$8tX\$8Bht#B$\$D$BhЋl$d\$T$\D$8@D$8xKxKH|$8u8$L$HL$L$lL$L$pL$ QXÉ$D$dD$D$hD$D$HD$ /dT$\.ppp pC,l lCCMDT$h C,$\$@KL$E Ћ|$dt$@FD$\8FNȉD$4FD$0F$D$8<$D$0D$D$4D$D$8D$ F(HD$G<Ћl$\T$@B$L$8)L$(D$0;D$4JJ$J D$8,$L$dL$L$hL$у L$ у,L$' L$\tXËA4t@A$D$@@ D$D$A4ЋL$\$l$dT$\APt܉ $D$dD$D$hD$D$HD$ bL$\붋B(J$)J$ $D$,D$EЋ|$dt$@u XÉF$\$, N(T$(D$80 $B ЃD$@u Xù $D$\@ Ћl$d\$@T$\C$C$u$BиXËK$ K(D$PL$HXà D%'BHtmB$BHЊ\$tl$dT$\$l$L$HL$L$lL$ L$pL$ˉL$ul$dT$\tXÃ|$HF\"XËBPt$l$D$hD$D$HD$ `\$tl$dT$\uB<t.D$C B$D$CD$D$B<Ћl$dT$\BP$l$D$hD$D$HD$ `l$dT$\J<L$@EHu~B,D$<,$D$hD$D$HD$D$95tCPuktWtBD$hL$X $D$\D$L$`L$L$hL$ D$XЋ|$Ht$\l$XT$TD$lL$h1Pø#PÉ$D$XD$D$\D$D$hD$ 6\$Tl$D$L$\L$L$hL$ 3\$TtPËD$X tt Pø PøPt%D$:ƅtCpu/$L$\L$L$`L$L$lL$ PÉ$L$UL$$L$ M\$Tƒu PËhHD$LƀKt $D$JL$JL$ JL$CpЋL$L\$Tu Pt=)ClK $ClЋ\$TPÉL$:ƃƅCTف $L$XL$T$XRD\$\ L$L$XIDT$h)ʉT$ Sl$L\$TDDu PËD$;u<u[$L$UL$$L$ LD$;l$L\$T<<u PË<@f<WP $L$XL$T$XRD\$\ L$L$XIDT$h)ʉT$ RT$LD$;\$T<A<@u PË<hHJ\J`ClK $ClЖD$;l$L\$TPùUDCTt`ف $L$XL$L$\L$L$hL$ Q\$T@@u PËǃHǃDCTƃ$L$UL$$L$ *JT$T<<u PËD$LƀBTYL$X $L$\L$L$hL$L$HL$ D$X@8Ћl$Xu PËL$T $l$UD\$\ L$MDT$h)ʉT$ Pu PÉD$4$S>\$TL$4HD$;D$L<L$LP $L$XL$T$XRD\$\ L$L$XIDT$h)ʉT$ Pu PÉD$4$=T$LD$;\$T<L$4HJ\J`?6L$X $L$\L$L$hL$L$HL$ D$X@8ЖD$;\$T Pà Op L$X $L$\L$L$hL$D$X@0ЋT$LD$;\$Ttǃ<уP $L$XL$L$\L$L$hL$ Nu PËL$T $L$LL$D$4D$$L$ GT$LD$;\$T<<u PË<;D$4tJ`J\ǃ<J\J`<@<@!u ,t#1<A"}؋J`J\ǃ<a@tTC$@D$DD$HD$ D$CTЋD$T$_Kl$L\$TD$;Du0u$CXC$CXЋ\$TD$:ƅtCpu ƃ뮉$L$UL$$L$ E\$Tƒu Pt hJD$LƀKt $D$JL$JL$ JL$CpЋL$LD$;\$Tu PtC=Cl1K $ClЖD$;\$TPËDL$:CTC$@D$DD$HD$ D$CTЋD$Tǀ@$}I\$T%P $L$XL$L$\L$L$hL$ Ku PËL$T $L$LL$D$4D$$L$ DT$LD$;\$T<<u PË<;D$4tJ`J\ǃ<lJ\J`<@<@!u ,t#1<A"؋M`M\ǃ< 8 t h$L$XL$T$XRD\$\ L$L$XIDT$h)ʉT$ =$T$LD$;\$TʼnD$4<<JxHBtJx)ȋ<AJtJxtzD$DL$\C$<D$<@!D$<@D$ <@D$hD$D$D$D$ Ћl$4\$TPËJxJtp>t\C`PG7<(P $L$XL$L$\L$L$hL$ Hl$LT$DD$;\$T<A<@u PËM\M`C\t^L$\ C$<D$<@D$<@D$ <@D$<@D$C\Ћ\$TeVL$\ C$<D$D$D$ D$<@D$<@D$<@D$<@D$ Ћ\$T<L$\C$<D$<@!D$D$ D$<@D$<@D$<@D$D$ Ћ\$T5ǃTǃPC`ف $L$XL$L$\L$L$hL$ F\$TPPu PËLL$X $L$\L$L$hL$L$HL$ D$X@8ЖD$;\$Tu PËPPف $L$XL$T$XRD\$\ L$L$XIDT$h)ʉT$ Eu PÉD$4$D3\$TL$4TTtC`u$CD$;\$TL$\C$PD$hD$D$ TD$C`Ћ\$TD$;렋PtC`u$BD$;\$T4ف $L$XL$T$XRD\$\ L$L$XIDT$h)ʉT$ DT$TÃu PËD$DL$\B$PD$hD$\$ TD$B`Ћ\$TD$;N$L$XL$L$\L$L$hL$ (D$;l$L\$T\\u Pƃ`ǃLƃa0!ZtHt/t4g8LƃaTLƃ`̇!L뉹|7Lyt.t$.LVd+.LFG1L6d6L&. q &Ok"Gt6 t1!&Ltx\$T)9uف $>\$TLD$DL$\C$XD$\D$LD$ D$|$<$u/D$ЋD$T$d;\$T 1ҸPÃ*Wt'4()t $C Ћ\$Tƒu P@@@ @|$<)uGD$DL$\C$XD$T$Ћl$L\$Tƅ3뷋$L$XL$L$\L$L$hL$ rBT$L\$TXXu PǂǂƂ+_,-1rt @ȉx)D$;uR$@\$Tƒu PËD$DL$\C$XD$T$ЖD$;l$L\$TƅDž9 $ѣL$CЖD$;l$L\$Tu PÉt= $L$CЖD$;l$L\$Tu PÉ$<|$LD$;\$TŃ} PË( hzǃ $C ЖD$;l$L\$T7P'@ @Z62H/01,u Ptt|L@ @ȋt@ @t놿\R|u PË,|344!5aLL$@D$hD$($4:l$LÃ} PÍ @؉\$$ [ȋL$@HL$T $L$XL$L$\L$L$(L$ 7=|$LD$;\$Tu PË(D$$ @ȉh1҉Buf]D$X@DL$h)1:c78tJ9$L$L$\L$L$hL$ \$TtPËD$X$L$XL$L$\L$L$hL$ 2\$Tu PÖ$L$XL$L$\L$L$hL$ \$Tu PÖQCPt$$D$XD$D$\D$D$hD$ h\$TD$;$L$XL$L$hL$L$`L$ L$lL$L$pL$!D$;\$TtPÃ|$h\&PÃ;t <ƅuPClyK $ClЖD$;\$T[PÉP $L$XL$T$XRD\$\ L$L$XIDT$h)ʉT$ 4u PËL$T $L$LL$D$4D$D$ H-|$\$ T$X D$ $\$ \$L$$L$L$L$ Ћ\$ T$L$$tftUt/t u D$(1øu D$(1øËD$(1ËBPt6$D$\$D$D$ oD$u #ËD$(L$1ËL$ à  tj1BPt"$D$\$D$D$ T$\$ tD$(L$1ø#É$L$\$L$L$ T$uÉ$L$\$L$L$ }T$nÃ8l$@\$<00J0E E ,J,j 8JL$DJT$$BuUME! $t$4t$T$0T$L$,L$ Ћ\$<$L$L$4L$L$0L$ D$L$,L$L$,L$D$l$$\$<ƒu5D$0;D$,t t&D$@@ M,0M0Ѓ8ËD$@L$,+L$4H l\މ$8L$L$t$4t$ T$0T$L$,L$D$l$$\$1 à T$\$B tgT$\$ BËB |tltXtEt2t@Y$ݡ3D$=1ɉȃ $D $-ދ $ $$ 볃tIt1tu $~됉$L$Ox u-eu--N $;P= $0+ot[ tD t. t $O $ $ $γ $?tTt7t $s~ $KL$Lv $KL$^ L$u`$D$3D$4Á(4u EEt9Y$xT$4ËB@T%tjR<$T$軽 R<D$ AD$L$R<BAD$ )D$e4É$v R<‰Q R<D$ AD$L$R<BA뎍R<$T$ R<D$ AD$L$R<BAD$ ~D$q3cËA$3D$C3Ë_$3D$#3à T$(19}A9|$t$$ǃu1 ËD$,@D$ 1;l$(}: i@j Iȉ‹D$,@ X E;l$(|ƋL$, $|$|$,T$t t1 É$B@ t_D$$$ D$D$(@D$t$ L$(\$$Id͍ I H i H É$B@딃$t$,l$(EMȋN EMȋN EpW2t,t!@Y$u;D$L$91$1$É$T$Xƒu 61$ÉT$ $6T$ 6T$ D$,@D$L$, $T$+T$ t t1$É$B@ tFD$($ D$D$m\$T$(BdBفJ$É$B@뭃[ t1$É$B@$T$-L$Y$T$XtJt2C@T%t1$É$T$e7$T$U$T$$V|$T$Xi@atLt4>t?$T$0U<$T$T)$T$W$T$TAtB$T$"T$T$qt >wu1ȍ /IȋL${>rt؉>st͉>ot‰>pt벃qtr:뀃yuwlx^zU=E\D$4D$,D$D$m,L$ll$4tZD$`|$tD$${l$4|$,tD$,$zl$4t,$z|$`uD$`\ËD$`˃A\$0$L$D$D$_l$4uD$`@=nD$P$'zŃD$4K$L$`L$L$PL$}\$PʼnD$4@S $yl$4D$,|$,,$L$PL$&l$4D$|$1;|$P/D$8D$D$D$D$8]bS z  h_ /ZH;|$Pu11;t$P}/)T$,. uG .Z;t$P|D$$11;\$}-L$0 D$$L$$T$,)L$0 ;\$|11;t$P.D$8D$8rVo7 ]t9nt4|$8Z|&ÉKtGȉF ؉2@ 3IȉT$,@ T$,+D$TD$T 3A2L$THsF;t$P+,$|$:D$`D$,$wD$4$wD$$wD$`\É2@ 3IT$,D$TD$T 3A2L$THptq릃ystwtxz=|$T$@T$;|$X ; $L$dL$|$Xl$4RD$B:@r0T$@ T$9:@ ;I/s ;A:H:@ d|$T$@T$;|$X ; $L$dL$|$Xl$4D$rtttZ뇃@+twn>e?-WANBES ;D$P:@SuT$@T$9th:@qt:@nT$@ T$9|$X:@$ D$D$|$Xl$4u|$X:@$ D$D$z|$Xl$4D:@/qt /w1ȉ ;IȉD$@|$8q0|$8n%T$@*qtT$@*nL$@ @t$@.qtt$@.w1ȋT$@ Iȉƃ|$8nuD$8q|$8qt|$8wu2rD$8/ ;A:HI|$8rtǃ|$8st|$8ot|$8pt)멋t$@.rft$@.sUt$@.oDt$@.p3L$@)T$@*S/S|$X:@$ D$D$ľ|$Xl$4/r_/sR/oE/p80rkkZd e)ft g:@ ;I΍I|$X)L$H|$H| ;t$:@\T$@T$9:@ ;I9u*/$ D$D$蘽|$Xl$4bu1/:@$ D$D$b|$Xl$4,#/:@:$ D$D$|$Xl$4|$8fub vT$H T$@L$HT$9uA\$H + $t$Tt$L$dL$t$T|$Xl$4D$~|$8g:@k vT$H T$@L$HT$9c:@ ;I]:@ ;I=:@|$X ;I\$h I $F|$Xl$4$u;L$賙|$Xl$41D$d@9}D$d@ =-uhD$d@9Ɖt$Tu*L$d $-L$t$T|$Xl$4/d ;A:HD$@D$FtD$@D$:@ ;Iˉ:@rT$@|$XT$9L$dI $&^|$Xl$4/$ D$D$衺|$Xl$4D$c:@ ;I΃A 8:@ &T$@ T$9ȃ ;A:H:@ notptqy:@/qt /w1ȉ ;IȉD$@T$@*D$T|$Trt |$Ts5|$Ts |$Tp1|$8s|$8p19L$@ @t$@.qt t$@.wu>1ȋT$@ IȉƋD$T/ ;A:H]t$@.rtt$@.stt$@.ott$@.ptL$@뇃|$8st7|$8pt0/rD$@ ;A:L$@H/sι|$To|$Tp/rr/se/oX/pKCy/stwrxdz[=P=D$$@D$D$|$uP19D$}TL$T$@ $Bu1ÉD$ $h#L$2u D$|$tD$9D$|ËL$ $ i#L$tƋL$ $i#L$ޔu D$  렋L$ $i#L$踔uD$ @wL$ $.i#L$菔uD$ NL$ $=i#L$fuD$ %L$ $Li#L$=uD$ L$ $]i#L$ Tu. $di#D$_D$($D$$@D$(1É $qi#D$D$ D$"D$($D$$@D$(1Ã$l$,D$1D$Et E_1Mu]19}`Et$ H\$t A;D$#AD$L$QtB t FMtE9|$Éу $i#L$t$ l$,u|$t4T$i#D$%D$0$D$@D$'1$ËL$( $L$L$L$0L$t$ l$,\$u1$ËD$(L$IHAu|$t )At D$$ø$à $/u 01@D$ $L$L$L$L$"L$ u $G11ÉȃÃWT$L$ vr$+D$L$T$ s É$P+D$D$T$ S ރ WL$ vr$+D$L$" É$+D$D$ l$1t$t$E;D$rD$ 0D$ËM $?*t$l$Ã|ֹ)gfff9~ W$+D$Í؉ƉD$ED$wD$t^t1øËD$ t +t-t1øÃT$ \$(T$L$$D$ L$0KCC CCCL$,K‰D$+D$| L$I $KT$\$(s+D$|L$ $T$\$(++D$|L$ $T$\$(+D$|D$#u+D$wL$ $T$كL$\$T$(u1ÃuB+D$tD$,+D$tD$.+D$~W$F+D$}1É+D$uL$ JD$Bt/BG0t%t %tEtFtB$1øÃdtetftguD$L$ $\$уL$\$T$(u1Ã)W$#+D$1BD$D$0z0|$ uC=D$\CD$2L$ K D$L$ KD$ D$L$IKL$ D$ D$|$t$ l$\$T$|^9~Tى>u )ىMM))؋L$Ã^u)=E؃t^t1øD$ t +t-t1øÃL$ \$(L$T$$ D$ L$0KCCC CCL$,K‰D$+D$|!L$I $QT$\$(Z+D$| L$ $&T$\$(+D$| L$ $T$\$(+D$|D$#u+D$mL$ $T$ك L$ \$T$(u1ÃuB +D$tD$, +D$tD$.+D$~W$/D$1É+D$uL$ JD$Bt1BG1t&t!%tEtFtB$1øÃdtetftguD$L$ $\$уL$\$T$(u1Ã.W$/D$1BD$D$00|$ uC=D$lCD$EL$ KD$L$ KD$ D$L$IKL$ D$ D$|$D$ l$\$T$|z9~pىÇރ>u )ىMM))؋L$ÇÇރ^u)=EчÇރtJ^t++CKȋKȋKȋK ȋK ȋKȋ ȃ$É )ʉS 뽉+빉k봉k $D$D$K$L$ K(L$OL$OL$JT$ t$H\$(C:N )щK(Cȕ-u -C+Cȕ-u -C 1G1$|$@l$(\$,D$0D$ t',$D$ L$L$,L$ L$(L$$D$4D$D$D$襡 ‹QA$W$DŽ$DŽ$D$~D$tD$pD$hAtT$l/D$$u$ČË$ u⋄$$$@@AcAt$/D$딋At$/D$sv,$D$8uL$8QaUL$D$$D$xD$t$In1$D$,D$L$< $L$pL$L$~L$$L$ L$xL$L$tL$D$L$,L$$L$ a$D$L$$$x$$D$L$\$0T$<tD$,dtyGet/%t*Et%Ft D$,$B@ D$\$0`$0ÃMD$0$L$L$:\$0D$4,Xt btcu$L$L$L$HL$\$0D$4ntԃetftg^yotxK묃L$ $L$L$D$L$ :ÃL$ $L$L$L$L$nL$ Eà L$ $L$L$L$#T ÃL$ $L$L$L$L$L$ Ã4T$@D$0uL$8 $ȃ4ËL$< $T$L$L$D$ >L$L$0T$8tD$,GJt1t,%t'Et"FtD$,$B@ D$L$0뇉$L$L$wpetft߃gtڃnuӃ4T$@D$0uL$8 $;ȃ4ËL$< $T$L$L$D$ >L$IL$0T$8tD$,eJt1t,Et'Ft"GtD$,$B@ D$L$0뇉$L$L$pftgt߃nu؃l$\$ u ɋ ;u]u""É9s/ ɋ ;u""C9r(4(4(4(4Ãl$\$ u ɋ ;u]u""É9s/ ɋ ;u""C9r(4(4(4(4Ãl$\$ u ɋ ;u]u""É9s/ ɋ ;u""C9r(4(4(4(4Ãl$\$ u ɋ ;u]u""É9s/ ɋ ;u""C9r(4(4(4(4Ãl$\$u"ҋ ; $[Ãu""É19sO ɋ ;t""Ãu ɋ ;uC9r$úl$\$u"ҋ ; $Ãu""É19sO ɋ ;t""Ãu ɋ ;uC9r$*úl$ \$u"ҋ ; $Ãu""É119sI݈Çݕȕɋ ;t/t""úC9r4$yÕȕɋ ;t u""ú1뮃D$$D$D$D$ D$ԋt$ l$19}C+%‰ɋ ;tс #+C9|ÃD$$D$D$D$ D$`t$ l$19}C+%‰ɋ ;tс l$+C9|à |$t$11;l$}TG҉сɋ ;t/uс l$»FE;l$| Éсɋ ;t!tс #»1뱃|$l$ |$~@Gۉفɋ ;trځ l$ME;t$}GGۉفɋ ;t"ځ #MEF;t$|È]]럃|$l$ 1;t$}GGۉفɋ ;t"ځ l$MEF;t$|Éفɋ ;tځ #Mˆ]뽃 $Ãu1É@1AC CC CǃCC C$ǃǃǃ1ɉǃǃǃǃǃǃǃǃlǃpǃtǃxǃ|ǃǃ؃Ã\$Av31ƒt$T$ $D$D$\$͇T$ L$ЃÉBtA $n\$붹L$ǁpAtu 1Ë$L$$1ۃ }L$(\$ DL$ $E!L$dL$ $K!L$L$*\L$ $X!L$EdtL$ $`!L$+du !$ÍL$ $k!L$dtݍL$ $w!L$L$[tL$ $!L$ L$[tL$ $!L$ L$f[pD$($øR!$Ã_u D-C$T\$D |$(l$$1ۉ9} +#9 \$+D$$!L$L$Z|$(l$$\$T$:t =B t t ɋ ;u-uB_t.t9s\4$)L$D$$L$9D$ t. $/L$ $|D$L$ $L$L$ȃ C91 + t + uC+ t1 ÃD$ D$ |t ËL$ $L$L$`\$ ƒǃtxT$$!L$aT$\$ $!L$aaT$\$ tx$T$D$$ЋT$\$ D$ |$ tJxǃl|$ u+xu!T$Ť!D$L$D$ É$\$ 븉x밋x $T$T$`uD$ D$$u\$ w1L$$ $D$ЋT$$ǂlu =D$$D$ЋT$$=D$ t+$T$D$ЋD$$D$$D$D$иÉ$D$ЋT$$=t@$T$D$ЋD$ $D$$D$D$ЋD$$D$$D$D$иËxtx$}ڤ! $L$2L$$xÉ$T$D$иÃ\$(1l$L$$P $D$1l$ƒuL$( $!Ãu8T$$XT$ʼnD$ uL$( $Él$,$ t$$ËD$h9~^\$  $)L$l$(\$T$u& t ,$~É$B@Ћl$(l$$D$ $\$l$ l$T$D$ L$  t|$ u1ËD$ É$B@މ$B@Ћl$ ǃB=$1T$ J $L$!L$D$ Ou1ËL$$ $D$D$D$gT$ÉD$ t^u1É$!L$YT$ÉD$ tu1ËD$ É$B@Ћ\$щ$B@Ћ\$둃\$KI SR9rK $aËKA A %D$ $D$@D$Á$DŽ$lV$ $$L$T$$ƒtt xtt$taD$$!D$$D$D$ @D$莛T$D$D$Q$ $ÉЁÉtv$kAދtI$ $|D$$  $L$L$$L$L$ c$$ $<Ël~7$ $$L$JL$D$ $ $L$L$T$ 8$&$à \$l|K $= Ëu8 $D$,L$ƒu $\ É$Mu  1L$%ËD$ËD$L$ÃL$ ${D$L$ $L$L$L$$L$D$ u1ÉD$$T$D$ tD$É$B@ D$L$$ $zt$\$$D$T$ |$1ǃuD$,@1 Étƒto1ƒ ueC€uZ|$(tƒ uDE)B;T$}u Áv1<$t щL$E Eƒ u ʈMCEc|$tL$ $t$\$$T$ %(D$$D$D$D$L$, $L$0L$L$4L$\$4u1(ǃw $L$L$\$ Gt$T$4u $(Ët=$L$uL$4 $(ÉD$$$2t$T$4ÉEǂ|$tN$L$)ى\$ L$T$L$ =\$ T$4u $ (Ëu|$uTt9$L$uL$4 $(ÉD$$$|T$4ËL$$؃(ËL$A $L$+L$L$T$L$ \$ T$4u$w(E ulFEu1ËL$ $L$L$D$ D$l$ u,$1ÉEE EEÃyD$u1ù $;T$u$:1ËBB J L$ JL$L$ЃÃT$xtx$=T$uuHBtu)t$T$$Ë$T$Nj u$@@ЋT$댋 n$@@ЋT$N,w! $D$S-=Lh"t1,ù}! $ -ƒt+@=+t'T$$J $+L$ T$$u1,ËR<B@T%T$($D$L$4 $+uD$L$4 $L$L$L$L$D$ uTL$( t2 Y $5uD$0@,1,ËD$($D$(@@빉D$ $!L$D$5\$ ‰D$ oу $JL$\$T$(D$ |$u* tD$0@,É$B@ߋD$4$T$0D$4L$xtx$L$ $sD$L$ $L$L$&T$(L$0xD$0x\ t1,É$B@$C@ЋT$(%$C@ЋT$1,Ã(l$,EM9tEE%(ËE t (ËEM $ L$9sT$,Ãt5CBuJ JZBB%(ËJ $D$rT$,ËB9uB (ËPLh" $lh"L$L$5l$,D$$t |$$u>E E t!$Nl$,MM(ËD$$uD$$$~l$,E 뤉,$L$$L$T$,tD$$$Ll$,vBB )ȉD$ B )ȉD$L$$ $nqL$l$,EˉL$A1u5E$D$,D$$$D$,@(ÉEU MMM$D$$D$pD$$$zl$,U\$ MMAM U\$ M$BtAL$t$l$,;t$T$,L$$  J  $D$}pl$,EMAM D$$D$ E_Eu8 $*l$,EEuE(ËMM M $M U)щL$l$l$,E MD$uM)Ήt$E+1uEMM(ÉEU MU M |$1EM $M U)щL$l$T$,u,pt (ËB$!D$nT$,J $D$nl$,EE@ u`ERU\$ MMUE9+ B U1롋MT$ $t$tL$|$t$l$,ߋEM)rE M $D$nl$,EE@ u 1EM)ȉD$ ,$L$$l$,tE E \$ T$t0JB 9s!$U\$ T$B9tBËD$<,RtJ)/t'%t&t(t3øøøøÃ*t +uظøø Ã/t-t .uøøÃ:t ;u ø øÃ^ItA@"t=t>køø2Ã[t]K ø ø!Ã|"t`t{$øøÃ}t~ øËL$D$/ts*Nt6!t&%t&t3Ã=u*Ã=u)Ã=u߸Ã*t =uϸ'ø$Ã+t-u=u&Ã=u%Ã/t =u(ø0Ã>^tBVøø"Ã=t>6#øÃ^t|=+Ã=,ËT$ L$D$*tE/t0t3Ã>u=u.Ãt D$1ËD$A É)؃} É,$\$\$lЋt$l$ \$t D$1Ã|$ t$l$\$9u   @Lt-t(t1É,$AL$t$|$ C9t:  @L2t" t t t1ÉC9uƸÃtuՉ@9u K @L t t tu1ÉA!Ã\$L$ 1 D$)ȃt Xtdxt AMtFmt ALt(lt Ãt1 úߺ룃t$$l$\$ \$9u   @Lt%t D$(1É)؃} É,$\$`Ћt$$l$\$ u D$(1Ã9  @L-  tgt D$(1É)؃} É,$\$ \$TЋt$$l$\$ u D$(1Ã9jÉ)؃} É,$\$ \$PЋt$$l$\$ u D$(1Ã)؃} É,$\$ \$LЋt$$l$\$ u D$(1Ã,$L$L$\$ \$L$L$ lt$$l$\$ u D$(1C9t+  @Ltpt_tZtC9uոÉ)؃} É,$\$ \$dЋt$$l$\$ t D$(1Ã끋D$(1É)؃} É,$\$ \$hЋt$$l$\$ t D$(1Ã+t9tBC9u >D$(AD$É)؃} É,$\$ \$lЋt$$l$\$ t D$(1à \],$L$L$\$ \$L$L$ \$ u D$(1C;\$$u > D$(AD$Ãttt CtD$(1É)؃} É,$\$\Ћt$$l$\$ u D$(1Ã6)؃} É,$\$XЋt$$l$\$ u D$(1ÃCtD$(1Ãl$\$ D$)؃} 1҃}:<t ]1BC|]à t$l$\$9u   @L@6C9t0  @Ltxtdt_tZtC9uЋD$ É)؃|),$\$\$dЋt$l$\$u닋D$ ËD$ É)؃|,,$\$\$hЋt$l$\$u8D$ Ãtt t @듉)؃|,,$\$\$lЋt$l$\$uD$ É)؃} É,$\$dЋt$l$\$t D$1 ÃC9u ]kC9u >tKOD$A( ËD$1 É)؃} É,$\$hЋt$l$\$t D$1 ÃtTt t D$A C9u   @L uCD$ É)؃} É,$\$lЋt$l$\$t D$1 ÃLt$l$ \$9u   @LGt D$1É)؃} É,$\$`Ћt$l$ \$u D$1Ã9  @L ` tgt D$1É)؃} É,$\$\$TЋt$l$ \$u D$1Ã9jÉ)؃} É,$\$\$PЋt$l$ \$u D$1Ã)؃} É,$\$\$LЋt$l$ \$u D$1ÃC9t1  @L t t tt D$1C9uϸËD$Aà t t 뚋D$ACGtttrC%tӃ\D$1É)؃} É,$\$\Ћt$l$ \$u D$1Ã)؃} É,$\$XЋt$l$ \$u D$1ÃCytD$1Ë|$t$ l$\$9tE  @Lt t1C9t%  @Ltt t1C9u۸ÉA Ã|$ t$l$\$9tdxu,$AL$t$|$ `  @Lt1C9t#  @Ltt1C9uݸÉA Ãt$l$\$9u   @Llt D$ 1É)؃} É,$\$`Ћt$l$\$u D$ 1Ã9  @L;tgt D$ 1É)؃} É,$\$\$PЋt$l$\$u D$ 1Ã9sÉ)؃} É,$\$\$LЋt$l$\$u D$ 1Ã)؃} É,$\$\$TЋt$l$\$u D$ 1ÃtCD$ A ÃttރtكD$ 1É)؃} É,$\$\Ћt$l$\$u D$ 1Ã>)؃} É,$\$XЋt$l$\$u D$ 1Ã,$AL$t$L$ L$ ÃttyD$ 1C l$,\$$D$D$(9L$(  @L$ tstD$0L$(1 É+D$(} É$L$(L$TЋl$,\$$uD$0L$(1 ÃD$(D$(9\ É+D$(} É$L$(L$PЋl$,\$$uD$0L$(1 ÃD$(+D$(} É$L$(L$LЋl$,\$$uD$0L$(1 ÃD$(D$(D$(9u ËL$(  @LrD$D$(D$(9u ËL$(  @LD$|$ t*|$ t#D$ tƒ ttD$0L$(1 D$(D$(9u ËL$(  @L;D$UD$(D$(9u ËL$(  @L v t tD$0L$(1 D$(D$(9u ËL$(  @L D* tctD$0L$(1 É+D$(} É$L$(L$\Ћl$,\$$uD$0L$(1 ÃD$(+D$(} É$L$(L$XЋl$,\$$uD$0L$(1 ÃD$(+D$(} É$L$(L$`Ћl$,\$$uD$0L$(1 ÃD$(a  D$0L$(A ÃctXtvD$(D$(9u ËD$(>tD$0L$(1 ËD$0L$(A D$(teD$0L$(1 ÃttmthtSt D$(V$L$(AL$l$L$(L$ Zl$,\$$ƒ&u D$0L$(Ѓ ËD$0L$(1 ËD$0L$(1 É+D$(} É$L$(L$dЋl$,\$$tD$0L$(1 ÃD$(t^t 1덉+D$(} É$L$(L$lЋl$,\$$tD$0L$(1 ÃD$(@+D$(} É$L$(L$hЋl$,\$$tD$0L$(1 ÃD$( Y PGD$0L$(1 à .QD$(ttt׃|$tD$0L$(1 D$D$(D$(9u ËL$(  @L tctD$0L$(1 É+D$(} É$L$(L$`Ћl$,\$$uD$0L$(1 ÃD$(+D$(} É$L$(L$\Ћl$,\$$uD$0L$(1 ÃD$(+D$(} É$L$(L$XЋl$,\$$uD$0L$(1 ÃD$(;D$(2tD$0L$(1 ÃIMD$0L$(1 Ãt$ l$\$9u   @LlZt0t D$$1É,$AL$t$L$$L$ É)؃} É,$\$`Ћt$ l$\$u D$$1ÃD$9  @L  tgt D$$1É)؃} É,$\$\$TЋt$ l$\$u D$$1Ã9jÉ)؃} É,$\$\$PЋt$ l$\$u D$$1Ã)؃} É,$\$\$LЋt$ l$\$u D$$1ÃC9I  @L O7trt D$$1É)؃} É,$\$\$\Ћt$ l$\$u D$$1Ã,$\$t$L$$L$ 7É)؃} É,$\$\$XЋt$ l$\$u D$$1Ã띉)؃} É,$\$\$`Ћt$ l$\$u D$$1ÃS t C9ËD$$AÃLtDt C9u >t D$$1ËD$$ACtqD$$1à  q돃|tttC|$t D$$1D$C9u   @L t[t D$$1É)؃} É,$\$\$`Ћt$ l$\$u D$$1Ã)؃} É,$\$\$\Ћt$ l$\$u D$$1Ã)؃} É,$\$\$XЋt$ l$\$u D$$1ÃkCetD$$1ÃuD$$1É)؃} É,$\$\Ћt$ l$\$u D$$1Ã)؃} É,$\$XЋt$ l$\$u D$$1ÃC9u   @Lt0t D$$1É,$AL$t$L$$L$ É,$AL$t$L$$L$ Ãt%ttD$$1C,$AL$t$L$$L$ Ãt$ l$\$9u   @LQC9t-  @Ltz/tttC9uӋD$$ËD$$ÃtuӉ@9tC]tC딉؃9tC>tC|D$$ك1É)؃|,,$\$\$dЋt$ l$\$u6D$$ÃXtM6)؃|,,$\$\$lЋt$ l$\$uD$$É)؃|,,$\$\$hЋt$ l$\$uD$$à  D$$1É,$AL$t$L$$L$ ÃtK1C9u ]C9u >tKD$$1É,$AL$t$L$$L$ É)؃} É,$\$dЋt$ l$\$t D$$1ÃtOm)؃} É,$\$lЋt$ l$\$t D$$1Ã()؃} É,$\$hЋt$ l$\$t D$$1à t D$$AC9u   @L uCD$$Ãt$l$ \$9u   @Lit D$1É)؃} É,$\$\Ћt$l$ \$u D$1Ã9  @L;tgt D$1É)؃} É,$\$\$PЋt$l$ \$u D$1Ã9sÉ)؃} É,$\$\$LЋt$l$ \$u D$1Ã)؃} É,$\$\$TЋt$l$ \$u D$1ÃtCD$AÃttރtكD$1É)؃} É,$\$XЋt$l$ \$u D$1Ã>)؃} É,$\$`Ћt$l$ \$u D$1à t D$Ãt!tt v׋D$1Ct$l$ \$9u   @LUt D$1É)؃} É,$\$`Ћt$l$ \$u D$1Ã9  @LOC t$t{t t D$1ËD$É)؃} É,$\$\$TЋt$l$ \$u D$1Ã9ZÉ)؃} É,$\$\$PЋt$l$ \$u D$1Ã)؃} É,$\$\$LЋt$l$ \$u D$1à C#tttދD$1à $)؃} É,$\$\Ћt$l$ \$u D$1Ã)؃} É,$\$XЋt$l$ \$u D$1ÃCt_D$1à |$t$ l$\$9t>  @Lt]tC9u¸ É)؃} É,$\$\$hЋ|$t$ l$\$t1 Ãk)؃} É,$\$\$dЋ|$t$ l$\$t1 Ã!1 É)؃} É,$\$\$lЋ|$t$ l$\$t1 Ãt t C;L$9u É  @L t t t t1 ø Ãtu|$,t$(l$ \$$9u   @L` 7It1É)؃} É,$\$XЋ|$,t$(l$ \$$D$9  @L *tdt1É)؃} É,$\$$\$PЋ|$,t$(l$ \$$u1Ã9hD$؃É)؃} É,$\$$\$LЋ|$,t$(l$ \$$u1à )؃} É,$\$$\$TЋ|$,t$(l$ \$$u1à t D$Ã/tt ߃|$u1ÉAÃCD$t)QD$D9u D$)  @L t%tgtt D$C)؃} É,$\$$\$TЋ|$,t$(l$ \$$u1Ã)؃} É,$\$$\$PЋ|$,t$(l$ \$$u1ÃY)؃} É,$\$$\$LЋ|$,t$(l$ \$$u1à 1C 8tt؃t1Ã!t9"t#$|$u1ÉA Ã|$u1ÉAÉ,$\$LЋ|$,t$(l$ \$$tD$1C9u ]u)@9u C>uك"ÉC9u   @LbtEt2t-t(t1É,$AL$t$|$ ÉIÉ,$AL$t$|$ 7Ãt҃t̓uƉ)؃} É,$\$\Ћ|$,t$(l$ \$$tD$,$\$PЋ|$,t$(l$ \$$tD$1ÃtZ P@9u 7C9u   @L t tڃtՉÉ@9u)؃} É,$\$`Ћ|$,t$(l$ \$$tD$,$\$TЋ|$,t$(l$ \$$tD$1à ft@ t- h $l$AL$t$ |$*ÉAù $l$AL$t$ |$ÃtAÉ,$AL$t$|$ ÃL1t!ttD$CD$Ct t7tqAÉ,$AL$t$|$ AC9u   @L @t t t t1ÉÃtuA#Ã!t"t #t̃$uʼnA%ÉA$Ã#t$AÉA&Ã|$t$ l$$\$9u É\$9t* @LltetWt%ttC9u։]Ã;\$u<$AL$t$l$ IÉ]É]1Ã끃 tL t&u;\$uAM'É];\$uAMÉ];\$u*C9u  @L uC]É]Ã|$t$$l$(\$ 9u É\$9t% @L^tWt%ttC9uۉ]Ãƃ;\$u<$AL$t$l$ É]Ã돃 t_ t9u;\$u"<$AL$t$l$ u1É];\$uAMÉ];\$u*C9u  @L uC]É]Ãt$l$\$D$ 9t: @Lt_tC9uƸC9u ]uC9u >uC|$ uD$ *L$ mC9u !SC9u [9D$ C/D$ 1É)؃} É4$\$\$dЋt$l$\$t D$ 1ÃtZt 땉)؃} É4$\$\$lЋt$l$\$t D$ 1Ãz)؃} É4$\$\$hЋt$l$\$t D$ 1Ã0|$t$l$ \$CM9t@ @Lzt*t00t+1t&| C;u$ԟ ȃ ΃3t4u8t6t܃7uՃ9tЃAuȃ뙃b2t!EtCtDuڃFtՃaqȃbctdtetfJ;Vō‰| C͋L$D$ )ȃt|tWt1at&quAuuAouAtuո"ApuAouAsu'auAmuApu&Atugtlt<ø>Ët$l$\$ M@Ltvt^E 8tM @L(ttt t1Ãtutttu۸ÉEC 8t1ÉEC 8t1ÉEC 851ÉEC 8t1Ãt DCE 81Ãtt߃tڃϋl$ \$T$t9u1 8t1BCu9u1l$\$   @L7t2#ttt)ÃσʃŃtuC븃tttul$\$  @L t ttCߋ|$ t$l$\$9s# @L$ttt CE9rà t uEECEC9t @L t ECl$|$t$\$)ȋ)9~# )ȉË9vC%=t/9t  MBE9u/K˃ |$t$ D$(D$;\$t9uD$D$(  @LtxtC f빉9tK? K? K? - fEсfMV K? K? ȉf(K? ȉf|$t$ \$;D$uË݈Ç݇Ç%t8)|ՇÇ ȕ?ɀ렋9t 닋|$ t$l$\$E9t9uËME fߋ|$ t$l$\$E9t9uËME D$=0t(=t=t=t =tøø=t=t=t=uD$=t=u1à \$D$0;t$݈ÇF߈Ç߇Ç߃4t~tyL$ )} D$0 ÇÇ Ç߃ȕ ȕ?ɀ;t$FD$0 ËL$ )} D$0 ÇÇȗ ȕ?ɀ띇Ç=s;D$ u D$0 Ëȕm{m=tW=L$ )} D$0 ÇÇ߃ȕ @D$D$ ÇL$ ߈Ç߇Ç݃N ȗȗ ȗ?ɀv=6=&|$t$ l$\$E) )9~F%=t-9tE9uË@  ȋMEfӃ΃ \$D$0;t$F݈Ç߈Ç߇Ç߃4t~tyL$ )} D$0 ÇÇ Ç߃ȕ ȕ?ɀ;t$FD$0 ËL$ )} D$0 ÇÇȗ ȕ?ɀ띇Ç=s;D$ u D$0 Ëȕm{m=tW=L$ )} D$0 ÇÇ߃ȕ @D$D$ ÇL$ F߈Ç߇Ç݃ ȗȗ ȗ?ɀv=6=&|$t$ l$\$E) )9~F%=t-9tE9uË I ȋMEfӃ΃l$\$9tXCE-99t8K T$  @L[tBt1t,t9uȸÉ)؃} Ã뤋D$1É)؃} Ã끃tttӃu9u CU-I9u Cu>uD$ك ËD$1É)؃} ÃK $\$ L$l$\$D$1Ãt$l$\$9u K^  @L5t7t2t D$ 1É,$كL$t$L$ L$ Ã9tQK  @LID$(كD$É)؃} ÃK $\$  L$ql$$\$  P<$L$L$\$ \$L$L$ \l$(\$ u ]1Ã;\$$u C>كMD$Ã)ttt 9~ÃtS  $ȍ- !Ѓu]1K $\$  L$Q|$t$$l$(\$ S H'ȍ- !Ѓ]1K $ L$|$t$$l$(\$ l$T$ D$)Ѓ } 1ۃ}Bu!:;uC|UÉU1à |$l$\$9u É)މtu ÍʼnD$Kb T$ @L}t 9t=K T$ @LetJt:t5t0t9uÉ É)؃|릉 É É)؃|낉 Ãtt҃ t̓ uƉ)؃|P K $\$ L$|$l$\$<)؃} Ã9u C]9u Cu>uك( Ã1 É)؃} Ãt~tԃ t dك Ã9u Ku! T$ @L u K $\$ L$|$\$̉)؃} ÃK $ L$|$l$\$t$l$\$9u K T$  @LatetFt't1É)؃} É1É)؃} É1É)؃} É1Ã9PK T$  @L5 tetFt't1É)؃} É1É)؃} É1É)؃} É1Ã9t:KuJ T$  @L t t tt1Ã9uƸÉكK $\$ L$t$l$\$럃 x teكÃ9ÃtttۃЃ{tÃS  $ȍ- !Ѓu1K $\$ L$t$l$\$,S H'ȍ- !Ѓ1K $ L$t$l$\$ \$;\$tuK T$  @Ltt D$1Ã;\$t;KuO T$  @Lt(tt D$1Ã;\$uŸËD$ك K $\$ L$\$K $ L$\$P\$;\$Cu xK T$ @Lt D$ 1Ã;\$t6KuJ T$ @Lt#t D$ 1Ã;\$uʸËD$ ك K $\$ L$\$K $ L$\$ZL$ $كL$L$L$L$ L$ Ãt$l$ \$9u K; T$ @LtitIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1ËL$ $كL$t$l$ (ÃtKtFrS H'ȍ- !Ѓu ]1Ã9K T$ @LtuftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1Ãtu9ZÉكM Ãtփtуt̃_S  $ȍ- !Ѓu]1K $\$ L$?t$l$ \$K $ L$t$l$ \$ t$0\$,D$D$(9gL$(IL$( T$$ @L t{tVt1t L$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 ÃD$(D$(9u ËL$(IL$( T$$ @LD$D$(D$(9u ËL$(I3L$( T$$ @LŃ D$t t t ttL$(1 ÃD$(D$(9u ËL$(IL$( T$$ @L9D$(D$(9u ËL$(I;L$( T$$ @L   t t L$(1 ÃD$(D$(9u ËL$(IL$( T$$ @L xtVt1t L$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 à 2 u(L$( Ã|t`tZD$(D$(9u ËD$(@uD$(>uL$( ËL$(1 ÃD$(D$(9 ÃtD$(T$(R H'ȍ-L$( !ЃuL$(1 ËL$(I $L$( L$t$0\$,LL$(I $L$( L$t$0\$,tptktZt D$( L$$ $L$(L$\$L$(L$ t$0l$\$,ƒuL$(Ѓ ËL$(1 ËL$(1 É+D$(} ÃD$(t.t b+D$(} ÃD$(Y+D$(} ÃD$(;L$(I $L$( L$t$0l$\$,CL$(I $L$( L$tt$0\$, + "L$(1 ËL$(I $L$( L$%t$0\$, ^D$(yttt1փ|$t L$(1 D$D$(D$(9u ËL$(IL$( T$$ @Lt{tVt1t L$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 ÃD$(tuD$(T$(R H'ȍ-L$( !ЃuL$(1 ËL$(I $L$( L$yt$0\$,kD$(T$(R  $ȍ-L$( !ЃL$(1 ËL$(I $L$( L$t$0\$,|$t$ l$$\$9u K @L*tktKt+t ]1É<$كL$t$l$ nÉ)؃} É]1É)؃} É]1É)؃} É]1Ã9u KuW @Lt+t ]1É<$كL$t$l$ É<$كL$t$l$ K $\$ L$|$t$ l$$\$늃tKtFS H'ȍ- !Ѓu ]1ÃD$9K @LEtt titIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1Ã9Kk @L ftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1à t u9ZÉكMÃhtKt bă9u Cu>uكMÉ]1Ã<$\$t$l$ 8ÃtS H'ȍ- !Ѓu]1K $\$ L$|$t$ l$$\$s H Sttt9rÃ|$t ]1D$9u K @LstitIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1ÃtuS H'ȍ- !Ѓu]1K $\$ L$`|$t$ l$$\$`S  $ȍ- !Ѓo]1K $\$ L$|$t$ l$$\$<$كL$t$l$ K $ L$|$t$ l$$\$t$$l$ \$9u É)߉tu ÍʼnD$ K8 T$ @L[;qh9tBK, T$ @L)ttt9uÉÃtuى؃9tCu9C]u0؃9tCuC>u ك1ÃOG)؃|6ÃLqt%Q)؃|É)؃|à " K $\$ L$t$$l$ \$1ËL$ $كL$l$t$ Ãtca9u CG];9u Cu>u1à L$ $كL$l$t$ GÉ)؃} ÃH)t#)؃} Ã)؃} à t qكÃ9u Ku! T$ @L uK $\$ L$t$$\$K $ L$t$$l$ \$t$l$\$9u K9 T$  @LtuftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1à t u]ÃtRtMt xS H'ȍ- !Ѓu ]1Ã9K T$  @LtuftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1Ãtu9ZÉكMÃtփtуt̃_S  $ȍ- !Ѓu]1K $\$ L$t$l$\$K $ L$\t$l$\$t$l$\$9u KO T$  @LtitIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1Ã9K: T$  @L |ttZt:t t ]1É]É)؃} É]1É)؃} É]1É)؃} É]1à ttu9;ÃTtttۃ]S  $ȍ- !Ѓu]1à $K $\$ L$7t$l$\$}S H'ȍ- !Ѓ<]1K $ L$t$l$\$ l$\$9t?K T$ @Lzt^tMtHt,t9u É)؃} Ã띉)؃} Ã놋D$ 1 É)؃} Ã`tՃ t u;L$D9u ËD$ Ku? T$ @L t t t t1 ø ÃtuK $ L$zK $\$ L$al$\$|$ t$(l$,\$$9u É)؉D$D$t"d$|$u ËT$ƉD$(K @L Slt)t ]1É)؃} É]1Ã9u Cu]t ]É؃9u CuC>uЉكM"Ã9u K @LjtKt5t0t+t ]1É<$كL$t$l$ ÉكMÉ<$كL$t$l$ Ãt̓tȃuK $\$$ L$c|$ t$(l$,\$$T)؃} É]1à z؃9u uÃ9u ]Ku0 @L t tЃtˉ]É؃9uK $\$$ L$|$ t$(l$,\$$뱉)؃} É]1à mtE t/  $|$كL$t$ l$ÉكMù $|$كL$t$ l$_ÃtUكMÉ<$كL$t$l$ ÃHtyD$9K$ @L<. tuftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1à t u]D$Ã/ttu|$u ]1ÉكMÃfKD$t#)D$9D$؃9u D$)K @L|t!tZt:tt D$~v)؃} É]1É)؃} É]1É)؃} É]1ÃtttuS  $ȍ- !Ѓ[]1K $\$$ L$G|$ t$(l$,\$$ m?ttփtS  $ȍ- !Ѓu]1Ã!t="t#$X|$u ]1ÉكM Ã|$u ]1ÉكMK $\$$ L$>|$ t$(l$,\$$D$tdS H'ȍ- !ЃtD$7S  $ȍ- !ЃD$  t<tكMÉ<$كL$t$l$ iÃ9u K @L Et !t t t ]1É]ÃtuكM#Ã!t""t #tȃ$uكM%ÉكM$K $\$$ L$vl$,\$$Z#t$كMÉكM&K $ L$&|$ t$(l$,\$$*|$t$ l$$\$9u É\$9t9KA @Lstit[t'tt9ulj]Ã벃;\$u<$كL$t$l$ É]É]1Ãm tP t(u;\$uكM'É];\$uكMÉ];\$uX9u Ku @L u]K $\$ L$l$$\$ˉ]K $\$ L$|$t$ l$$\$|$t$$l$(\$ 9u É\$9t4KF @Let[t'tt9ủ]Ã뷃;\$u<$كL$t$l$ LÉ]Ã{ tc t;u;\$u$<$كL$t$l$ u1É];\$uكMÉ];\$uX9u Ku @L u]K $\$  L$ l$(\$ ˉ]K $\$  L$|$t$$l$(\$ l$\$D$ )މt9l$tUK T$ @L.t9l$uÃ9u Cu]u9u CX>L|$ uD$ *L$ *9u C !9u C[D$ D$ 1É)؃} Ãt*t ʼn)؃} Ãw)؃} Ã]K $\$ L$l$\$\\$l$;\$tiK8 T$  @Lt:Zt3 Gt, t' t"Ku+$t@t D$1Ã;\$uøуtuۃtԃtσuȃt"uKu t놸Cu uD$1Ã;yti>[R'D ;!2")#K $\$ L$g\$t$$l$|$1ۉ\$ D$MuPMT$ @L isOMtM $l$ML$Ƚ|$t$$l$\$ ~V uu1|$딃u;\$ }@ t@9tME t@ >MuVE tMuMT$ @L;D$t M $l$ML$ݼ|$t$$l$\$ ˸맸z؃Ãt,;\$ }H|$D$ |$ 1|$;\$ } hC\$ bY;\$ },@ |$1tʃ#뿃u#;\$ },@ |$Eu#;\$ },@ |$;\$ @ u#;\$ },@ |$x t t eu 1|$PG;\$ =@ ,t,;\$ }H|$D$ |$ 1|$;\$ } hC\$ \$1҃CuxtVCu;u $T Ku)ō‰| Ã뱸ӃCu;tKBqtc5At'2.t 0t1t| Ãȃ ރ3t4u8t6t܃7uՃ9tЃAuȃ멃b.tEtCtDuڃFtՃauȃvctdtetf^׸1T$D$ )=t1JatGquBuuuσBuouButu"ÃBupuBuouBesY'ø\B<a0B mBp&BBtJugtl<ø>ø߃l$\$Km T$  @L<twMuXMT$  @L.tttt 1Ãtuttt߃uM $ML$롉CE 8t1ÉCE 8t1ÉCEl$ 81ÉCE 8t1Ãt EC 8t1ÉEl$C 81ÃtǃtƒtK $\$ L$9l$\$}l$ \$T$t&9u1Bu$ 8uCu9u11à \$\$Ku< T$ @LIt[ktatTt +D$ ÃKtK $\$ L$z\$~tt tu낃zrtu߃\$Ku/ T$  @L t t t؃ÃKtK $\$ L$\$ƒl$\$;\$s8K T$  @L+t$ttE;\$rȃà t uEEE;\$tKu! T$  @L t E뚃K $\$ L$l$\$K $\$ L$l$\$<l$\$9tXFC-99t8 KT$  @L[tBt1t,t9uȸÉ)؃} Ã뤋D$1É)؃} Ã끃tttӃu9u VC-I9u uC>uD$ك ËD$1É)؃} à $\$KL$蜲l$\$D$1Ãt$l$\$9u  _K @L5t7t2t D$ 1É,$كL$t$L$ L$ Ã9tQ K @L\$ $\$KL$!t$l$\$'D$ ك! $KL$t$l$\$l$T$ 1E D$)Ѓt  BXxt à uiBMtYmt à u9BLt)lt Ãt1E û޸Ļ뮸딻{Z|$t$$l$(\$ \$9u  K@LytitIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1Ã9 K@L=tt titIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1É<$L$L$\$ \$L$L$ l$$\$ u D$(1Ã9t8 KT$ @L[tBt1t,t9uȸÉ)؃} Ã뤋D$(1É)؃} Ã끃tFtӃu9u VC>ID$(كD$É)؃} à $\$ KL$sl$$\$  P<$L$L$\$ \$L$L$ \l$(\$ u ]1Ã;\$$u C>كMD$Ã)ttt 9~ÃtC  $ȍ-K!Ѓu]1 $\$ KL$R|$t$$l$(\$ C H'ȍ-K!Ѓ]1 $KL$֫|$t$$l$(\$ l$T$ D$)Ѓ } 1ۃ}u"B:;uC|UÉU1à |$l$\$9u É)މtu ÍʼnD$ cKT$ @L}t 9t= KT$ @LetJt:t5t0t9uÉ É)؃|릉 É É)؃|낉 Ãtt҃ t̓ uƉ)؃|P  $\$KL$|$l$\$<)؃} Ã9u C]9u uC>uك( Ã1 É)؃} Ãt~tԃ t dك Ã9u  u"KT$ @L u  $\$KL$٨|$\$̉)؃} à $KL$袨|$l$\$t$l$\$9u  KT$  @LbtetFt't1É)؃} É1É)؃} É1É)؃} É1Ã9P KT$  @L5 tetFt't1É)؃} É1É)؃} É1É)؃} É1Ã9t: uKKT$  @L t t tt1Ã9uƸÉك $\$KL$Ԧt$l$\$럃 x teكÃ9ÃtttۃЃ{tÃC  $ȍ-K!Ѓu1 $\$KL$t$l$\$+C H'ȍ-K!Ѓ1 $KL$艥t$l$\$\$;\$tu KT$  @Ltt D$1Ã;\$t; uPKT$  @Lt(tt D$1Ã;\$uŸËD$ك  $\$KL$¤\$ $KL$詤\$P\$;\$u Cx KT$ @Lt D$ 1Ã;\$t6 uKKT$ @Lt#t D$ 1Ã;\$uʸËD$ ك  $\$KL$ۣ\$ $KL$£\$ZL$ $كL$L$L$L$ L$ Ãt$l$ \$9u  >KT$ @LtitIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1ËL$ $كL$t$l$ (ÃtLtGrC H'ȍ-K!Ѓu ]1Ã9  KT$ @LtuftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1Ãtu9ZÉكM Ãtփtуt̃_C  $ȍ-K!Ѓu]1 $\$KL$;t$l$ \$ $KL$t$l$ \$ t$0\$,D$D$(9gL$( L$(IT$$ @L t{tVt1t L$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 ÃD$(D$(9u ËL$( L$(IT$$ @LD$D$(D$(9u ËL$( 5L$(IT$$ @LŃ D$t t t ttL$(1 ÃD$(D$(9u ËL$( L$(IT$$ @L9D$(D$(9u ËL$( =L$(IT$$ @L   t t L$(1 ÃD$(D$(9u ËL$( L$(IT$$ @L xtVt1t L$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 à 2 u(L$( Ã|t`tZD$(D$(9u ËD$(uD$(@>uL$( ËL$(1 ÃD$(D$(9 ÃtD$(@T$( H'ȍ-L$(I!ЃuL$(1 ËL$( $L$(IL$t$0\$,K L$( $L$(IL$œt$0\$,tptktZt D$( L$$ $L$(L$\$L$(L$ t$0l$\$,ƒuL$(Ѓ ËL$(1 ËL$(1 É+D$(} ÃD$(t.t b+D$(} ÃD$(X+D$(} ÃD$(:L$( $L$(IL$蛛t$0l$\$,BL$( $L$(IL$ot$0\$, * !L$(1 ËL$( $L$(IL$ t$0\$, ]D$(zttt0փ|$t L$(1 D$D$(D$(9u ËL$( L$(IT$$ @Lt{tVt1t L$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 É+D$(} ËL$(1 ÃD$(tuD$(@T$( H'ȍ-L$(I!ЃuL$(1 ËL$( $L$(IL$st$0\$,jD$(@T$(  $ȍ-L$(I!ЃL$(1 ËL$( $L$(IL$t$0\$,|$t$ l$$\$9u  K@L*tktKt+t ]1É<$كL$t$l$ eÉ)؃} É]1É)؃} É]1É)؃} É]1Ã9u  uXK@Lt+t ]1É<$كL$t$l$ É<$كL$t$l$  $\$KL$胗|$t$ l$$\$늃tLtGC H'ȍ-K!Ѓu ]1ÃD$9 K@LFtt titIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1Ã9 mK@L ftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1à t u9ZÉكMÃhtKt bă9u uC>uكMÉ]1Ã<$\$t$l$ 4ÃtC H'ȍ-K!Ѓu]1 $\$KL$Ӕ|$t$ l$$\$r G Tttt9qÃ|$t ]1D$9u  K@LstitIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1ÃtuC H'ȍ-K!Ѓu]1 $\$KL$V|$t$ l$$\$^C  $ȍ-K!Ѓm]1 $\$KL$͒|$t$ l$$\$<$كL$t$l$  $KL$舒|$t$ l$$\$t$$l$ \$9u É)߉tu ÍʼnD$  9KT$ @L[;qh9tB -KT$ @L)ttt9uÉÃtuى؃9tCu9C]u0؃9tCuC>u ك1ÃOG)؃|6ÃLqt%Q)؃|É)؃|à "  $\$KL$荐t$$l$ \$1ËL$ $كL$l$t$ |Ãtca9u HC];9u uC>u1à L$ $كL$l$t$ >É)؃} ÃH)t#)؃} Ã)؃} à t qكÃ9u  u"KT$ @L u $\$KL$t$$\$ $KL$׎t$$l$ \$t$l$\$9u  <KT$  @LtuftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1à t u]ÃtStNt xC H'ȍ-K!Ѓu ]1Ã9  KT$  @LtuftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1Ãtu9ZÉكMÃtփtуt̃_C  $ȍ-K!Ѓu]1 $\$KL$st$l$\$ $KL$Ot$l$\$t$l$\$9u  RKT$  @LtitIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1Ã9 <KT$  @L |ttZt:t t ]1É]É)؃} É]1É)؃} É]1É)؃} É]1à ttu9;ÃUtttۃ]C  $ȍ-K!Ѓu]1à $ $\$KL$)t$l$\$|C H'ȍ-K!Ѓ:]1 $KL$豉t$l$\$ l$\$9t? KT$ @Lzt^tMtHt,t9u É)؃} Ã띉)؃} Ã놋D$ 1 É)؃} Ã`tՃ t u;L$D9u ËD$  u@KT$ @L t t t t1 ø Ãtu $KL$k $\$KL$Rl$\$|$ t$(l$,\$$9u É)؉D$D$t"d$|$u ËT$ƉD$( K@L Slt)t ]1É)؃} É]1Ã9u u C]t ]É؃9u CuC>uЉكM"Ã9u  K@LjtKt5t0t+t ]1É<$كL$t$l$ ÉكMÉ<$كL$t$l$ Ãt̓tȃu $\$$KL$T|$ t$(l$,\$$T)؃} É]1à z؃9u uÃ9u ] u1K@L t tЃtˉ]É؃9u $\$$KL$蚅|$ t$(l$,\$$뱉)؃} É]1à mtE t/  $|$كL$t$ l$ÉكMù $|$كL$t$ l$_ÃtUكMÉ<$كL$t$l$ ÃLt{D$9 'K@L=/ tuftIt)t ]1É)؃} É]1É)؃} É]1É)؃} É]1à t u]D$Ã/ttu|$u ]1ÉكMÃgKD$t#)D$9D$؃9u D$) K@L|t!tZt:tt D$~v)؃} É]1É)؃} É]1É)؃} É]1ÃtttuC  $ȍ-K!ЃZ]1 $\$$KL$7|$ t$(l$,\$$ n>ttփtC  $ȍ-K!Ѓu]1Ã!t="t#$V|$u ]1ÉكM Ã|$u ]1ÉكM $\$$KL$-|$ t$(l$,\$$D$tbC H'ȍ-K!ЃtD$4C  $ȍ-K!ЃD$  t<tكMÉ<$كL$t$l$ aÃ9u  K@L Et !t t t ]1É]ÃtuكM#Ã!t""t #tȃ$uكM%ÉكM$ $\$$KL$cl$,\$$Z#t$كMÉكM& $KL$|$ t$(l$,\$$&|$t$ l$$\$9u É\$9t9 BK@Lstit[t'tt9ulj]Ã벃;\$u<$كL$t$l$ É]É]1Ãm tP t(u;\$uكM'É];\$uكMÉ];\$uX9u  uK@L u] $\$KL$}l$$\$ˉ] $\$KL$q}|$t$ l$$\$|$t$$l$(\$ 9u É\$9t4 GK@Let[t'tt9ủ]Ã뷃;\$u<$كL$t$l$ ;É]Ã{ tc t;u;\$u$<$كL$t$l$ u1É];\$uكMÉ];\$uX9u  uK@L u] $\$ KL${l$(\$ ˉ] $\$ KL${|$t$$l$(\$ l$\$D$ )މt9l$tU KT$ @L.t9l$uÃ9u uC]u9u YC>L|$ uD$ *L$ *9u C!9u C[D$ D$ 1É)؃} Ãt*t ʼn)؃} Ãw)؃} Ã] $\$KL$yl$\$\\$l$;\$ti 9KT$  @Lt:Zt3 Gt, t' t" u,C$t@t D$1Ã;\$uøуtuۃtԃtσuȃt"u uCt놸uC uD$1Ã;yti>[R'D ;!2")# $\$KL$Tx\$t$$l$|$1ۉ\$ D$MuPMT$ @L isOMtM $l$ML$w|$t$$l$\$ ~V uu1|$딃u;\$ }@ t@9tME t@ >MuVE tMuMT$ @L;D$t M $l$ML$v|$t$$l$\$ ˸맸z؃Ãt,;\$ }H|$D$ |$ 1|$;\$ } hC\$ bY;\$ },@ |$1tʃ#뿃u#;\$ },@ |$Eu#;\$ },@ |$;\$ @ u#;\$ },@ |$x t t eu 1|$PG;\$ =@ ,t,;\$ }H|$D$ |$ 1|$;\$ } hC\$ \$1҃u CxtVuC;u $  u*Cō‰| Ã뱸Ӄu C;t CBqtc5At'2.t 0t1t| Ãȃ ރ3t4u8t6t܃7uՃ9tЃAuȃ멃b.tEtCtDuڃFtՃauȃvctdtetf^׸1T$D$ )=t1 BatGquuBuuσuBouuBtu"ÃuBpuuBoufBsY'ø\=Ba0!BmBp&BBt uBgtl<ø>ø߃l$\$ nKT$  @L<twMuXMT$  @L.tttt 1Ãtuttt߃uM $ML$p롉CE 8t1ÉCE 8t1ÉCEl$ 81ÉCE 8t1Ãt EC 8t1ÉEl$C 81Ãtǃtƒt $\$KL$&pl$\$}l$ \$T$t&9u1u%B 8uCu9u11à \$\$ u<KT$ @LHtZjt`tSt +D$ à t $\$KL$ho\$~tt tu냃{stu߃\$ u/KT$  @L t t t؃à t $\$KL$n\$Ãl$\$;\$s8 KT$  @L+t$ttE;\$rȃà t uEEE;\$t u"KT$  @L t E뚃 $\$KL$ nl$\$ $\$KL$ml$\$<l$\$ ECa|z~0ƒa|ƒz~8t1ÀuÀ˃D-$D$D$D$D$D$ D$ zjÃL$ D$D$ $D$$D$D$(D$D$D$ D$@D$A<ЍD$9D$u D$ËD$ t t t t1øÃ\$ T$$9uD$(ËL$ $\$T$UD$ L$ $l$ \$u D$4(1ËCDʼn$l$ l$L$$L$D$ L$ $Sl$ \$u;l$$uD$(ËD$(($l$ l$L$$L$l$ \$u D$4(1Ã=&D$,(D$(9u D$4(1ËCDʼn$l$ l$L$$L$`‰T$$\$ T$t!BDÉ$\$ \$L$$L$(ƃ|$"t |$'D$D$BDËD$0$\$ \$L$$L$\$ T$D$9uJD L$4Ãa| zBD믃A|Z~0|9~.t-tۃ_t֋D$41ËD$41É$l$ \$t[D$,(CDʼn$l$ l$L$$L$;D$D$ L$ ${l$ \$uƒ|$=|D$4(1ËCD&,T$8D$(D$$D$ BDD$ t) t$L$L$ù 8ù ù 71Ãt^tu) É,$UD\$ SL$L$ L$'L$ EЋT$c ù 1ÃT$l$$D$Ct; t- tt$L$L$1ø8ø71ÃtuĹ) É,$UD\$ SL$L$ L$'L$ EЋT$t Ã\$ T$ t> t0t%t$T$mù) 1ø8ø7Ã\$ T$t*t)t$T$ù øÃ\$$T$D$t)t$L$L$ù É$L$L$L$ L$ /L$ CЋT$$tD$É$L$L$L$ L$Xm-L$ BЋT$p ù] øÃ\$ T$t%t$T$ù øÃ\$ T$t%t$T$ùW øÃ\$T$ t:t%t$\$xù ù] øÃ\$ T$t%t$T$*ù] øÃT$l$$D$Ct;t0 t" t$L$L$ø8ø711Ãt#tu<ù É,$UD\$ SL$L$ L$É$L$L$L$ L$1L$ BЋT$$tD$3)1É$L$L$L$ L$$L$ BЃtD$n)11Ã\$T$ t%t$\$ù B 11Ã\$ T$t%t$T$fù :1Ã\$T$ t2t$\$+ËJtBøB1ËL$Au|$tȹ)ø;ËT$ BB BËT$w BB Ãl$Et{]C1EEEE0CC CC C(C,C0C8C<0ClCPCL1øÃl$L$\$ tBAt:Q)B<؃ wٸH!ŋJ<B8Z<1øøÃL$T$t :Di2t Ã|$ 8uu BB uPJ B(B$uPJ$J( $L$0%L$B Ћl$T$Ãu ÉE}LCڃ|S$C4,$<ËE($\$E$ЋD$@É@C0}몃L$ $L$L$L$L$L$ ËT$))JLBT )JPBXÃl$UB4uBM( $T$J$T$L$E Ћl$T$B4B4u ËB(uJ$B(B0B,E\$ )ËB(9r9B4$E J()ȉD$T$B(D$QT$B0J(J,1Ër(J0)9vދB4T$J0ȉ$E )؉\$D$t$ t$QL$\$ T$)كt6B4$D$@ )ȉD$L$L$vQT$L$J0J(J,zZ0B0J(9uB0B,J(9XZ,PX|$\t D$\@u XËD$\@ tD$\u D$\@uԋD$\hE uE D$\@ D$LD$\@D$DD$\D$PD$\@D$HE8D$@]<\$@ȋL$\A,|$8u |$4u|$tD$XD$|$`u11뫋Mt5M $L$\I +L$4L$L$4L$Il$TEL$\A0aM $L$\I +L$4L$L$4L$kSl$TL$HD$PD$PD$@ FE t E L$@HE%tPD$@D$D$@D$D$@D$D$@D$l$TM $L$L$L$Hl$TED$@1Es*|$HL$HD$PD$PD$@r֋E tE L$@HD$@M A E%t:D$@D$D$@D$l$TM $L$L$L$PHl$TED$@1ۉ\$U\$D$\L$LH D$\L$DHD$\L$PD$\L$HHL$@M8]<X$D$D$5<\$9uEFր<>t1)؃ \$$C SCu B<tlJ<b8J<)J<1ۋB<rD$CȋJ8j8j<B<sBhЉT$ h$D$D$\$ \$$T$ щT$ h $ L$KL$T$$)BBD$ @ht ËBD$BD$$T$$L$JL$JD$ 1 ø ø ÃL$t'AtA uH<t1øÃT$$|$ tu ËBtB tB$tߋBD$J( $L$0%L$B ЋT$\$$D$u D$B4tKK( $J$T$L$C Ћ\$$D$uC($D$D$C$иËD$ $\$8D$)0D$$D$D$0%D$ 0t$l$\$CLف09rCLف,%9vWKl)ف0Elt'K$4$C4D$L$/t$l$u4D$ h1ËKL)ف0ELKP)ف0EPnv9Ã1ɸt t|trt t[tQ t t:t00ttt ȃÁ@ ΃Ƀ뭃먃A뉋D$,=-)Ã\$ L$|$t)É$$ $@ÃD$ $蜝|$tÃà L$$ $L$(L$L$L$ L$D$L$,L$L$0L$ ÃL$4|$,t$0l$ \$(T$D$t :14t Ã|$88uu BB uPJ B(B$uPJ$u6D$ۃ| ~ Ã|$$u|| l$ ؃|Ӄ΃\$(uD$( J( $L$D!L$B Ћl$Ãu ÉE(L$H@L$(H0H0C,K,IK4L$,KPKPCLKLIKTKPSXM( $\$K,L$L$E Ћ\$T$B8K( $J,L$L$C Ћ\$T$B@K( $JLL$L$C Ћ\$T$BDL$, !K( $ !L$L$C Ћt$\$ʼnC !C C8tC@u!C <=-N4$ËCDt׋Ctϋ !J(! !@K!L$ L$0L$$K$4$ÃD$|$(t$$T$ |$D$ tBu ÃtB@tB@u B@*uыZ\$Ct*J0 $t$|$v/|$(t$$l$\$L$ A0s1ËC,9vk,)ƋC8$t$l$l$Z*\$ |$l$}l}\M8 MHMXEHM8I1ȋMT!ȉEH19wSMXEHU8 I1ȋMT!ȉEHM4!ʉыU@ J]HUDZfۋEHMDAf0F9vt1Ã\$tCu ËC tC$tC1ɉKCC,SBJJB}JىJJt~*BT$ JuL$D$D$$L$A0D$ @(D$ $<D$ ${1$D$D$-벸q뀋L$t&AtA@tËAL$H1øË\$T$t0Bt(B@!ٸHL$ !ȋJf8L$ @T$ \$$ D$ fAT$\$$ fAL$ D$ ,$D$$D$D$ql$,,$D$0D$D$$$D$D$D$,D$(Í>71T$$f@D$t$$v1D$u D$L$(T$$f@ D$D$;D$(VL$T$$@ E;l$}9t*9}ZT$ fd1\$uD$D$D$;D$(~9uD$D$̃t!;\$tT$ fdD$ f뎃 D$ fyD$ fi$l$(D$D$,@D$1D$ |$u D$ D$ D$ ;D$0t$L$ T$,@ D$G;|$ } ;t$9%hD$@!+L$9dË@!f |$$t D$$t ǂ Ã|$$t D$$t ǂ ÃD$ $D$$D$D$(D$D$,D$ D$D$0D$D$à L$$T$(utt ǂ utt ǂ ÉT$ $T$t$|$$t D$$t ǂ Ã|$0t D$0|$4t D$4|$8t D$8|$<t D$<|$,u|$,u $?T$|$0t D$0|$4t D$4|$8t D$8|$<t D$<|$$t D$$t ǂ$#D$$3 Ë$L$ $T$P|$$t D$$t ǂ ǂус $L$ T$ÃD$t =sV)Éу $L$\$\$ L$ T$D$9u% $\$T$u\I|$$t D$$t ǂ Ã|$$tD$$t Ã|$$t$ l$(\$,T$1ɃtL$t ǁ|$t u tthL$ $T$L$t tt ǂ1ù $f0L$t$,l$(Ãu tt ǃ1Ãtt ǃƃL$ ǃƃǃǃǃ~ MHENى\$ $L$ L$L$$L$L$T$Ãt tt$01ËуƂЃÃtt ǁ1ÃT$ L$tt ǁutt ǁttt ǁtȉL$$FL$ $/Ãl$(\$,L$ T$$tt ǂtu tt ǂ1Ã|t tt ǂ1Ãu tt ǂ1ÉT$ $T$t&|$ t D$ t ǂ1Ëu $_T$с $T$Ãt \$u $\$T$unu2|$ t D$ t ǂL$,)ȃË|$ t D$ t ǂD$,Ëux|$ t D$ t ǂ1Ã|$ tD$ t1Éу $L$L$ L$ bD$L$ $UT$t&|$ t D$ t ǂ1ËL$уdl$\$L$T$ utt ǂËttt ǂÃt4t/tt ǂ MÃtt ǂà L$ $u  É$D$D$1 Ã膅\$L$T$u Ãu Ãt B$uGJ$B(uGJ(J, $tL$L$B$Ћ\$u ÉC @ @ @ǀd CC CCL$H(ǀT ǀP ǀL @,L$H01øøÃ4\$8C@u4ËC @ف@ A9u4C Kfŋ$$͋T$ D$͋T$D$L$|T$$J@@fË$$ˋT$ D$ˋT$D$L$|T$$J@BfË$$ˋT$ D$ˋT$D$]L$|T$$J@DfD$"$$L$"T$ D$L$"T$D$L$|T$$J@FfD$"$$L$"T$ D$L$"T$D$L$|T$$J@HfË$$ˋT$ D$ˋT$D$L$|T$$J@JfD$"$$L$"T$ D$L$"T$D$SL$|T$$J@LfD$"$$L$"T$ D$L$"T$D$L$|T$$J@NfD$"$$L$"T$ D$L$"T$D$L$|T$$J@PfNj$$ϋT$ D$ϋT$D$L$|T$$J@RfNj$$ϋT$ D$ϋT$D$OL$|T$$J@TfƋ$$΋T$ D$΋T$D$L$|T$$J@Vfŋ$$͋T$ D$͋T$D$L$|T$$J@XfË$$ˋT$ D$ˋT$D$L$|T$$J@ZfË$$ˋT$ D$ˋT$D$WL$|T$$J@\fŋ$$͋T$ D$͋T$D$L$|T$$J@^fŋ$$͋T$ D$͋T$D$L$|T$$J@`fË$$ˋT$ D$ˋT$D$L$|T$$J@bfË$$ˋT$ D$ˋT$D$_|$T$,$D$D$6$$,$D$D$ $$N $$1D$xt9D$x| tHD$x1;L$P}fDL@A;L$P||$PuD$x)@2z$$;D$x$OfD$"DŽ$$;D$P}G$Mщ L$"$$fDL@$$;D$P|$$;D$xyɚ;D$p1;T$P}DT@9s DT@ÉT$pB;T$P|\$tD$pD(L$d L$pD$d|$Pu D$x)@2t9;t$x)D$p E w`F;t$x~׋t$xFUD$p E w`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI `D$p Eȍ wI `D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI`D$p Eȍ wI `D$p Eȍ wI"`D$p Eȍ wI$`D$p Eȍ wI&`D$p Eȍ wI(`D$p Eȍ wI*`D$p Eȍ wI,`D$p Eȍ wI.`D$p Eȍ wI0`D$p Eȍ wI2`D$p Eȍ wI4`D$p Eȍ wI6`D$p Eȍ wI8`D$p Eȍ wI:`D$p Eȍ wI<`D$p Eȍ wI>`D$p Eȍ wI@`D$p Eȍ wIB`D$p Eȍ wID`D$p Eȍ wIF`D$p Eȍ wIH`D$p Eȍ wIJ`D$p Eȍ wIL`D$p Eȍ wIN`D$p Eȍ wIP`D$p Eȍ wIR`D$p Eȍ wIT`D$p Eȍ wIV`D$p Eȍ wIX`D$p Eȍ wIZ`D$p Eȍ wI\`D$p Eȍ wI^`D$p Eȍ wI``D$p Eȍ wIb`1ۉ\$\$wfD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@ fD$L$ L$ D$L$ D$w@ fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@ fD$L$ L$ D$L$ D$w@"fD$L$ L$ D$L$ D$w@$fD$L$ L$ D$L$ D$w@&fD$L$ L$ D$L$ D$w@(fD$L$ L$ D$L$ D$w@*fD$L$ L$ D$L$ D$w@,fD$L$ L$ D$L$ D$w@.fD$L$ L$ D$L$ D$w@0fD$L$ L$ D$L$ D$w@2fD$L$ L$ D$L$ D$w@4fD$L$ L$ D$L$ D$w@6fD$L$ L$ D$L$ D$w@8fD$L$ L$ D$L$ D$w@:fD$L$ L$ D$L$ D$w@fD$L$ L$ D$L$ D$w@@fD$L$ L$ D$L$ D$w@BfD$L$ L$ D$L$ D$w@DfD$L$ L$ D$L$ D$w@FfD$L$ L$ D$L$ D$w@HfD$L$ L$ D$L$ D$w@JfD$L$ L$ D$L$ D$w@LfD$L$ L$ D$L$ D$w@NfD$L$ L$ D$L$ D$w@PfD$L$ L$ D$L$ D$w@RfD$L$ L$ D$L$ D$w@TfD$L$ L$ D$L$ D$w@VfD$L$ L$ D$L$ D$w@XfD$L$ L$ D$L$ D$w@ZfD$L$ L$ D$L$ D$w@\fD$L$ L$ D$L$ D$w@^fD$L$ L$ D$L$ D$w@`fD$L$ L$ D$L$ D$w@bfD$L$ L$ D$L$ D$%fD$@fD$BD$%fD$DD$fD$FD$%fD$HD$fD$JL$ Mщ $"|$ CD$P+D$ 1)Ѓ*x)D$NFxD$t=X} D$Pt=} D$Pft=` } D$PLD$P? T$BD~\`щ`dd ȉd`1dl~BLh|$6#T$BJDȉB,lug$ D$$BD$OD$$ZD$:D$$hD$%L$ $p0D$ T$BD$1D$D$$AD$D$$YD$D$$&D$D$$SD$D$$YD$L$ $`D$D$$D$D$JL$ $D$AD$.D$$D$$T$|$$D$D$$rD$D$$ED$D$$8D$D$$PD$D$$D$L$ $dD$L$h| $! øÃL$L$ $>ÃL$ t $蕦Ã$cÃ|$l$D$;D$ uËD$ +D$~fD$ D$ D$ ;D$|QL$ D$L$$t$ ;t$ 9$L$HL$ D$ ;D$}D$ HD$ D$ ;D$|KL$ D$L$$t$ F;t$ 9$wL$HL$ D$ ;D$}É HF뽉 HFt$xDŽ$HDŽ$X$$X$$XD$$X$X$Xd|$c$x$X$X$T$XD$$P$P+$T }E$$|D$$TD$$PD$ $x$XctË$Hi@%$H$H1D$t$$T$|$L$T$h$P9#9l9;$h$h+$T+$h9$h+$T$TD$ )ȉD$L$|$~7L$ D$L$L$ D$L$D$ D$L$|$ɋ$P))98$P)l$ $P)@D$L$|$~7L$ D$L$L$ D$L$D$ D$L$|$ɉ$T+$hM$P)B+$T$P)9~S$T$X$Xl$$X$X$P$XD$$X?$X$P$XD$$X$T$X$Xl$$X)+$hED$ D$ EN9$|+$Lu{D$ $hD$ $h$hE9~9$|+$LuD$ D$ ONVUNG>E0u+$T$P$|$L$P$|$L@$P$L$HD$$T|1Ɂ}DŽ<A|19}L$ $<C9|1ҁ}<D %@ @%HD@F~‰<;@}_$X 4N} $h Ƌ$\ €@u ʋ@@$X 0G;@|Aƃ}d~dIVUUU‰ʼnD$$D$@$|$t$D$8D$ l$4l$D$0D$D$$D$l$@L$0\$H||$$1|C$CD$D$8D$D$4D$ L$l$@\$H`$h1;$l}%<$C;$l|ۋ$l$\1DŽ$0DŽ$ D$;$l`DE0닼00$ 9 }00ʉ0F;$l~$X|$$X$4$T0$4M0D$9D$0$4$P0$4M0D$9D$0$\$\$PD$TD$T $P 9l$T %@$T $P  ȋ$\ $\DE$\0담00$ 9 }00ʉ0g$\| $ ;$l?1ڃ|| TE|}$d݈X;$p~C;$l~u`ú;$l =@ Bϋ$P %9}*$ 4$ 0 9|9$ 0L$9 00F9}*$ 4$ 0 9|9$ 0L$9 00Fĉ |$1t$;t$(1;\$ }L$ 9u,EC;\$ |F;t$~؃ Ãl$1t$$;t$(*1;\$,}L$  9uT$GC;\$,|F;t$(~1҃}B|1;\$,}L$  @C;\$,|}@C|1҃}L$B|1\$$;\$("@+ƉHT$C;\$(~ދ\$$C;\$(T$@@+C;\$(~ÃL$ |$$u8$ D$$L$ $D$D$$$D$D$蔄L$ D$uw|D$$$ȉL$ D$|$$t$ GoMH1ۃv1D$D$ Ã}MO 1NwωD$IiD$L$ $D$D$L$L$ :} ËL$$ $L$(L$L$L$D$ JzD$D$$}D$à D$$@D$${u ËL$$ $D$D$L$L$D$ Ã} ÙD$|$tؙD$|$)ˋL$( $L$,L$L$L$\$ D}D$D$$|D$ Ãl$$} Ë\$ L$  $D$pL$I 4D$@ 9r8>|u?;\$ u9}D$@ 9s;\$ uC0;$r 1;$r ÉC <몃 l$\$1 }C1$ 4$׸;l$w1 M0M|$utF | à |$,} ËL$$ $:D$$D$ʚ; $D$d\$D$L$(T$, IL$$D$D$\$D$D$ L$I $L$I L$L$L$L$(L$ \$D$uZ$D$$D$$\$,T$(L$u É))9t$L$\$ 1 ËCE똃\$CC@u$.L$É$K(L$D$D$ DT$b,u$.L$迟É$D$D$諟D$$y1ÃL$$l$\$(D$ uFM"VUUU‰@D$($Cxl$\$(u1D$ }1ÉL$$ʋE}B-KD$ tot tQ@t8,$T$\$}|$ t D$$$3y1ËD$$É,$T$\$"Ɖ,$T$\$벉,$T$\$F랃L$}t3$~L$uȃSÃ|$} 3$y~ $L$ΧD$ L$ $~D$D$ $D$D$[~|$ u 3$'~D$D$D$;S} SD$L$ $L$PT$ B B u3$}T$ L$JЃÃ\$D$ŋC9|GC9|ËCK $D$Cl$ )D$D$L$ HËK $l$ L$w\$C C u3$}\$CK $D$CL$ )D$O\$ T$ZZà L$u At3$|L$A $D$AD$D$@ $vD$$v Ãl$]K| E tAMEuEK҃L$I $\$KH D$ @ $C D$CD$D$ à D$$D$@D$\$T$ JKC $B D$BD$4 à t$Fu1 Ë^K|M L$,I N}19}E C9|E~EM @t(M1N|:D$,@ D$L$ L$T$ Ѝ >U A\$N}ƋE L$ p\$T$CJ)ȃtËK $KL$J L$JL$ vÃ\$T$  9t  )ȃË}$T$É$\$Ã(T$0uED$,@D$4$jD$0L$, $rD$D$0$D$D$CrT$0u (Ã|$8tD$8$D$D$4D$Sl$4\$0D$,@us (ø(É\$L$ D$D$,xO|bD$,@ D$|BыD$݈Ç݇Ç݃uu;\$r (ÉCȕ1}O}D$9u;\$r (ÉC+D$(Ë\$S\$l$ 19s 9tEщMÃt$L$ \$|$1,$$sB)sB$E$)s øËt$L$\$ |$͕ؕ1ɋsBsBEu1 ËT$L$t$\$ )ʋ|$1t EBrËE|$uD$L$ $hD$u!;)t =;)uR1$v&L$ $D$D$D$!L$ $pD$ D$$D$ D$oD$ø멃T$u1É$@D$L$ $@\$ʼn‰BCuÃT$T$ L$ $\$ L$L$L$ÃT$T$L$ $\$ L$L$L$ L$$L$ ÃT$ \$$T$L$ $ L$\$L$(L$ L$,L$L$0L$lÃ8L$< $L$@L$L$$L$L$0L$ ƒL$< $L$@L$L$,L$\$@ƒuw|$$L$< $\$L$,L$L$(L$ L$0L$L$L$‰D$4|$ t5|$ t.u#L$DD$$D$(AL$DD$AD$ A Ѓ8ÍL$< $nD$D$ $D$D$mT$4먋L$< $\$L$,L$L$ D$L$L$7pl$ \$(1ҋD$D$ +D$ |zD$ D$ D$D$$L$D$ tGd$|$uL$ $l$L$L$ ‹D$$L$HD$L$ Ѓ뷺$l$,1D$D$(D$D$9scT$D$%tFL$ $l$уL$L$ L$L$SËD$(L$D$0L$؃$ÉT$ف$$$1$D$u$t ĈË$${Q[taL$ 9v$L$ĈË$L$ $\$2$$A$D$믃t룃JL$ $|$\$D$ L$|L$$ƃhȋL$|HT$L$ $\$$$A$D$t t $$L$D$ t H1u$$tju D$9v vD$uD$@u$D$D$^$$AD$&}Qu D$t $D$D$$$AD$D$~ ~ L$A $IL$D$$$A$D$ot9Qt Rt C$1L$ $|$\$l$ $L$$ƃȋ$Ht u 1L$ D$D$;D$s l$$|W$D$;D$t $ L$( $l$$$APL$ $|$L$|L$S$l$$ƃ{uGgfffl$|D$|‰ЉET$( D$|D$(|$ЉET$( EL$(L$| xtk t L$ 9v w$L$ $\$$$A$D$9L$ 9v $$L$ $\$l$$A$D$ t L$ $|$\$l$ $L$7ƃ$$ $ A $$BB$$D$$D$c$@$ $$_$!L$ $|$\$l$ L$ L$$$ $eD$D$ $D$D$le$$ ȋL$ HtcL$ $|$\$l$ L$ L$$$ $ eD$D$ $D$D$d$$  ȋL$ H&L$ 9 l$D$11;D$w{o|$ttV|$u1MtC ȉƉMuD$ 0D$ Ã}%t%t뺃t$D$11۽t9r9uD$ D$ÉB %t́ȃ 믃4\$@1l$0D$8D$,1t$(| |$D|$,|$ | ;9D$,D$,D$L$, $L$D$ $|$t$HD$4D$D$D$DL$ D$<@l$ D$ D$D$ $l$D$D$ L$l$8\$XT$ )ʉL$ u@D$ D$ сɀD$ $l$D$D$ l$8\$X2@D$ &u D$ уD$ |$0} @ÍD$ $D$0D$\$l$8\$XD\$\D$,D$HD$<1l$@L$PT$Lt=D$TcS(`{5stD$HL$<DÍL$L $L$(L$L$`l$@D$(uuD$<D$<뮋D$(@D$0|$0|L|$0Eu0D$4D$,D$Ttjt[tL|$,t;|$`u%D$<$D$,D$D$,D$l$@D$,D$<D$XD$,몋D$XD$,렋D$XD$,떃L$L $L$$L$l$@tz1ۋD$$9pT$$@D$0\$ u,D$0D$0D$$~C\$ T$$@D$0D$<$D$0D$D$`D$Pl$@\$ C눽 &   1҃|$T u\T$X L$< $։T$|$L$`L$ŃdD$빃|$T uT$X뛽딃|$T uUD$X2D$$l$@D$0|$`u D$<$D$D$D$0D$l$@D$0D$<8tttttk]RI;2j$ t  .t"t  t xt$l$~ B|$tӉÉ)щʃ~щ CCŃ|$t$} )ȉ~ B|$ u %u.|$$tӉɃ|щCBσ|$D$ 09t119}T$ @ I9t1E9|à l$1ۉ<t7L$ $ډ\$ L$l$\$t؃ C<uɸ ËT$uBt1ËB uD$J ËT$uBt1ËB uD$J ËL$T$u BuBt BuBt1ÉȋJ ÉȋJ ÃT$uBt1ËBuD$J ËBu]Z \$ }9~9T$$]|$ t$l$19} )PCB1ËT$uBt1ËBuD$J ËT$uBt1ËBuD$J ËT$uBt1ËB uD$J ËT$uB9t&t tt1ËB uD$J Ãtu݃tփtуuʃtŃu뾋T$uBtBuB t1ËD$J ÃL$  $L$ ÃL$ $D$ $D$D$D$D$|D$ ÃL$t $MÃ\$T$u0u$uȃÉу $ L$vuك $ L$ZNj ȉD$ $(\$L$ D$$؃D$D$\$L$ T$ $؃D$D$L$YL$  $L$ ÃL$ $T$~&ȉL$ $D$D$D$7L$ ȃÃL$t $LÃL$  $QL$ @ÃL$ $D$ $D$D$D$D$D$ L$HÃL$t $%Là $D$ L$ $?RD$D$ $D$D$QT$ ׃t$L$$ ЃÃL$1҃tB uЃÃL$ tD$ $KL$uà L$u Ë[tLt:t(tt ËA$QA$DA$7ՋA$*ȋA$뻃   tM uAD$L$tȉL$ $QD$u|$hD$$WAD$L$tȉL$ $ D$u|$ D$$AA$PJA$L$uËAtA$JL$A tA $JL$AtA$IL$AtA$IL$A$D$@$$D$$IÁD$$ $$L$u D$ļD$D$ $$$$L$t$$$$L$Jt$ $&m$  $$L$L$Ad8AL$L$$$ $D$ $$$F$$$|$L$ $T$D$D$JT$D$D$$$D$T$~NjD$$;)D$T$묃L$ $L$ L$t|$ u ËL$  $L$L$stۋL$ $(;L$gÁ$DŽ$D$|D$DD$@D$<D$8D$4ʃ $ L$L$lL$t-D$t$sL$|$u $1ɉȁĈù( $@@@ @@@@@ D$|@$L$l $L$DL$`L$D $KD$DD$hD$DD$H$bL$|A D$HD$`L$h $L$@L$OL$@ $*$$T$@D$@\$HT$\=u Bى\$H $T$|J 9D$HD$XD$TD$PD$L$~t=u AL$\ $L$0L$L$0 $L$0 L$D$*L$|AL$X $BT$|BBL$T $L$D$,$T$(u M<)4ËJ$ $L$@L$L$L$L$L$ D$0D$($D$04Ã$D$D$|$4$Ã$D$D$D$D$ |$4$Ã(D$D$D$ L$0 $D$D$L$L$ L$ $D$VD$$D$$t7|$,t$(ÃD$D$D$ L$ $D$|$t$ÃD$D$ D$L$ $L$$L$D$|$t$ÃD$ D$D$L$$ $L$(L$D$-D$|$ t$ ÃlL$t $cRD$\D$`D$d D$*$2D$`<)D$AD$ d|$ T$ A@D$A D$AD$AD$D$ =L$* $`D$h|$pt$\lÃT$ D$D$ D$ у $ L$D$|$t$Ã$D$D$ D$D$ |$4$Ã$D$D$ D$D$ |$4$Ã)$ - ø=)$D$D$D$@D$D$@D$ ,뾸=)$D$D$,맸=)$D$D$,됸=)$D$D$D$@D$D$@D$ w,\tN>)$W,<>)$E,*>)$3, t|tetN 0>)$,1ҋD$96>)$щT$T$@D$+T$Bʸ)>)$+$>)$+:>)$D$D$+w tH iK>)$r+D$MΉL$<$D$ԸF>)$3+D$ΉL$<$D$ԃ L$$ $L$(L$L$L$qt*S>)$*a>)t =n>)u"1$ <$t$ øك<{>)$*L$@ $L$DL$)D$4$ƒD$0t"D$4$J 28D$D$D$D$4$L$0u>)$*<ø>)$@D$D$)>)$D$0@D$)>)$D$0@D$)L$0>)$A D$AD$)>)$D$0@D$)L$0I $D$, $覫L$,D$>)$AD$D$D$D$ I)>)$D$0@ D$D$D$D$ )L$0I$ $L$,L$L$L$L$L$ u9?)D$8!?)$(L$8|$tt$<$6L$8*?)$L$(D$,$]D$0$$$$HD$$D$HD$ $J $S4L$HL$HL$ $L$?$$$D$$HD$$$$$D$$HD$$$}$(D$S4D$>$t?DŽ$L $$LL$L$$L$FDŽ$L$ $$L$)>$P$$$DŽ$$Pu$(D$S4D$$$LL$L$Z$L$$I $T4L$$}$PD$T4D$ $ցƌH|$TցI$TTс,K$PK$$7-$}$PD$*T4D$}DŽ$Lց,K$P $$LL$L$uG$CT4D$$D$ $$PD$VT4D$$L$5$ $ƌH|$TցI$TTс,K$PK$DŽ$,}G$|T4D$$D$ $$PD$T4D$5$ $$LL$5uG$T4D$$D$^ $$PD$T4D$n$LtG$T4D$$D$ $$ D$T4D$~$ $$PL$_u&$$(D$U4D$9$L${$I $.U4L$x $}5U4$$$+$ĄÉ $ D$NS4D$L$/D$S4D$- \$(=Xu <X=XD$$@tF<$<(#|$)L$\$D$ RU4$D$ D$D$$@Ћ|$\$( :H t6D$$$PD$ZU4D$D$ bD$($ 1 11C9}CEC9|-<=(#~ D$$$PD$U4D$뙉|$<$t$8|$l$(1ۋE9}t|$<$E\$D$7l$(\$D$D$$ED$ED$葑|$l$(\$ECE9|+XD$|$<vV4$D$G|X@$D$D$B7D$(tVX$D$D$D$D$$HD$ WX$D$D$D$D$$ID$ MD$X|$,uQ<XL$$I $<L$L$鰤<L$}$/V4D$,D$($ É|$<$CD$r6D$D$$D$(D$ D$D$ D$(@(T$|U4$bD$zT$D$D$@$D$(@(D$T$D$@D$D$$D$(@,D$5|$L$(I0G|$<$CD$5D$D$$D$(D$ D$RD$ D$(@(T$|lU4$DD$&zT$D$D$@$D$(@(D$T$D$@D$D$(@,L$D$$D$4D$1;T$}1D$$D$(@,T$@D$4T$D$B;T$|ϋD$(@0T$U4$SD$XyT$D$D$@$D$(@0D$T$+|$D$@U4$JD$ yL$.t7Z|$<$؃D$C(D$ҍ|$D$(@(OCD$D$$@=t|$<$D$D$3|$\$(|$<$CD$D$D$l|$D$|$ l$8H4H)94H49tD4$4HD$t$t$|$ t$L$˃44Hݍ 348H9}GM $4H L$)t$L$|$ t$l$18H9|4H4HÃ8\$<$L$ƒu18D$0щT$4A $2L$0\$<ƒ =HD$,~-$2D$gV4D$T$ HD$18à $D$u18ÉD$4$D$,D$D$D$<HD$ RD$4$D$,D$D$D$<ID$ HD$@|$,}0D$<$2D$V4D$YD$@$ 18ËL$4A $1L$@AD$4l$,L$4 $1D$(L$4 $1D$ L$4 $1l$<|$4\$,t$(|$4|$ wD$jD$|$REt )9x119};uE9|,$1t$4L$@A,D$1;l$(}A2u-l$$ .A $0t$4l$$L$D$T$@R, A;l$(|D$(Ɖt$4$D$0\$@T$C( ~ ؃$D$ )ЉT$D$袉L$D$@)ȃ($D$4D$L$谉 $80T$@B0B0@D$<@tS@ $.D$$@L$L$@L$^ D$V4$D$D$D$<@ЋD$$8øV4$\$L$t$ EЋ|$4t$(bD$4$D$D$HD$ OD$4$D$D$D$<ID$ EL$< $L$,L$Du18ÉD$4$D$,D$D$D$<HD$ >OD$4$D$,D$D$D$<ID$ pE\$@T$4l$,L$0 D$0  t+D$<$ D$V4D$D$0D$ vO$6.l$,D$493D$$l$,L$4 $-\$@T$$D$4l$,D$(;D$,AKK $L$,L$@AL$4 $L$(L$-t$(l$,L$@IT$$ t$4)D$$d|$0kbmd$e-T$@BD$4l$,|$, @Ѓ$D$4D$ D$视L$,T$4  @9L$,A $T$4 L$-T$@B(B(@D$4B(@)D$,|$,L$4 $,T$@l$,B,L$4IJ0$,T$@BD$4l$,|$, hЃ$D$4D$ D$υL$,T$4 3@9L$,#A $T$4 L$C,T$@B(B(@D$4B(@)D$,|$,L$4 $+ƒD$4l$,D$,9щT$( $",|$(t$4L$@A,19}5l$$ 3 $+|$(t$4L$$T$@R, A9|)|$,|$,C@9D$,5)t$4D$($0+T$@B0B0$D$4@D$D$(D$ul$,D$(@)ZBM9l$,T$4$D$(D$*T$(L$@AT$4)T$,|$,L$4 $*l$,D$49kD$$l$,ML$4 $J*\$@T$$D$4l$,&D$(;D$,AKK $L$ )L$@A L$4 $L$(L$*t$(l$,L$@I T$$ t$4)D$$V*tKL$‰$L$L$'W4L$#l$$ƒud$L$L$)W4L$‰$L$L$1W4L$\$(ƒt$L$L$3W4L$\$ ‰Ѓ1ۋE9}$L$L$-W4L$ډ\$ IL$ l$$\$C \$$l$,T$(‹E  t&$T$6W4L$ML$ ‹D$$ É$T$T$W4L$l$,1ۋE9}Љ$L$L$W4L$M\$ L$ W4L$Rl$,\$C뺉$T$T$W4L$$L$L$W4L$L$,IL$ l$L$L$W4L$S1ۃ }:$L$L$W4L$ډ\$\$, IL$ \$C |Ɖ$L$L$W4L$$L$L$W4L$L$,I(L$ W4L$f$L$L$W4L$L$,I,L$ $L$L$W4L$L$,I0L$ c$T$T$BW4L$b$L$L$OW4L$L$,IL$ >$L$L$_W4L$%1ۃ }:$L$L$iW4L$ډ\$\$, IL$ \$C |Ɖ$L$L$nW4L$$L$L$pW4L$L$,I(L$ wW4L$8$L$L$yW4L$L$,I,L$ W4L$$L$L$W4L$L$,I0L$ W4L$#$T$T$X4L$"$L$L$X4L$L$,IL$ X4L$$L$L$ X4L$l$,1ۋE9$L$L$9X4L$M \$ L$ $L$L$wX4L$ډ\$ IL$ l$,\$CE(9|‰$L$L$|X4L$$T$T$OX4L$$L$L$cX4L$L$,IL$ jX4L$?$T$>X4L$h$$D$$$D$$ D$L$ $AtP~X4$D$D$AЋ$@ $@$X4D$$D$BËA t $X4D$D$D$띸X4$D$D$놃 \$T$Cu~ Á|C9~Su0SǃPK$CK $X4L$T$ ÁuSǃPK Ƹ à T$$L$,KL$J$L$'yu  1 D$$5D$@$$>D$@($/D$$D$D$wD$$ Ãt$ l$1ۃ}l  _49uU  _4H  _4H  _4HH=~1øC|1Ã1D$9}JT$h;|X11ۃ}'<_4t  _49t(C|FD$9|t øÉË1!럃 t$1ۋ9}/@1҃}`_9u B|C9|Ѹ ÁL_$w=_t_$x_LùX4 $D$`}X4$71LÉD$$L$LL$L$WD$D$$ L$X4$1LD LL$L $L$$L$ L$L$ Y4L$#D$1ۃ}b1ɉL$1;l$}?\$  _4 $l$L$L$YSL$\$ l$iȍ  _4C|Y4 $D$C}%Y4$1LÉD$$L$LL$L$:D$D$$ L$DY4$1LD LL$L $L$$L$ L$L$ cY4L$"D$1ۃ}t1ɉL$1;l$};\$  _4 $l$L$L$+B4hB8kAB<كB@y!~BD[ƂML$ $L$L$L$ L$T$ @L$Á$$$HH)9sH H$t$$l$|L$$$$)׉$H։$H=uQ؃H$HD$؃D$L2$$$HJǃHဃtJ4$$L$؃D$1$$$$J)$u>t0؃H$t$$|$kK$$H؁ĔËHrރHH1ɉ+J$2ƒp2p)鉬$T$ $D$$L$JD$ $$DŽ$DŽ$$I$$$$ $$D$D$$$$D$$D$r0$$1ɉJ$$؃D$$D$k$Lu $m1Ĕù)鉬$D$$t$$|$I$$D$e t$l$T$*9D$AD$ET$81ۈET$01ۈET$(1ۈET$1ۈET$\$ET$\$ET$\$EL$9l à L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$N0L$0L$ à L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$41L$@L$T ÃT$$u*P $L$ƒu1ƀLMu?B؞B |6Bp0B9YB1 BXhB dB$OƂML$ $L$L$L$ L$T$ L$ÃT$$u*P $L$Pƒu1ƀLMu?Bg jB gBrnt0؃H$t$$|$E$$H؁ËHhރHH1ɉ+J$2ƒ8(8)鉬$T$ $D$$L$D$D$ $$ S$ S$$$ $$D$D$$$$D$$D$1$$1ɉJ$$؃D$$D$k$Lu $茳1ùx)鉬$D$$t$$|$C$$D$ol$\$ T$9s.CCCC9r҃à L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$6L$L$* à L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$Y7L$ L$ Á$uIP $ʰu 1É$$D$PD$XB$ƃLMu*C#EgC CܺCvT2CƃMHH@)ŋ$9s$H H$$D$l$l$AT$$)$H$H@uC؃H$HD$؃D$$HJǃH$tG$$L$L$؃D$l$$J)$$$uJ$t7؃H$$D$$D$@$$H؁ËHWރHH1ɉ+J$2ƒ88)鉬$T$ $D$L$L$B@$D$ D$$ SL$ SL$$$ $D$D$D$$$$D$$D$$$1ɉJ$$؃D$D$r$Lu $1ùx)鉬$D$T$$D$$D$O?$$D$Tyl$\$ T$9s.CCCC9r҃à L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$"<L$L$ ÃlL$pT$t D$LD$p;D$LD$x@D$dD$x@ D$`D$x@D$\D$x@D$XD$ $D$pD$@D$|$Xt$dl$`D$h|$h0}jL$h3‹D$h D JJ )ˉى Љ|$\l$\D$h|$h0|D$xpD$xh D$xL$\HD$xxD$x@1PD$p@D$p;D$LlÉ3D$\1nj#D$\! ȋL$\! yZJ#D$\! 5$uIP $u 1É$$D$PD$<$ƃLMu#C#EgC CܺCvT2ƃMHH@)ŋ$9s$H H$$D$l$l$B<T$$)$H$H@u,؃H$HD$\$^$ǃH$t4$$L$L$\$#L$$)$$$uJ$t7؃H$$D$$D$r;$$H؁ËHHރHH1ɉ+J$2ƒ88)鉬$T$ $D$L$L$:$D$ D$$ S$ S$$$ $$D$D$$$$D$$D$$$$D$D$r$Lu $螩1ùx)鉬$D$$$D$$D$9$$D$l$\$ T$9s.CCCC9r҃Ãl$\$ T$9s.C K K ȉ9r҃Á$uIP $%u 1É$$D$PD$8$ƃLMu#C#EgC CܺCvT2ƃMHH@)ŋ$9s$H H$$D$l$l$P8T$$)$H$H@uC؃H$HD$؃D$E$HJǃH$tG$$L$L$؃D$l$$J)$$$uJ$t7؃H$$D$$D$V7$$H؁ËH]ރHH1ɉ+J$2ƒ88)鉬$T$ $D$L$L$6$D$ D$$ S$ S$$$ $$D$D$$$$D$$D${$$1ɉJ$$؃D$D$r$Lu $m1ùx)鉬$D$$$D$$D$5$$D$sl$\$ T$9s.CCCC9r҃à L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$EL$L$ ÁX$p$x~ 1XÃ$h@v 1XÃ+M$\ $$`L$D$T$ $tЉ$p$luXÍ$$\D$@D$4$h$dƄ$S19s+0C9r$D$D$D$$pD$ $tЍ$ $@L$D$D$ $tЉD$$$xD$$lD$L$ $t1XÍ$$6D$@D$A3$h$dƄ$S19s+0C9r$ $@L$D$$pL$ $tЉƒ^1Xà D$$D$D$2D$$D$D$D$2D$$D$ D$P L$tD$$L$D$2D$ᆳރ à D$$D$D$&2D$$D$D$D$52D$$D$D$ D$$D$D$ D$$D$D$ L$tD$$L$D$1D$ᆳރ Ã|$ l$G O O ȉGO O O ȉÉ%UUUUځ⪪ ہ㪪UUUU ˉ%33ف33 ȉ ȉ %ف ȉ ȉÉ%33с33 ȉ ȉ %с ȉ ȉƒ|$$$xD$|$}u 1Ɖ )43 +43 -43 /41Ëu 1Ɖ *43 ,43 .43 041Ë$ŋu 1Ɖ )43 +43 -43 /41‹u 1Ɖ *43 ,43 .43 041‹$D$|$媪сUUUU ͉%UUUUځ⪪ ‰%33с33 ȉ ȉ %с ȉ ȉ‰%3333 ȉ ȉ %ف ȉ ȈGGGWGGG$~ D$(@L$( ȋL$(I ȋL$(I ȉŋD$(@L$(I ȋL$(I ȋL$(I ȉÉ%UUUUځ⪪ ہ㪪UUUU ˉ%33ف33 ȉ ȉ %ف ȉ ȉʼn%33с33 ȉ ȉ %с ȉ ȉD$|$D$,D$T$$)x|$,D$|$y2 1Ɖ )43 +43 -43 /41ŋr 1Ɖ *43 ,43 .43 041ʼn‹2 1Ɖ )43 +43 -43 /41Ër 1Ɖ *43 ,43 .43 041ÉD$|$݉D$|$3檪UUUU Ή%UUUUځ⪪ ‰%33с33 ȉ ȉ %с ȉ ȉ‰%3333 ȉ ȉ %ف ȉ ȉËD$(L$(AL$(AL$(AD$(PL$(AL$(AL$(A ËL$T$$ ¿9 t$l$1 $n2+ $n2 Љƃ $n2+ $n2 ЉŃ< 4<  |4<  <4<  4 <  4<  |4<  <4É< |4<  <4<  4<  4 <  |4<  <4<  4‰%ف ȉ ȉ ȋL$%ك? ȉ ȉу? ȋL$AD$Gn ÃT$ B J J ȉBJ J J ȉ‰%@@@@ ȉ ȉ ȉсက ȉ ȉ ȉ ȉʼn% ȉ@@@@ ȉс ȉ ȉက ȉ‰%3333 ȉ ȉ %ف ȉ ȉÉ%33с33 ȉ ȉ %с ȉ ȉʼnڃ% $L$D$$D$Ãl$ \$EM M M ȉEM M ȉʼn # #C  #C #C у #C #C #C #CÃ\$T$ %J J J J ȉB%J J J ȉ‰CCCCCCÃD$$D$D$?D$$D$D${Á`$d$h$|$X|$$T$ $ L$$\|$l$$l_\$OW w$d;ω}7yZ1#|$1L$t${ω}yZ|$1!1t${ω}yZ1#|$1L${ ω} 7yZ|$1!1t${ω}yZ3|$!3|$t$;l$";ω}7yZ1#|$1L$$d\$}3}3}3}lj}yZ1!1}3}3}3}lj}yZ1!1}3}3}3}lj} yZ1!1}3}3}3}lj}yZ1!1}3}3}3}lj}7n11}3}3}3}lj}n11}3}3}3}lj}n11}3}3}3}lj} n11}3}3}3}lj}n11;l$ !}3}3}3}lj}7ܼ11!11}3}3}3}lj}ܼ11!11}3}3}3}lj}ܼ11!11}3}3}3}lj} ܼ11!11}3}3}3}lj}ܼ11!11;l$}3}3}3}lj}7bʉ11}3}3}3}lj}bʉ11}3}3}3}lj}bʉ11}3}3}3}lj} bʉ11}3}3}3}lj}bʉ11;l$!$l_OW w<$9$d7`ÃD$D$ $l$t$^NV 1!1׍8xjE؉1!1ύ:VU ‰1!1ߍ9p $Mщ1!1Ǎ;ν] ˉ1!1׍8|E؉1!1ύ:*ƇGU ‰1!1ߍ9F0Mщ1!1Ǎ;F]ˉ1!1׍8ؘiE ؉1!1ύ:DU$ ‰1!1ߍ9[M(щ1!1Ǎ;\],ˉ1!1׍8"kE0؉1!1ύ:qU4 ‰1!1ߍ9CyM8щ1!1Ǎ;!I]<ˉ1!1ύ8b%E؉1!1ߍ:@@U ‰1!1Ǎ9QZ^&M,щ1!1׍;Ƕ]ˉ1!1ύ8]/E؉1!1ߍ:SDU( ‰1!1Ǎ9M<щ1!1׍;]ˉ1!1ύ8!E$؉1!1ߍ:7U8 ‰1!1Ǎ9 M щ1!1׍;ZE] ˉ1!1ύ8E4؉1!1ߍ:U ‰1!1Ǎ9ogMщ1!1׍;L*]0ˉ11׍8B9E؉11ύ:qU ‰11ߍ9"amM,щ11Ǎ; 8]8ˉ11׍8D꾤E؉11ύ:KU ‰11ߍ9`KMщ11Ǎ;p](ˉ11׍8~(E4؉11ύ:'U ‰11ߍ90M щ11Ǎ;]ˉ11׍89E$؉11ύ:U0 ‰11ߍ9|M<щ11Ǎ;eV]ˉ׃ 1ύ8D")E؉σ 1ߍ:*CU ‰߃ 1Ǎ9#M8щǃ 1׍;9]ˉ׃ 1ύ8Y[eE0؉σ 1ߍ: U ‰߃ 1Ǎ9}M(щǃ 1׍;]]ˉ׃ 1ύ8O~oE ؉σ 1ߍ:,U< ‰߃ 1Ǎ9CMщǃ 1׍;N]4ˉ׃ 1ύ8~SE؉σ 1ߍ:5:U, ‰߃ 1Ǎ9*Mщǃ 1׍;ӆ]$˃@|$_OW <$9$Á$$ D$$;D$$$A$$A$A $$A$A$$A$A$$A $A$$$A($A,$$A0$A4$$A8$y<$|$$9$@1ɋ$R101ҋ$m181 ދ$R1(1 ދ$R1ۉ1 ΋$@1 ΋$@1 ΋$@1 Ή/w$$9;$9I81È[ ˉI?1ƈ.v 11މI11Ήl$t$ I[=1 ˉI-1.v 11މI11Ή,$t$Iȋ[,$l$l$l$ ˉ_$9"$|$$9$.1$$ ˋ$21$$ 11ދ$$$)1 11ދ$ŋ$Ƌ$$ы$!Ћ$!ы$#$$#$11ދ$$IΉIΉ$$$$$"1 ˋ$$1$$ 11ދ$$$'1 11ދ$#$$#$$#$$#$11ˋ$#$$#$11މ$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$9 $$$H$$H$H $$H$H$$H$H$$H $H$$$H($H,$$H0$H4$$H8$H<$;D$(Á4$8$< $$8;$ $@8$@@$,$@@$($@@ $$$@p$@@$$@@$$@h$l$D$D9sP$8$8I ȋ$8I ȋ$8I ȉE$8D$D9r$9skEM ȋMU 1ȋM1ȋMUȋMU ыU] 1ыU 1ȉE$9rh"$\$$9 ȉ  1ȉ 1ȉك ȋ$$ $#$#$1ȉʼn ȉ  1ȉ 1ȉ#$,#$(1ы$,#$(1ȉ$$$$$$$$($$$,$($,ύ$9$@8$@$,H$@$(H$@$$H $@p$@$H$@$H$@$H$8;$4Ãl$ \$+\$T$+T$;\$vJ]Uà D$(\$t$|$D$%3)11҃|v }Vu2D$%t tؕҋD$$PD$$( ى )ى Љʼnى볃 u몃@}ك똉ڃ "щʼnщ )щ ЉmD$(0$$,$$Q D$$D$\$ ÃD$ %tX|$tED$؉D$D$ ЉD$ D$ $$ <D$$$}<-#ËD$ ؉D$ ËD$ $$ <D$$$}<ÃD$ $D$D$UÃ0L$DT$HD$@;D$8wD$@;D$8u2D$<;D$4v(t At L$8JL$4 0Ã|$@D$ D$81t$@D$$$D$%tdGO 9rJBT$,$|$<|$(T$,^u‰<$s't $Ë^GGB B1%<^/t(B%^/ %<^/u*ED$0D$0hB}ؕ.B*D$0D$0pB 1t@u ؃@u B׃㿹BJ 9J $T$9t$(l$\$T$D$ El$;l$$|ƒD$D$9tuZD$ t;D$;D$$}1BJ 9r/ $T$8T$D$ D$D$;D$$|ϋD$ ËBB ۋBJ 9r/C\$$T$H8t$(\$T$D$ D$]BBC D$IBJ 9r(C\$$T$7\$T$D$ D$‹BBC BB Ez1<|ED$ ^\$ t@f1Éȃ@t @%t IQɃ@뽁$$$%+@D$0D$4D$4u D$0-=9D$9t$~,$C D$L$L$t$l$T$\$,S Չl$)넋Cك9tHt$| Ct'$/t$l$\$,TECu͋ $l$t$t$=t$l$\$,ƒuCu CT$ \$t0CK 9r@BT$ $\$T$ \$uЉ$~t 1CCB 랃l$ \$KS 9r,$\$IËKCÇ%D$ L$ $L$L$D$*Ãu1ËL$ $L$L$D$|ËL$uËà \$1ҋl$l$|$~!K S9r_$yl$\$ƒu4u ;l$u1 É$iu|$tD$D$ ÉEl$L$ t됋C C %롃\$K S9r $ËC C %T$uPD$Lh"s"t)BuT$$T$t s"u׋D$D$Bt Bttt1øJtYBJ)ȃt# $JL$D$ D$T$;D$ uBBB B1BtBËB륋D$@u1D$@u1_ƒu1ËL$D$ au5R<$T$D$D$D$ D$ET$u1BBBB BBЃÃT$D$u Bu É$ L$uD$At0Qt(AAA A$CL$Au&|$ kL$}D$AAD$Ã|,<<t <T$<ыT$J}ԃÃD$$}ËT$Bt tBJt B-HY$Z݄$\$t(jB$$ZD$%E$d$D$%=uV$'|$uL$t,r/ƒtJtЃЁİÉЃr/\$u%$r/tA ЁİD$$$L$$L$ $D$PD$%D$\$,d$0L$0?D$,0; ,g8@1$L$D$ 4\$4D$4$T$$$|$ fD$l$\$l$ L$D$t| $)HzDŽ$D$d?DŽ$L$`L$|L$d D$X~ D$XD$p$  c Z # 1ۉȃ9 Cȃ9~HY$$t$|$ZD$D$ | ] $| $\$l$T$h1t$Dt$@|$pt@$6+$$L$d $\$lT$hƉD$@~ |$d0$~n|$p~<4$T$D$@$L$PL$D$LD$P$aT$hD$LD$P$)ЃtL$P $D$D$P $y$T$`D$<~L$< $T$e$T$`D$<$}!|$uD$%D$\T$|1ËL$fM<|$u1҃}fU<B| -C1ø +à h`u $ $8.(L$fh`É $ h`t $h`ËT$L$t9utAA݃h`u'$ $:.(L$‰h`#= $L$T$u1É4<$:L$d$:L$SD$D$L$ $輢f8<=<<L$ $:L$D$$ D$T$=t*ȃL$ $,L$L$ u4<1Ã\$|`|VÍ  <t؍  <t/R<$\$D$D$ D$豸\$$L$ L$L$$L$L$(L$ L$,L$裸D$} bL$ȃÃL$ $L$L$L$ L$D$ D$Ã\$|Wt~9tуu1ËD$ȋJ$%D$à $X$\$ u $%É |WH|WÃ\$ 11҉T$CtaSt B:uuST$$L$ L$ L$T$D$D$ u|}  ЃùL$ $JL$ƒu׹ЃD$$D$HD$l$\$KMbUC1D$ t$ iEKMbUC1D$ t$ iE à $L$L$D$D$ [ÃL$ $L$L$L$L$D$ 0à $L$L$L$L$L$L$ ÃPL$T $ƒD$\tl)D$D$$2D$4D$D$D$ IL$ $7ƒt"у$Iuu$g#1PÉ$Y#PL$Tƒu^PÃ~9t $Q̓|$`tD$`$T$T$T$|$XtT$$WT$L$XD$T$"D$TPÃLD$ $9L$TuB$D$(D$,L$P $L$ L$7D$H} (^L$HȃLËD$(AD$,Á$ $6$|u]ĔDŽ$<$8$`}G$8t$ $7$|ŃuV$$8$`|$ $$}U]$|$!$ĔÉI[9u9u FM9t ,$f!wMf9uFM9uݍD$$h $D$ J1҉L$ꉬ$x RL$ $<$8D$$h$ $$<L$`7$$$8I@L$$}$x$ $$$D$D$D$ D$s$$u $sDŽ$DŽ$R<$$D$$D$$D$ D$ $$$D$z$$s$|$1ĔÉ$/L$萄$u D$D$5$T$ȉ$4)ЉD$$$4L$5 )/)D 6$D$D$诮D$5f;- $VT$ u;- ;- $5T$ BBu$;- $T$ BBu;-J;-J;-J ;- $T$ BBu(;-JJ $*;-L$趌u D$ .;-H11à \ =$18D$D$D$ \ = ÃLh"s"t AL$s"u1ù + $D$H|. +9uA09tu1À븹 + $BL$L$T$Ãu AY1Í<<BBBB BBЃà L$ u A t tuAD$ $D$D$@' $D$;|WR<$L$L$D$D$ D$D$$D$ D$D$D$$CD$ ƒ$tT$$UT$$$ƒ$tT$$(T$$A$D$$D$$t@L$ $D$$$AL$ $$–$A D$Ã0D$$D$D$04. $D$|9D$$D$D$D$D$ D$荭D$$L$ $.L$4ƒtЃ0ÃL$ $0u1ÉD$H, $3L$L$uD$ D$$D$ 1\L$` $T$`ue$L$dtAAA A WAAAAAAAA1\V\ÍD$$T$D$D$ D$6D$D$L$` $L$L$9L$ I}U\ÍL$ $D$L$yL$dL$% $D$L$yL$dAL$* $D$L$]yL$dAL$/ $D$L$9yL$dA 1 }:l$XjL4 $D$L$yl$X\$d +AE |1\T\Á$ $$u3$ $uVĈ1ĈÍL$ $3L$ L$JL$ JL$J L$/$1ۃ }K$L $Σ3L$ډ$$ IL$$$C |D$$$D$D$D$ D$D$uJD$uA$ $L$L$$L$C}PSĈ1Ĉ6SĈÃ@L$D $Mu*L$D $@uV@1@ÍL$ $գ3L$L$HL$D$D$u5L$D $L$L$L$L$} zJȃÁ` $h $D$r9|%$h $}4J` Ë$h $"t$hV` Ë$d $"$P uI` Ë$d $/L$r$X $h $/L$r$X $h $d /@ƒ@DŽ$\ )؉$T )9u$$l$)ىL$s$d qDŽ$ $D$ˋ$ ($h $L$$P IL$蓟$\ $ $\ |,$ $L$ L$ L$<$\ z$ $o$ $`$\ ~1Ƀ$\ u%$d $}/H` Ë$P $p $\ ` Ë$ $L$ L$D$8$\ 9$G$ $輊G$T $U$ $"$T $@ $d $$ L$!=[GDŽ$\ ($|$0t$,\$(|`|V$Í  <tԃw1$ÃuV $Ëi l$u?u:$t$|$L$4L$ L$8L$0D$ } FL$ ȃ$ËtV $Ãu0$-K|$0t$,l$\$(tV $É$t$|$l$ kP됃L$ $L$L$L$ L$D$ D$à L)D$T$ |)uL)T$;T$u lT$$ԆT$uL)BЃ à 뷃D$$胛L$AuA $豛p\$‹C u>SS T$B$脛L$ $L$ʇtD$ÉP D$$T$Bu 蛄T$Zt?\$KJBuB $ L$ $E#L$Pt B$ݚ ÃL$ $觚L$u1ËAuA $褚É $蓚1à T$uV É$цl$}EDl$1ۃ/<@f@f@ C~1 ËE|E`|V ËE|E`|ۃ@B $}V Ã8L$< $(u MC18ÍD$$L$ L$D$JD$ ${D$%=@uV18ËL$< $D$} B18ÉD$4 < $uV18ÉH L$4@@@@@81WT$uVË $-} ËD$@$rD$$f1ÃL$ uAAAAA$)L$ AD$$D$D$D$ D$D$u D$s AÃÃ\$uV1ËCK9CK9|7C$T$B $уL$\$CCC}C$U\$CCu1Ës CD$ 1} CK9|"CCC KȁCÉl$t$$CC@D$ @,D$D$ojt$L$\$ƀEs(\$,T$0ЃT$ %p$D$3/l$,L$0\$ "%tV(É%tȃ,$\$Ã\$$} ?\$$  <L$0Hf@D$f@ L$, $@D$L$ $?\$$T$B B tB $D$,D$\$$T$Bt/R<$\$D$D$ D$\\$$؃(ÃD$4I,$\$L$~%t ȃu)$T$WÃD$$}>\$$҃D$$$ÃD$\$ D$%=t1D$$D$:u 1D$$|$ }L$$ÃL$D$ $<$t1Á|$u| 1|$u 11Ã0L$4 $L$ L$(uV0ËL$4 $D$L$8L$D$,})=L$,ȃ0É$1\$ TщT$95,<$l$ <t@L$A<,<$L$At W|L$A ںȃÉà ) $؉\$L$ $ $+|$t$l$ },<$聒1ÉD$‰<tZ2RMu2,<$CD$L$@ ںÉ$*D$uʸ,<$ 1B 1à L$u ÉʃT$B= ںt 3{T$B <D$,<$a\$T$ K,<$莑 Ãl$\$ u $ ÉT$ B= ںtzl$\$ T$ D$9rÉ$u1ÉD$$D$D$D$D$艏D$$D$à \$(  <,tV!D$$@ ÍD$$\$D$,D$D$0D$ D$4D$訐D$u D$s!:L$$D$D$A VÃHD$$D$TD$D$LD$L$ $L$T$PD$D}V"HÃt1$ND$ L$D $L$PL$L$ L$|L$D| $$1HÉ $$VHà T$(\$$1҉T$}oD$YD$$L$$ىL$u?L$ $L$L$p;L$D$D$$D$D$IL$ȃ ùu*D$ L$ $L$L$;L$ĉ$T$;L$y뫉$o\$$ƒD$)V ÃLL$P $L$ L$@L$ǎ}1LÍT$ $ r0T$ $谋T$ЉD$T$$p$T$gjt1LøL$  < t1à AD$L$ $t @ øÃD$D$D$D$ L$ $L$L$L$ L$*+t^D$<D$f<D$f<1S-$D$D$"D$`,S-<(X<<1ÃD$D$D$D$ L$ $L$L$L$ L$*t^D$<D$f<D$f<Y.$D$D$"D$\`T.<4X<<1Ã$ " $D$D$$L$ L$L$D$ }V D$$i!D$ $ÍL$ $8uD$ ڃ$' $D$oxD$$L$ L$L$)D$ }~5D$$pxD$ $ÍL$ $tD$ ڃHD$$D".D$L$NL$ $D$D$@$L$-L$L$D$D}4D$@$x D$DHÍL$- $GtD$Dڃ3 $D$q}1ÉD$$L$L$L$L$yD$ L$T$ @D$$ |$ |D$1< $L$vV ÃD$D$D$D$ L$ $L$L$L$ L$'t0D$ <D$f<L$ $,< <1ÃD$D$D$D$ L$ $L$L$L$ L$z't0D$<D$f<L$ $,<<1à D$L$ $t @ øÃ6 $D$u}V1ÉD$ $L$L$L$L$pL$ }V $u1É $uL$u $6D$SL$ȃÃDD$Pu D$LsV DÍD$$ D$LD$,D$PD$0L$H $L$L$ }2D1DÃL$ $ u1ËD$$L$ L$L$  <D$D$ $ 1ÃD$(D$ $;uD$ $D$tD$ \$ tD$ \$D$ $PT$(\$ D$u8L$ \$D$%d$L$?D$ÃL$\$ uD$ $D$%Á|*V\$ v ز;|n2Ád$ D$$à \$,\$$vF\$$v.d$$$\$L$,\$-#d$ D$$ D$$\$D$%)!D$D$D$D$$d$ Ã5!D$Ճ $0D$} /L$uBL$WȃÃ(|$,1ۉ\$1D$4q  <ƒ|`|t V(ËtۋD$0( t.t"t uj뱋 ȉ롋*뚋 t<뉉T$BD$Ã`}  <`u D<$\$ \$kqt$\$;D$ t'l$}W.l$V  <L$HNfHN fH CV1MB ȉBtt  $@" $L$L$a$D$É$1`}]  <$ȃ$,$Kp$$$AE`|D$9v#$$D$D$D$)L$$$o#" $L$L$萃$$|ND$1ۃ $9$$D$D$D$)L$$$ko$($$1"D$$($ $ $$=L$ $tx9tt$)Љ=|$$T$$L$$$$ $L$L$[$}N$ $ J$  $$$L$$K+$$$ $~$19}+u+C9|$$l$$t$$$19}+u+C9|$$m#< B=u $$\$'*$B Cȉ$>$$l$)B $$L$)B $$IL$)$C D$ى$)$$D$D$D$)L$r$D$É$ L$ $L$L$ XYL$ à L$ $L$L$ XYL$ à L$ $D$D$ à \$|P`}KD$9u  <u($L$ $D$L$L$ É؃ V Ã|$ t$l$N fE[fUNfMt SF% fM@fEfEfE tF$E F(ENMN MN Mt GF0D$ L$ $L$ L$D$t D$L$fHD$@4D$ L$ $L$ L$D$\$T$ tL$fK tKfJK fJ OfMO fM GU U.|t&stMt fM fMfMfM $D$q1ɃL$L$> $u1$ÉD$ #1>#9|>#)B>#9}>#AM UE úFl$}щT$I $T$l$JۃL$ $8=L$gÃD$ T$<u T$<D$D$<t!9D$|8A9D$}/<D$D$L$ $L$$L$L$H Ã봃L$ $0=L$aà D$$t1D$rl$\$M I t1B B K KM I u1BKB K K؃$E D$D$ $D$@dD$D$$D$@dD$D$$D$dD$sT$L$Bd|A2A0ȃ$BdD$DD$ ÃL$ $TJ=L$ËD$Ѓ)ЃunømÃl$\$ E |&gfff‰Й$ <$Ѓ0Eؙ$ <$Ѓ0EÁD$$D$D$q9u1 $D$}1<<$Gu1D$p<ĤÉD$ $L$L$L$=}D$ $UD$D$L$ $<L$yL$ $<L$[L$ $<L$q=L$ $<L$1ہL$ $\$ <L$\$ <<uĤC븃t$ l$ t t1ۃ} t4 t/EC| t u E1øøà |$l$1UE-uF t tu 1 1ۃ t) t$0|.9)ЃЉËUE u׃tۉ1 ø à L$uQ<L$ $g8D$ D$DD$ ÃT$t $1@t$D|$Ls1@Ël$Hl$PBC뜋L$I, $!L${.l$\$Hu!@$T$@*@D$LL$I, $!L$5.D$(D$@؃T$;T$s)T$$L$ L$ L$D$;D$ uËT$  B=뷃$=UuY $Q$$L$D$0L$ =Uu$ø<$yP|$(u1$ËU$P5UFFD$FZ~E4$V (L$=5UueU$P$ËL$(  <D$L$ (HH@ D$L$(H =Zu 2ZT $dPD$=`$=P\`=$o<1ۃ`}!;\$(t  <u}C`|߸$`D$<D$($D$D$D$L$HD$L$HD$U$vO $D$;`1$É\$ $;\$ n'D$ D$ $`D$M L$  <D$u ËU$ND$@ U$ND$@$D$% ÃD$ @D$U$TNUT$ BL$) mBJ97ЃBB$]ND$ L$ $L$ IL$ L$\D$D$ @ u $|$u D$ D$ |U$MT$t$l$ UE Ct"@!ЃEt4E$MD$ $D$9$Ct@!Ѓu $BMC$1MU$D$D$s9C$MU$D$D$I9hUUEEt(E$LD$ $D$9Ct@!Ѓu $xLC$dLU$D$D$8$>LB$-LD$ $D$q8$ LL$  <A ttNL$u |$$U$sKUT$BJ)ȉu\B t$K1B$KD$$D$7U$KUT$BJ)ȉu $:K;L$ ~L$ D$$BD$L$ L$I-U\$ T$Z)BJ9u Bu,$JD$ ÉЃBBB,$JD$$D$ 7VÃ(L$<|$0t$4l$8@iD$YMb‹L$щL$u G$|$0t$4l$8|$,`|D$,`1;\$,}pك!Ѓ  <u*\$ $9|$0t$4l$8\$ t (C;\$,|D$$tAu F1;\$,}&ك!ЃtD$$C;\$,|ڋU$H-UED$EEEEE E$1;|$}+  (@ ÃG;|$|Ճ|$$WEu E}|$8|$<tL$M =Q -UE,$mH U $D$4|$$-UÃ|J 4 <@ك!ЃtMكT$0 EEEEE E$(É@ك!ЃtF tuكT$8 -UEEEEE E$,$8GD$$(ËEwEkE _E$tRD$|$8t#T$8ك!Ѓ|$0T$0ك!Ѓ|$u F t D$$كЉT$0!ك PtF tt8كЉT$8!ك P2D$D$$!Fp;ك!ЃGpt#`FTFHt$E7E+E~ $WE1(ùL$D]à Q~ $D$lÃT $#EQʸD$D$$`D$ $A;D${1Ƀ`}L$ $F1L$ A`| $D$0tU@ $yD=D]t D]ڋU$C UAt A = =uA  = $DAA  = $DU$D$E0nL;$8C $D$0tÃQ$ D$Ã=`t-w Z9tu`؉$ D$ɳà Uu É $/1ۃ`})  <‹t  C`|U`ZQ Ã=[t$D$g$?/1Ã\$vNd$\$3\$s \9D$$C\$D$$-#t$3\$sD$$\$D$$t$ÃDD$\$<\$Hvd$H\$H\9\$L$H\$ D$ $<0\$HuD$@$1u0tH$:Cxt CXC-D$C s t  l$,T$$D$1$1   | s-K+?0 0| 9a| zA|Z~s9|T<$uT$$|$(tD$(t#V|$t ø Ã|$t؃ É É9}B$`˃놉˃é|˃rBxt BX*u0t8$*Bxt BXB-D$B _ t rD$$D$D$,$$$tCL$uuUBL$uJu 1É D uBuIM؁ÉBU؁à L$ $L$L$XL$ Ã\$ D$$u؃D$$$D$ D$+Ńt8T$$uC9t A $L$ L$*Ńu1BŃ T$|$u$D$* D$$L$L$~*ƒtBD$D$ Á D$ $D$D$*$$D AuBL$ tJt Ё 1 Ãt$l$\$ 19s.CEuB9s CB9rB9r҉à t$l$\$~,F EK9t9v  ø Ãu1 Ãl$T$ ֋\$BuJBEt K}BÃ$\$(L$(T$, D$D$0D$D$t \$ ;\$r#D$t\$(;\$s+D$($ËD$%tCL$ D$D$D$ZM= BtUtGAtCL$ 뮉$L$L$,54L$L$4IL$ L$zL$q$L$L$D%L$L$4IL$ L$=HtHIsD$4Pu) $L$L$T$L$  ~׃ ҉$L$L$L$4IL$L$ $L$L$L$4IL$L$ WStvUL$4I $l$4)Ãu1ۋE9}*1ҋL$ $L$L$T$L$ &+M)ٸ$IB뽉$L$L$L$4 L$L$ L$4I $<l$4)Ã|E9}*1ҋL$ $L$L$T$L$ M)ٸ$IB뽃Xt:Y$L$L$L$4IlL$L$ 49$L$)ىL$k?9L$L$4L$ \$  L$4I t2$L$L$R-L$D$ L$U1σmFctvat=b$L$L$T3L$L$4IL$ L$m$L$L$#L$L$4IL$ L$9$L$)ىL$I?9L$L$4L$ \$  dt5jA$L$L$L$4IAL$L$ $L$L$L$4I L$L$ $L$L$L$4IAL$L$ uzpw|xtIy$L$L$D$D$4@D$ d|$ D$T$L$ $L$)ىL$^?9L$L$4L$ \$ $L$L$L$4IL$L$ L$4I }/1$L$L$3L$D$ L$̃T$L$ |Y;L$$}S\$ $"T$L$É)9~)ˉ $L$ T$D$\$ \$$L$T$  ?@Ã|$t$ \$|SD$)9|I>H9r.ؙ$ <$Ѓ0Mgfff‰9s҃~*7?@à \$l؃؃Ł~6ف[Q)ՉفQՁ~$<$Ѓ ÃL$ $!@D$$誐t L$ $D$D$D$D$r"L$ ȃÃL$ $L$L$Ãl$ \$E C9t9v øÃu1Ã<<,Zt<XD$1$4$уuGdU˽_}RɉG^‰։ؙ$ȭ<$iۏiG )˃}|<<E_|Ã,ZX,Z<<s'u$4,ZX| <<s| ,Z %X%Ãl$\$L$|$ +虃ʼnʋ3؃ Ѓ0MÉވÇމC BȖM׃T$ $T$T$L$ыt$l$\$}<4$\$Ճ}D$ËT$ $T$T$L$у}D$܋D$ ։4$\$Ճ~D$‹T$ $T$T$L$у}D$ 뢋D$뜃T\$`D$XD$PL$PrكdQ1ljD$,|$\L$Pڍ D$8D$D$\D$T$P 9D$8ssT$8;T$Pv&)ى $T$l$ L$눃(L$,D$0ËQA؉\$@ËI\$9~ B\$9$T$|$0D$l$19}A9|\$,L$,Iƒt[ )D$ 1 ؃L$ 9rމEtD$D$L$IHD$,$D$(Éك 9r̃T$|$ Jo)tȃÉփÉŃM9t U9s ø9w1Ã8L$< $L$@L$T$<u$@@8ÃHыT$@L$@D$0T$@$$1{'1A$,;@L$LT$HD$P|$Du |$5X%D$%t;u @É$D$8D$D$)D$8t @ËL$ $>L$Du @Ãtd$uD$u '1D$D'1D$\$<$'1L$|$Dt$Hl$<t |$ |$ t-1ۃ}& [ $;D$ u [, $C|ڃ|$u&l$<,$'1L$臧|$Dt$Hl$<tLt@t8t,t$,$|$t$L$L$ L$PL$@þ'1տ'1'1뭸@ËD$t*t'1D$D'1D$DD$΍|$%@ÃD$$8ÃT$ڃ w <3u g28Ë3ÃL$ $MƒtfT$J, $T$rNJ, $,D$h<$ D$"D$D$D$ D$$7h<É$7ns1ÃL$ $oMƒtZT$J, $T$rBJ, $蝲D$<$ D$ "D$D$D$ <É$L7r1Ã(- $L$蒵D$$$L$"L$L$ "L$8D$$$腵-$0 $1ɃL$ }!- $L$D$$|$$|P|$$}(ËL$$ $L$3"L$L$ 8"L$} D$$$(ø$8L$ Ao"D$D$$"$D$D$^$J6(Ã(T / $L$L$%!}T / $L$1(ÃD$tV)ËL$ $,Ã,L$4uD$D$0$L$4L$>\$4[tBK9u B 9tuЃ,Ã0L$4 $L$ L$ƒu( $3ƒu10Ë [[ЉT$,$D$pD$ D$,$D$pD$D$,ǀL$ HL$Hǀ|0Á$ $L$L$L$)}%$$i[V(ĠDL$ $D$D$D$$D$@4.D$$D$ $L$}L$ $L$/$$$Z$}%$$ZV(ĠÍD$$D$P4.D$$D$ $D$$ $$ƒu%V($$8ZĠÃtЉ$$D$pD$$$D$pD$$$H $H$H$D$D$$ĠÃ,D$0ttV%,ËD$4tV%,ø_4.D$c4. $L$M-ƒ}m,É$L$L$L$0L$L$4L$ L$8L$D$:,ør4.D$v4. $L$,떍L$ $(}m,ËL$ $2L$0H L$4HL$8HL$ |D$,à L$ $D$t  11Ãl$\$ t:CE 9tA|Z~A|Z~ 9tЉ)ȃÃE1)ȃÃ|$ u D$$W1ÃL$ $L$L$L$L$L$ L$ YÃL$ $L$$L$L$(L$} ËL$ $L$L$L$L$L$ L$ Fà D$tV) ËL$ $L$L$L$L$r à D$tV) ËL$ $L$L$L$L$% ÁD$H $=L$$8+$H=&$<D$ $t/D$葾D$$$HD$$<D$詔D$$<L$ $L$ $@} D$8$8 $$@ $$8L$$<D$.;$<t DË$@$U1DøDøDÃ01҃}R<<rT$u10ÍL$( $s%T$8}10 r3D$(D$$ rD$,D$ 9\$D$tWD$ [ <D$$ [f <[f<D$ $TL$$ $L$8L$T0ËD$$$TD$ $L$8 rusD$?Z}L$ $OTL$AZ|6$6D$6D$D$4D$ D$>$Qg\$110ËD$(D$,BoL$ $D$D$$\$1}, i <9uh<<uE|ԃu1Él$hf<<u|L$ $l$1ۃ}2 [ <9u~[f<D$ [ < i <9tuu: i <h< i <ËD$CfT$ T$T$J J J ȃÃ\$ D$‰BBZD$ÃD$ fD$D$J Ãf\$ D$ˈJD$ÃL$ $L$L$VV Á`$dAtV)`ø-$X$$D$跹$ $/L$u `@$-D$|$D $f!} `Ë$h $ <$P$D$$hD$<$D$P$h$$$D$-3$d$&J$$JX5tT<$謺 $D$蒧t`$H$XP$P$IP1`Ã=`3$;/` $ `L$$t䍌$ $L$$$d}$#1`É$$XL$K L$KL$ KL$$\L$$L|$\ $虷D$$H $$\L$L$L$b$H $L$ L$L$w9$L$O-D$D$$`D$$H$N$P$N`ø-$X$ $D$ƒuV$ĨË@ ttV'ĨÉщ$ $L$F"$$}VĨËB $ЃD$D$D$ $D$z$t$D$$-D$ҵL$ $讵D$$ $L$L$L$L$$}V)$FMĨÉ$2M$ $$L$FĨË$ $-L$L$e}%V<$$LĨÍD$$D$-D$$D$ |}V<ĨÉу $$|L$ }"`$ǀ|ĨË$ǀ|1ĨÃ(|$0uD$4DF=1D$D$D$DF=T$ $=L$Ŧl$\$D$؃uPU18ËD$f<19} g<6=B9|6=<<f<<6=<=<u f<<=<u 6=<<819}f<6=B9|6=<<zAL$$L$ $"L$,L$T$$uN=<u<}AL$f<t uvBkB֋L$ $"L$較L$T$$u}AL$f<띋L$ $"L$胃T$${$:L$֤T$$t9 $T$T$ g<L$:T$$1D$( $T$T$ f<L$T$$D$BDF= DF=$D$m"D$L$ 8fDF=$D$z"D$L$ >DF=$D$`"D$L$ $ $D$$uV$ĀÃp~VĀÉ$|$$D$T$/$$|C ttV'ĀÉف $L$$|$t}NĀËB $D$D$&D$0D$ $hD$$|A $ȃD$D$D$ $lD$$|'($l$_$ D$'(D$D$&D$ $hD$L$$lD$$_ $谡D$$t $$_L$L$L$} M$t$J9ĀË$t$/91ĀÍ$_$ D$'(D$D$&D$ $hD$L$oQ'(puJƀ|}V<ĀZD$$_$ D$'(D$D$D$ XXD$$_ $$||L$$|}ǁ|Āǁ|D$V$ȃD$L$V $L$ $p} QL$_$3ĀÍ$_ $ܟD$$p $$_L$L$L$}/K$p$v7$_$ĀË$p$L7$$D$VD$ D$D$V$$_D$D$V$l1ĀÁ$ $D$3$uV$ĨÃp~VĨÉ$$$D$T$ϟ$B tt 1ĨÉс $L$z $$}VĨËB $ЃD$D$D$ $D$$D$$D$.D$$D$ AL$ $۝D$$ $L$L$L$L$$}V)$s5ĨÉ$_5$$ $ȃD$$D$+.D$ \D$$$.D$JF<$@ $D$9uV$<Ë@ ttV)<É$,AtV%<ø@4D$$@ $$L$L$$8$8H<Ë$8Ƅ$ $L$($,}^H<É$L$L$K L$KL$ KL$$(L$ $4}H<Ë$@ $H4L$L$} $4$^3G<Ë$($$(D$$8D$K4D$ Q$Dt3 $$(D$$8D$5$H$8$4<øD4D$V$,||V<<Ë$@ $$L$L$$8$8} <Ã$8t$8ƄD$$$D$L$ $L$=$4k$ $D$$4 $$L$L$L$B$4~k$`$4$,$($(u$1<Ë$(J H $(JH$(JH؁<É$N1D$t t]\T$ |$,tT$J $T$L$,|$$t%D$$ЃD$D$$D$D$(D$ 褸ËT$ |$,tT$J $hT$L$,|$$t͋D$$Ѓ D$D$$D$D$(D$ L릃 D$$$D$謘L$ $/L$nuL$D$$L$ݘ A$D$$$(D$D$$pL$ $L$$,$ } $/JD$ÍD$$ D$$D$L$ +L$ $ŗD$$  $L$L$L$L$}/C$ $b/$,$S/$Ë$ $8/$,$)/1$à $L$ L$L$ L$u ËL$ $.L$Kt 1ÁD$$$D$L$ $/L$Hl@$$D$轖L$ $D$}ĠÉ$$L$L$L$ÃDL$ uD$L$ $!L$rA$L$ $.L$Gu/L$ $:L$-L$ $ѕur$L$f$ $iD$L$ $DL$fAL$ $$L$At$$:-ĠË$L$ $ $D$L$ $T$ fB$D$D$Ѓ D$۳$t 뀃T$ J J J ȃà |$t$$D$19s&21ɋ$\$ ˉ$\$E9rڋL$$D$A Ã( " $D$fƒt6T$$L$ L$L$D$ D$T$t-D$D$$IL$,D$D$A(ÍD$$D$ D$D$T$|$$t$ \$\$ T$D$11O~@F =+ tteEOt9t +D$ É؃;D$v ÉCC̉@;D$v ÉC뮉؃;D$v  ʉCCCb V J>t$\$\$L$ VUUU‰@;D$~ øVUUUl$ D$ ‰׃~rFʼnF ʼnF ʼn >+C ? >+C? >+CC? >+OD$ $<$tit +D$ÉF ‰ >+C ? >+C? >+CC=‰ >+C ? >+CC=C=\4t$D\$8L$L$u$L$ $T$ L$;L$T$u'tBu‰Ѓ ÃuBB'tB1뙃딃 \$D$D$;D$}0t L$ $\$ L$:\$u3uD$ ËL$T$$L$L$D$뛉C띃 \$D$D$;D$}1t!$- $\$ L$:\$u4uD$ ËL$T$$$-L$D$C렁D$$$D$$D$$D$  4VtJ$`#D$L$D$D$ L$t|$u1$ζø$`#D$D$D$Y븃 D$D$$L$VЃ ÃL$ $ËD$?fP,$fXfP<$fX?ÛÛËD$@ÃD$b<$D$D$D$L$ 7VÃ8T$@L$<9w18D$L$ L$HD$D$D$D$ D$HD$$D$$D$DD$KD$D$8ÁD$$$HD$D$D$D$ $P$0$ $$LL$D$~$ $L$t ȁDøDÃD$$L$ $L$L$ L$D$ "'ÃD$(L$ $L$ L$L$$L$D$ &ÃD$L$ $D$Q'ÃD$(L$ $L$ L$L$$L$D$ jÃD$ $L$L$D$ÃD$ L$ $L$L$D$ÃT$BJ)ȃt$J $JL$D$ D$T$;D$ uJJ1ÃL$ $ ËD$@ËT$ l$EUU\$ M ML$ME1Ãt$l$ ~[Su <͘<ú<9s9u&<u Ér9u<*1Ã˸à a4L$ $L$L$pD$E4D$ Ã\$ <͘<¹<9s9uAtAÃ9r3T$7t59u%$L$ AD$3D$ @Ãu3Ã(|$4l$,\$0E$D$E(D$E,D$ E,E(1ɉM$\$0U 30p`* .tT$D$L$, $D$Ћ|$4l$,\$0}1ҋL$M$L$M(L$ M,Ѓ(Ãf؃M,^L$$ $\$0\$5|$4l$,\$0É\$0T$$U 3=7ot4t5t 6O10r9v.t&E,t M,u(M,u$KڍЃЉƃtC먃8t9떃EEp}E,te,E(qؖM,s1E,IM,@E172}) L$1҃}|} úف}$Q.\$t t$ D$ V.\$}Q.L$\$V.L$\$ρ4~|n2 Ãt$l$ \$|<}7.9r!9 10J9sE11Ãl$ \$T$*9r)؃0|19I9sE9ÃD$\$Fe}F-1t5ؙ$ <$Ѓ0L$ Eшgfff‰Ӄu˃u F0Ã~D$ MFXL$l|$hFuD$hf~L$l}D$lD$`$,L$tt0D$p'D$\$i8D$D$\X1\$`v d$`\$`BD$`$L$,%D$`$L$,D$(D$`\$4\$4D$`$D$(D$؋L$(L$D$ ̚-|$ fD$l$\$l$ L$L$(|$(j||$(sD$(=D$$؉$L$`\$,D$$+D$($L$,\$4\$4vL$(D$$+D$($L$,\$4d3\$4wD$(D$$+D$($rL$,\$41ۃ}KD$4|$ fD$l$\$l$ D$Ń0L$\ڈ l$D$l$4 d3\$4C|D$\L$lA|$hfuD$(VD$D$=$D$\D$~L$\D$(D$$A0A0ȃ$D$(D$D$\$D$X\$4D$4\$`D$VD$l@|$hfurL$\ $D$L$(L$L$\$tD$(D$(Ã}1۸+D$lD$(~D$pL$(AD$\L$\ XËL$\ $D$D$L$v\$tD$(묋L$\ $L$L$ItD$(D$\$D$(D$D$\$D$9\$4D$4\$`D$\$D$=D$v}D$$D$(D$$|$$ D$\$D$(D$MD$\$D$\$4D$`\$4v-L$\ $L$L$otL$(D$$D$`\$43L$\ $L$L$tD$(D$$D$`\$,D$p'D$\$i8D$|D$\Xà l$$EUM 1;\$(\$;\$,u;Ѓ9v',$T$L$) \$l$$ƒtuM Ѓ.Ѓ9v',$T$L$ \$l$$ƒt1M Ѓ0C;\$(uE)EU1 ø ø Ë]M 1;T$(}yT$;T$,u4@9v',$\$L$h T$l$$Ãt_M C.@9v',$\$L$4 T$l$$Ãt"M C0B;T$(|M)U]O ø ÃpL$tAA@\$hA,A,D$tQ(I D$,EeD$,~ g}1ҍD$M$D$h\$L$$L$ T$ T$D$HD$D$(D$L$ L$HD$MiD$Mn1C1͋D$$fgD$$e}1}1ۃ~ ߃D$u(|$$gt|$$hu9V)1t ,t$<|$4ډ\$8T$@|$(D$0l$0D$|$$e|$$gD$uD$t@$9"1҃|$(-t)L$t $T$q&|$4t$aRJK d SLeTJNVTqf \qg)Tj_j`=UU  ~m jk ^Tom ` =Uk\jMM`=Ui\jdXX"xY"no![)94IDIDO).@  )<<(~7 9=""""""TW8QX!$[.i#/ +ae"t80`8#yes`<+ANY`)"\1bbux"a)|)sH6NM61)?9O61(M168 4d1q1"$H;x33Z)c/;    1H7  h6pO#88L|J=l8@@)H~#A)0.5"%X "!%'L"#D-i1)$<<d3eN=-T4%d8/,9G) )t "/i/uu$iw$ )-)61c9Rxv"ž).)1o$:"Pi1M)"3k-D/4 "X<0@;61L6L6j# 3d"l-1i1 6"L-SV48?D}#sx1sD&9rMQ )I4S.startswith(prefix[, start[, end]]) -> bool Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.K# ;K#W  3  !""#$%&'"""()*+,-./0123456789:;<=>?@@@ABC@@@DEF@@@@@@GHIJKLM@NOPQRST@@UV""""""W"""""X""""""""""""""""""""""""""""""""""""YZ[\"""]"""^_"""""`"""a""""""""""bcd""""""ef""""""""g""""""""""""""h""""""""i""""e""""""""""""""""""""h""""""j""""""""""""""""kl"""""""""""""""""mn"""""""""""""""""o"""""""""p""qrstuvwxyz{"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""|@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@}~""""""""""""""""@"""""""""""""""W""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@  !"# $%&'(&)*+,,,--./0////123123123412356789:;;<=>?@ABCDDEFDGHIJIKLMNOOOPQQRS//////////////////////////////////////T//***UVVVWXXYZZZ[\]]^_`aaabcdefghij777kkkkkkkkkkkkkkkkfffffffffffffffflmnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn/oooooooooooooooooooooooooooooooooooooo//////////////////////////////////////////////////////////////////////// ////////////////////////////////////////////////////////////////////////////////////////////////////////// ///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// /////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// //////////////////////////////////////////////////////////// ////////////////////////////////////////////////// /////////////////////////////////////////////////////// //////////////////////////////////////////////////// ////////////////////////////////////// ////////////////////////////////////////////////////// ///////////////////////////////////////////////////// ///////////////////////////////////////////////////// ////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// ////////////////////////////////////// /// //////////////////////////////////////////////////////////////////////////////////////////// ////////////////////////////// pppppppppppppppppppppppppppppppppppppp//////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////qrstuv//////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////  ///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// ////////////////////////////////////////////////////////////////////////////////////// ////////////////////////////////////////////////////////////////////////////  /////////////////////////////////////////////////////// //////////////////////////////// //////////////////////////////////// /// ///////////////////////////////////////////////////////////////////////////////////////////////////wx/////////////////////////////////////yz{{{{{{{{||||||||{{{{{{||||||{{{{{{{{||||||||{{{{{{{{||||||||{{{{{{||||||{{{{||||{{{{{{{{||||||||}}~~~~{{{{{{{{{{{{{{{{{{{{{{{{{{||{{||{{g||j/qrstuv/qrstuv/////aaaaaaaaaaaaaaaaaaaaa////aaaqrstuvqrstuvqrstuvqrstuvqrstuvqrstuvqrstuvnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnooooooooooooooooooooooooooooooooooooooooooooooo///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// //////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// /////// //////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// //////////////////////////////////////////////////// //////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// ////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// /////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////// ////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////q/////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////qrstuv///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa     qrstuv////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////YW][a_jhomsqwu{yVgZl\np^txXir`vz|}~k@ABCDEFGHIJKLMNOPQRSTUVWXYZ\]^_`abcdefghijklmnopqrstu[ceƶƷƸƹƺƻƼƽƾwxvȩƢƣƤƥƦƧƨƩƪƬƭƮƯưƱƲƳƴ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ǡǢǣǤǥǦǧǨǩǪǫǬǭǮǯǰDZDzdzǴǵǶǷǸǹǺǻǼǽǾǿ@ABCDFIJMOPQRTUywߖՉ͓ߛhډYۉ]܉ڊ܋ۗSnȋKpݔӊے۔zF~hhٟןj\^pРf욫HEo\ޞޔe֕ڗE}XdVM[ǕYWESxQlk›{`KKdighBfݓR̋mnopd`t×ЊtȜxZH}}ŠJъGڞQŞxkIo~y{DLKSÍōʍ̍]aRV֍ޠҗۍꌯIƗY֖ŗחߌIrkP̝eDncڠSyj]cipjNJ׉MݞdoØŘfnݗҒa˘]̘i͘ΘbcGИјur֘٘Zۘݘm]MWߕÌƜJ~D@ɔӔFєNs“HKUN_Y`tUDˌVY[ČEC͕ɗPƕgvQs@Ozd~npS^\z]db͗dLɎT|UzȖÙ֐vpKǎTQǙDאCGXߞYBΙϙɒܗ]EyLۏLMzWޙRgޗѕJVIەʼndUԖ|MHI}PG؎ɐUXՐAZ\—\`EXcIknOFגuԓypx͑Joj_AONU͞yWΝҌYsќIC[ɞXFVx{֝OΉğԋrF{ƋWЉωщ~oNjk҉ϟӉgsNOxԉҟnoPWf։ޖpnl؉Yc@sىVqrėgihQoqRZ݉RSU[}hG~߉TzO}͟Ēoӛ՟UŒVܞqǒLh}WXazȐڒYZYʝmDuVyǚGӟʚZ]QԟyXWABNܔڕjFFGHޒSڛ~CRН럩ϝȝOTU֊_Қj‘b`^Ŋl~TŜ[\[WeǘŽԛdv`šsr̟g}oAJBgi}leNnߙT{wo}~xrq\t]މ^Bh{_`͛ӝLRÕtߗwTŕU~BŌQ\LkxOqe[P@MrsoArwxrKuڐgߐTaHygٌbc}skmu]LɋɟDdMhXsHtux`ab@ԌQeXfTΟuiONez{jSY@ACaFbkLʋzQTlaWpQ|ˋnafzkkܠhmqdКa[@M~rvnttqy|PyxݠuvtwÐyyv͋ZzEuFQ{|֞[|LŏÝJKMƊ[MxEVCǝ΋g~ۓcՓqdؓӓvbѓYRSMrPی~R܎PʌuYM^}GPh}iOV㜩D@Jj~|JEHGjQٚNDRFѠʟϒčALWޜBlX^{͔Z[^ƍȍǍɍpˍ\e͍΍_𓶟ύcЍbe۟fϋэҍqoӍ矽ПЋrыۊΕvbԍxvƘՍїBs׍؍OٍkΗڍZ܍Dݍ֠A՗JM˗ލߍ݌~ӕhdGE֗DPҕܜϕgЗҋِGcppol^TFcpQCZ~՛Úȗ۠БݏʒWQIv̜SIʛܒȂD_ӋGHUKLxQVaWfՋiILeXuSeYJǞ֒ԑ[S^ZŔ\tsFdhNeZԒiEȘɘʘmlksn_Ւqxzwyu]|DӒyq^jϘ٠MΠÉm{ҘٗĠvxӘԘq՘\DטؘݝژߝY\wܘޘŸkĘ͠ǏOԏĕnLOPFԔۖĔYɓVŐ؋hƔiڜrɉABב̔ތіՔДDcϔjILMsGPOIQRLVMʑWG؏X\SVO^jdٜ]PQbRhaY]fndSTpark@{W_sbXurZyxz\|}ًמBvgB}U`bac܌vpnopqrstuѝ׋ڋŽĎdeNˎߋΎώhikюlԎՎm֎ݎ]qer\ߎftvwyڝ\_cg|}~[aȠ˜w‰klJvHЌRwAIM䝵ThJBQFU͜xSocVvƟXHelb̖gu~fnE`ўbLǑ_mq˔ÖϠmrBw@D™\ęř{vΌƙ͖ǖaph~PӐVșəyIʙ˙՝z_͙ɠۚƠנǠCa^|ǟj|ERЙÏďƏ`љҙœә]ɏ ʏԙX͏ԠΏyЏ֙יʠX֏ؙӏٙ|EޏߏK̠ěLz{ڙˠHۙNܙdHܝݙ֟Ҡ@ĊȕZJ\ɕHIJћLM˕̕x|}~]ZPOTƨCE}`[۞ybUehlؕjnqJܟpcܕq^I[PՏsucԔwMxܖr@JؖKA@[AݑBCYDQvUEEKٖtEڑ_LzޑFylXfGIHJdߑyזCzۑjݕHKEM␴NO@CݖQNCRStTPVW̙YĐǐRېfҐkԐ[ċfސFQXP]z\|R^vƑtWߟ^ɌjBbiDCA`IJKdfgijRMf{klglmjlđwoURSU]qmsTqVmWƉljjW_][\^\Wer`^adAihtum`ޟßgvՕʞwxpoqcgzVښ~ޝP􋤟^}H۝sz{–ws}TpmAJAÑiȑɑˑȉݟCmt׌،ڌȣHoq1vq1}q1q1q1q1q1q1q1q1q1q1q1q1AADAFGAAAJKLMNOPAAATAAAAAAAAAAaAaAaAaThe error setting of the decoder or encoder. Subclasses should override. S.rindex(sub [,start [,end]]) -> int Like S.rfind() but raise ValueError when the substring is not found.cosh(x) Return the hyperbolic cosine of x. inflate 1.2.3 Copyright 1995-2005 Mark Adler "q/=0$_9@_fileno() -> int. "file descriptor". This is needed for lower-level file interfaces, such the fcntl module.Truncate file to size bytes. File pointer is left unchanged. Size defaults to the current IO position as reported by tell(). Returns the new size.H)B<AI;readline([size]) -> next line from the file, as a string. Retain newline. A non-negative size argument limits the maximum number of bytes to return (an incomplete line may be returned then). Return an empty string at EOF._NEN6777O*-X7xZ߈TkgCW777RN<.IJCH~J;D(ڗZٝ*(s-(sm+%<.IJCH~J;D(ڗZٝ*OsE+-Osݳ_NV7 7N77W7 ~7gp3xEN7y7sM7*7;g;7I7\;k:gj3xEN7lY7l7lWRNp$pppݳp p^2\$ k$kkk v"ݳ$ݳ T7\i$iii [p$pppݳp p^2\$ k$kkk v"ݳ$ݳ 7\i$iii [[ pspspppp=2=2///\/\ss=2=2DDDDD=2D=2D\D\\\kݳkݳkskskkkkk=2H\\\\\\"""\"\"""Oss33'''\'\''\\\\\\iݳiݳisisiii^2i^2i3i3ii))[[[ ٞٞٞ=2ٞ=2ٞٞ1\1`1u1uwJ``./`/u/u>IhwIK`K`D`k\``\׽"*`"-jݳ<`<`gg````ii9 `[`[`ٞ\ٞ\LMMMއ|\I߉\ښ7L/ٞL~"~ppkkiiisisiiiii$i$Ipspsp=Gsp=GsssD\D\DDssMMK/ٝKDDښ"$"$p^Gp^Gp3$p3$pp3$3$k3$k3$kk3$3$'3$'3$''i3$i3$ii8888"-j/PVVٞ`ٞ`p=2p=2\\ssݴsݴs=2=2=Gs=Gs[s[sP"PP~cp\\\ \!އٞ!އI߈I߈1\i\\\\އއ'\'\[\[\<1`wJP/އ/`Ihi`wIwIw`wI\D`fCC``k\Hݳt`Q׽j`"*`"`Jט'j'`'j'އ''``P`i9 `(ZZٞ`ٞPLMPI߈FdI߈|JwID`a`I߉\I߉\L%LP97^PJQއ::`:~::ט:'`::(:Z::3::O::-]:*]:I߈:I߈:*:-:l:q::E+:s::%:mE+:ms:m%:m:W:W:S-]:S*]:lޏ:qޏ:X7:7=2^2ݳ3:`:e::::ڗ:I߈:U:t:‘:m:T:4N:.4N:D:T:3O:mq:ml:m*:m-:m]:%:3%:3:mݳ::t݄:t݄:m݄:m݄::w:m*A$%$$$ݳ$s$I$$=2$ $2$^2$3$$E,2$3E,2$3%$$$2$2$2$Gm$%8$8$*ސ8$-ސ8$*x2$$*^8$lސ8$qސ8$X8$8$8$8$=8$8$^8$8$\$$E,8$8$328$8$8$ 8$ 8$ݴ8$t8$m+$3m+$ݴJ$J$J$J$J$-^8$8$(8$]8$ژ2$Eݳ$3I$%N$N$$!${$$2$8$3E,8$*x8$ݴ2$2$r2$*-L8$5L8$)6$-2$*^2$$ژ8$*8$-8$-l8$-^2$=Gm$8$3^8$!2$3 8$3$3s$3t8$3ݳ$3$3ZL8$<$I$H$J$D$$.$$$$$$ڗ11k7k7dddRN{{{nI{z{{{:{{{f>Sycڂli9:{{z{{:{f>Sycڂl'i9:{:{{dgdd:d:d:ddmdd1%1%ߐߐ%%KKKKKKKKKKKKKKKKddddddddddd$NcIHr.Lk$DE<ۥt\H\HHJWD2.77I<ۥt\H\HHJWD2.77I$NcIHr.Lk$DE$$IIٲٲٲٲLٲLٲLٲLٲ  3%3%ff99ݠݠ\\%%7$ݠ$$'$'$$7$7kއkއ?7?7u8u8u\u\u`u`I0I0]0]000E\E\\\00tt``00X0X0߂D߂D߂i\߂i\00X2X2/0/0/E\/E\../0/0II``އއ``އއ..އއppp p pphhi i I I ] ] IIksksk k   JJĎ Ď   isisi i i3i3/ / u0u0  u`u```\\-\-\-----C-C-----C-C-ݜ-ݜ\\``OOAA````00фr]τr{eHȄڅ쨄{|*箄HE廄d˄M`ݞĄ=첄桄݄:*]ON_NRNNфr]τr{eHȄڅ쨄{|*箄HE廄d˄M`ݞĄ=첄桄݄Z߈yWtWNW WfWfWݨWWeWWW)WWFWWWFWWWOWhWWWWWFW sWWWLWW6W W NW W W ^W 0W NW W W W #۩W UW œMW WLW WW W qWWB t tp t tR u ߚu[ t7T t;T tu t>/ mR tn   t t 9u Um߈ Ut߈ 7t߉T m  W?TW?kW?gW?W?W?W?W?W?W? =8 =8 {=8 p p ئu7Z߈`Z߈7`@s@m7@s`@m泦N;eئYj~./ئټٽ럦顦g<'<IƦƦ⨦䎦YѦdZx 282828u2828?|E2|E828,2,8:N싦 8 =v2 58 5v|2 |v=2  8  o|2 o58 |fvމ  8 \ St2 |2 2 |f2 |8 58 =2 2 58 >=2 >=8 |8 މ   |f2 2 S|f2 o ފ8 o ފ| S ފ|  ފ| o ފ2 cW?|2 cW?2 FW?|2 FW?2 FW?t8 W?|2 W?2 FW?|2 FW?2 oW?t8 SW?t2 S |2      L   ۻ   # "   G Q  b e L  t 1  x  ! q    e   y     D v ~  R K Tkg<HIDJޛ{E4ڸMNڸ4{4E4$t݄$m݄$X݄$/݄$t݄$m݄$X݄$N$3=2tOmO:_N<Wݡٱgn5OY ޗդդդդ:ٱդٱIIH:::H<<<:<<DD:HHHJKդzNqqp$7qPPP_PMPzޢ콢i콢ϢiϢϢuiusisޕޕsi{i{8Ƣ{_i_iƢ̢i̢i,ݢ냢ۧޕu8uu8냢햢햢**..0I///΢΢΢~:~~쑌~~w~~t~~{~~~UJ~ <~ ~ ;~~ ~~B~Ռ~~׌~o~膌~J~t~ی~~~琌~*܌~&:~wq~~w凌~~w⏌~Č~7~L~~ $~~ڼ~⛌~~f~_~ ~{~Ȍ~~<~d~:~~H~~n~l~D~~yN݌~I~~J~`~a~뤌~]~^~dߌ~d~d]~d2~~$~1~Tkg~y~|9~B~yTy8eBy)%wBywyB $ ڻBBJy<d:HZ٦Dd,> >8IJ:ʑdʑdʑdʑd{N+Tkg;;=<;P;-;B;;p;-;s;;7;,;D-;;<;-;<-;`';,;;,;C;M;;;_(;;F;;;F;;T;k;g;;;;;;;;k;g;;;;;;;;T;;mD;;m;/;8;;;|;|;*+;K+;;;;};s;;E;{;M;;;;t;;ޛ;#;;$;;;;;^;;7;/;J;F;;P;r;;;;;;;;;<; ;;J;4;:;H;;D;;;5;;;I;;J;;QhtK;P;H;;D;%|;;;;.;8;;;;a;a;a;a};as;a;aE;a{;aM;a;a;a;at;a;aޛ;a#;a;a$;a;a;a;a;a^;a;a7;a/;aJ;aF;a;aP;ar;a;a;a;a;a;a;a;a;a<;a ;a;a;a;;;j;;V;r;y;R;#;S+;p;;<;;;;;h;h;<,;B M; Ml&7r&7l&r&????}?s??E?{?g?M?????t??ޛ?#??$?????^?????????UM2CLHI8+I<IDIHI:IIIIJIq98ڥڻں<DH:IJr *qZ\P<COGHA3LoR\Sfrwxk]{+bzqr;gDC#"ED+. rvn7$'612&"ܼܴܸܻܹܺܶܵ\Nl+%'H$NWNڭZ߈CRN6kg6A666w66E6&6666B[1-./[[NJKL[݅݅2݅a݅a݅݅݅݅n݅1݅<IHJD؏gDp뼏zC Ϗďď鈏cЏ荏>̏琏WaTNH=;ⱏƏ^g)Ϗޛ\W͏oUݛݚݐݏݎݍ72'&$#̏ڻڥڜȏٮyIHJY@@H<:ڻڻڴڴڴY(I߈''$']'x]'-]']'3'3Ek''\'+'qޏ)lL%Y@@p+Y;;@WޖezYz@R@ޛޘgg  qi9)Y)j5cY@@>>==<<;;BBAAAt%uwYwv//--,,++**11000t>&YSSUUTTT@uCzC7 Y^}Y  $$###%2tB;i:aJYL٫٫٪٪٩٩٨٨٧٧٭٭٬٬٬ZRZZt&zbKC MMJ   #"%ffpfafffffeZytniݗݕݔݘKq\XTPsruttttڲڲڲڲ#ڲ%IHGFONP$$$$$$#$"$%2I2H2J2<222ڻ222>2222q292ttptt@m@p@t@s@q@}@@K@@@@@ڥ@ڻ@@@@@@@@@@@@@@@@#@@ @@@ @@@%@@@l@@;@@D@@@g@@x@}@@@@@E@F@I@H@G@J@K@@@@@>@@c@@@@@@@@@@@@+t+@;@r@q@btb@{@H@L@V@U@T@W@@ @z@v@C@@@@@@@@E@G@K@J@I@O@ݒ@ݔ@ݗ@ݖ@ݕ@ݘ@ݎ@ݏ@ݚ@ݙ@ݐ@ݛ@ @@\@Z@*@r@ٝ@Bٝ@A@B@I@H@D@J@g@@^@T@@@@@@@@@@$@&@2@1@'@7@@ @.@+@@E@@@ @@@  7Z߈pڲڲڲڲڲڲڲڲ'%2(NzzݭY[5i߃2ig NNJ؝$3DʝZ(vj<^J<۝JJJ槝抝ØÝWCCܝڠڛ(JϝϝHIj~<;ƝƝƝʝٝݟݦܾɝɝ.kn8̝̝sIQW໽˝̝.ZuJ ?bߡඝ@䣝ڗmĝUĝeĝ!ddydތ<ތHތDތތތsތޛތތތތތތތތތތތHތDތR<HDsޛHDzmz3<HDsޛHDދ<ދHދDދދދsދޛދދދދދދދދދދHދDOOO9O}OTOOEOO O8OOOOOOޛO#OeOOOOO%OvOOOKO OHOO߶OOOOOOOyOtObOIO=OpޚEޚJ*J)TkgTkg{CusDz YOdb`3`ۢۢۢۢ'ۢ8'ۢ8'ۢ8'ۢ8'ۢ8ۢ8(jۢ3'ۢN'ۢaۢ=8ۢ|8ۢ8ۢc'ۢ'ۢN'ۢNpۢNpۢNaۢNaۢNqއۢNbއۢ`iۢ`ۢ`۸ۢ`۹އۢݢۢ{_ۢ_ۢ_ۢ`wZۢ.<.vIwIH~\JwJJwJ\VxJJ;ҘטDD D׽(ٝLFl:<::::.:I:I:C::H:~::::::J:V:;:::D:(:<:<::::.:I:h:wI:wI:C:H::::J:wJ:xJ:J:;::D:D:׽:::f::>::^H^^D^^f^^^^n1ݳ/ݳKݳݳ"ݳ<ݳ'ݳ'ݳݳݳٞݳC:C&yk\\<\i\:\1`/`K`D````"`<`'``` `ژ`ٞ`p``/އ`w`w`i`k`w``i`M`:::P:v:wI:J:\:fC::k\::H:k\:a:`:`::`:j:"*`:"`::J::`::`:i:9:D: `::ٝ:ٞ`:ٞP:L:$%$$$8$-N$r$"$p$$#$$'8$$q$32$2$!8$8$32$#2$wp2$$]$$\$.$v$C$C$$$$$$$$':$$$ٝ$r8$*2$-q8p^8p^81=21=21=81=81,81,8]]/=2/=2/=8/=8/,8/,8/\/\/8/8t$t$tt88ݴ8ݴ8]]K=2K=2DsDs=2=2=8=8  \\ 8 8kݴ8kݴ8kk=8=8,8,8=8=8=vs=vs,8,888=2=2=8=8"=2"=2"=8"=8",8",8"8"8ݴݴݴ ݴ t$t$tt<<<=2<=2'=2'=2'=8'=8'=vs'=vs',8',8=2=2=8=8=2=2=2=2=v=2=v=2=2=2=8=8,8,888i8i8iݴ8iݴ8i8i8iݴiݴit it  ݳ ݳ =8 =8)$)$))) ) )=2)=2)=8)=8ژ=2ژ=2ژ ژ [=2[=2ٞٞٞ=8ٞ=8ٞ,8ٞ,8,8 )^2[^2p-]=2 \t\>p=8p=8p2p2ppp$p$p2p2pݳpݳp=8p=8p p p $p $p 2p 2p ݳp ݳp =8p =8=8=822ݳݳ$$22ݳݳ=8=8k2k2k=8k=8=8=822$$22ݳݳ=8=8$$22ݳݳ=8=8i=8i=8i2i2iii$i$i2i2iݳiݳi=8i=8[$[$[=8[=8[2[2[ݳ[ݳ[[۲۲@@۲۲@@۲۲@@۲۲@@zzz۲z۲z@z@zzzzz۲z۲z@z@zz۲۲@@۲۲@@۲۲@@۲۲@@:::۲:۲:@:@::::۲:@:۲۲@@۲۲@@۲@۲@z۲z@۲@۲@:۲:@۲@۳۳AA۳۳AAzzz۳z۳zAzAzzzzz۳z۳zAzAzz۳۳AA۳۳AA9s۳A9s۲@!z۳zzAzz۲@z۲z@z۲@9s۲@9s۲@۲@:9:s:۲:@:::9:s:۲:@۲@۲۳A۲@۲@@__rPUUU6lNfNyy3E+3m+*mEN-mENmENmbEN*3EN-3EN3EN3bEN3W=y|=yw,66lf{lGfG7B73N3NmpxENmjxENN3_NIN~zl7*(M-(M3RNR_N_RNݤ{I7TTZmC?|e7NN=\t==|=t=NdVEtڮ6XLݰ6+"" | |;T;H;;;;;;;X7;;7;*;-;^T^k^g^^^^^^^^X7^^7^*^-^<^I^J^ڗ^hj77^7fh777777ڶ777k7d77777777^7o77@7$*2$-2$E,J$E,J$hL2$L2$*L2$-L2$^J$^J$h^J$2$t2$$$$$*-L2$d$$7Z$J$3EJ$od$NP$2$LJ$3J$Z$$*L8$-L8$2bMXU,dVlbMfCf355h|lfH3Hff1di7 }f;;f3ށ2NH7k7ۙٝU7773ٝ7v7f3~dfIfIfJJffJcdid\dd;7ll!G!C!!!Z..IH~+7J#7l(7l7l=7l7l|7l7l|7l7lt7lI7lG7l7l7l7l+ljkDkkDkgDkDkDkDkDkDkDkDkADkDkDkDkDkDkDkkDkgDkDkDkDkDkDkDkDkADkDkDkDkDkDkDk.DkDkBDk҃DkRDk DkDk7lUA5AZAA*-AlqAAAAAL\ZL\AZA|A5|AZ|A|ALއZLއLa5LaZLaLalqLL`ZL`LZL*-A*-L\!A5Lݪk5LݪdLݪkLݪdZL|L|khxFAxFALǫLhZLLJhwAwA45d5kZ4ZdkZLhA5LuALhZA 5 Z  hZZh3L\*-3L\Z3L\3A53AZ3A3A*-3Alq3A3A3A3A3ANAZNAAZA5L3\L3\A5AZAALLJZLLJCA5CAZCACA5CLa5CL5CL5CLE5C3A5C3LZCLaL{L{lqCA-LLu5AZLE\ZLE\*-LE\L3E\ZL3E\*-L3E\uAZuA*-uA#[\-u!!!G77=+7.p^pp(@Y@n@e-wwwwee~iJ3N1Ah =`ݴpݳoڨݳݳrereHreHreHrerererreNݳreeecJ3reHrǜuHre^re^reue}eߝ?rerNPrere;e;e{eWrereWhrehreWrere_V_ceVWrereWeeWeeWVWVTreUreeUeV]:p]p:]ure:urep]urep:ure]ure:ureQRSRJ((e(ure(eure((R"+""ݰ"7"=p"^p"p""+ݰ=p-ޏ*ޏqޏlޏ>NE-3E3->3E3-RURedeureereeW1v-x3-Z!~!i!!Jp=pߝpݰ*B-B*B-BݴOiO~3\3933J>reWd_Vd_WrǜrǜVrǜVrǜrǜrǜTW(ure(eure(ure(eureWeeeUeedeureeE鿺l- q- u\uEu\uEu\u=2uMuMuQu|k\Eu\Eu\MMٞ7Alq+*Z-Z*--f*fx-fx*f7(3PUHX9u77x*{x-{*{-{x_'ld|kmژppxsjxsso]8p fq1rqh_````/`ݳߎ/8燳`7`泴`V`۷Z۷`A`ZA泴qސQ?ߎ`q`>qސ/5۷`5AlސMHߎ`l`Glސ/۷`ADQ?QQ0QQl/D_ߜ`lސ H ߝ 0  qߎ*ߎݴ  Hݳ ߏݳDQ``Qqݳlݳ㕳揳QQQQ-N-x!AwxdE,dOdOdddC(UE+ddd""[AMdzdudvdvdddM|gd_V7d"x"eded*<`*V*`-<`-V-`*(<{*(V*({-(<{-(V-({*O<`*Of*O`OV-O<`-Of-O`V,V<*-OV<-*OVHwHx(s(s(hx(s *EV+-EV+p*p)p(p'6Exm6Em6E6q6l6EZ6qZ6lZ6E6q6l6q6l6Exs6Es(ddE,Vhhh||h|7K+ QxxOsOsxrsrsCeo^߁LVXd#n#ߚu#ߚu'#u'#uh###w##ޑ#,#Eޑ#|##S##"#*k#*g#*#*###ui-##u#Z##6#6#6#I6##E0dw#z#F|g#[|g`@u:u,Fl3"k"g""""""""6A"6"6"6"6o"6"6M"6)"6"6"6RkRgRRRRRRRR6AR6R6R6R6oR6R6MR6)R6R6R6Z߈|Z߈Z߈tZ߈Z߈RZ߈+Z߈Z߈Z߈6BZ߈6Z߈6Z߈6Z߈6pZ߈6Z߈6NZ߈6*Z߈6Z߈6Z߈6Z߈RZC>ZT>ZC>ZTjZCjZTjZCjZTjCjTZCZTZCZTpZCpZTpZCpZTpCpTCCTCET*5-55<5<-^5<*^5*T-TC[>[*5>[-5C(<*]C(*]C(-]C(<-]C<*]C*]C-]C<-]<*Z<-Z*ZCTCT-ZTE[TߜCߜ8D /mTGCGV,Vڗ\ubCfTf ;T*T-C*ClC-Cq<cx77E7s`d eueuiߝhd d-R#R#R#R#R#R#R#kR#uC^C&T&CEZuZu7Z7|-)'hZPAfDBC%fC%SC%AC%>C%;C%T%fT%ST%AT%>T%;T%TPCPCPTPCPTPTPCPZL;7;7;7٦ddFd#2#2#2#2#2#2#ܿ2#2TFddd7dC=mC|TC=mT|C}#-}##-#U#U-#CThbߤuqߤudPCߜ&m&s7tB77Z7Z7Z7Z7ZZ7EZ7Z7CTC>ddEdV*|H%bTv5"@K0CzVCzfTzVTzfڽE}TCfTfC_h3Cd"_A*jT*jC*jT*C*x.7jCZ* CTT?**j|2Te}]SڽO#9k\u(tz?BA>vd!d[STCTx<1gTg1gCgH 7rw]ڧ-<-C;T;-Nj-NTڗjTڗڗjڗPdjdwUdjwUddCdPdXdߝutStjttTtߜCtߜ}PCߜ"CߜwUTߜTUCߜPTߜjPTߜGߜCߜjwUTߜGߜRTߜTߜjTߜTߜNSwUSjSRTCTCPT"wUߜjSGUj#jSjSC-vC<-vC-C<-CTCڗj_dEEjEjmEbjmEbj3Ebj3EbIߓbj_bj_bjT;jT;*b-b*b-bpxbjxbjpxEbjjxEbjpxbjjxb*rb-rb*Ob-Ob"k"g""""""""6A"!k"!g"!"!"!"!"!"!"!"!6A"!k"!g"!"!"!"!"!"!"!"!6AjZAjAjZAjA| ZAj8ZAYZAjYZAYZAjYZATZAvZZTZjTIZAjTI5ZATZAjTZAiCZAoCZACZA`CZAjhCZAj+,+,}+,+,+,+,V+,+,6+,+,u+,+,&+,+,e+,+,E+,+,+,+,+,+,R+,+,2+,+,q+,+,"+,+,a+,+,A+,+,+,+,+,+,Y+,+,9+,+,x+,+,)+,+,h+,+,H+,+,ZLE\ZL3E\3LE\Z3LE\*-3LE\ZLa3LaZ3LaL\5L\5NANA3AZ3ANAZNAZNAZLߒ5LLJLLJZLވE\ZLވ3E\ZLއZLވE\ZLވ3E\Z3Z3LTZLTLaTZLaTAAL`L`L`L`LALALALAX _ _X L_AL_A _AX _AL_AL_ALmLZH4LZHLHkLHdg4An4hAx4hA4hAx4Lx4hL+-EA*EhAhAAZLGALGZAZLGAZLX8LX8ZLڗ*-L5La*l-q*q-ll-q*l*q-*l-ll-q-*q-ql*q*lLJZlLJ5-LJ-LJqLJZqLJ5*LJ*LJlaZla5-a-aqaZqa5*a*alG5*j5mZlGZ*jmlGZ?qGZZlG?ZqGlGqvZlGZqv5*jm*j5m-3L7GZAݴqGZALGݴpZLGݴpZLGreWGALVGZA]GZAL\:GA*އ-އlއqއNECٞٞ*COs-COs*C-Cٞ*sٞ-sٞ*Gsٞ-Gs*(Q-(Q*(x{-({*({-(x{*x-x*4Ws-4s3*4s3-4Ws*Trs-TrsE!+xrs-x۱-xxwxrsxr?wwxQxQxr?xrxw Llmxw Llsxw Lqmxw Lqsxw L-?xw L*?xw L-xw L*-.M.2.-L2.*L2"E"""պxE<ڗ"g7lL"C""V"m|lmX 7 7|8[=2[QZ[4-[G*Z*[jEEj-Z*5-5T*5-5CT*-*3-3hEW(Q 99ݴ2;9Kߛ [*5[-5TqATCqATqACTCTCTpM\LL3+N+pIxsjIxsݫ!"=p!"Xp!"p!Kq!Kq+!(p!(Kp|p|p!p|JH\p3\7Wh,,E,p pVpL`7JMQ9*[pٞmٞmEٞmX2X2Xݴ2X=8Xݴ8X^gXTZ2=8XX*X-ۤeT=2TQB)T*T-"TT3"7XZZTZeٞK7KMM~KiKGGJKGGGGJKj8Jj8K333(3(JK4)=2=23~3i|~|i0i0~K~ߒߒ3MQ3QۡQ3M3Qٞcٞc=8;=2N3E\NNE\ݴq=2ݴqXts=2rHrreGX7XG7Gݴp3|~~|G|8t2WWR2R2W9re9reW9r=9r=W9r=29r=2W9r=Gm9r=GsWIIWkrekreWIIWGrGGrGVWGtGtWGtGGtGVWGGGWGWG9rGG9G9rGWG99rǜV9rǜ9rǜW=9rǜ=rǜVrǜ9rǜV9rǜtVttGWG7tGG73V33WQKVjVWJJWKG9KG9**rere2Gk7UGk7GkreUGkreG7UG7GreUGreGreUGreGreUGre33T]:]X8:X8]T8:T8]ur=2:ur=2]uG7:uG7]uGݴp:uGݴp]uGre:uGre]uGre:uGre(*wVp(-wVp\9]re:re]G9:G\]G\:G9:j\:j8\ur?Qwf}*ޏqޏlޏEN-3E*E3*3E3*a*u3ۘqސMlސQlސGqޏ3qޏ3lޏ37377E,2E,8qސ8\ݴpNEINE\NpNVN9Wre9reNINEp3pCE!CECACACACA*-CATA5TATATATATATA*-TAlqTAZLݪZLݪ4LݪLݪ4(x5(5(<- 5(* 5*5-5x55TCTdCdTCC|T|T|TTCTCTTCTCTECE*Lݔ*L"+ALE\L3E\LaNALߒLވE\Lވ3E\LއLވE\Lވ3E\LڗLsGAݴqGALGreZLZL9\AZ\AݴqGZAZLGreݴqGALGreLGݴpZLGݴpCߜTߜCߜTjCjjjNNjjj"}}}ۣ}L}}}B}G}Y}}B}H}}}}%}}}}W}/}}b}c}}W}}}'}}}} }"}}}ٲ}ٳއ}}ٲ}Lٲ}Lٲ}}}}F<}%}}}ۣ}L}}}B}G}Y}}B}H}}}}%}}}}W}/}}b}c}}W}}}'}}}} }"}}}ٲ}ٳއ}}ٲ}Lٲ}Lٲ}}}}F<}%33ݳ<\'އp\ \0000ٞ0ٞ0`< -`)`)` Pޅ'އm^I^~:!އٞ!އKKK\K\KKKKKKK K KcKcKKKKKFKFKKKKKKK>K>K K KJKJKlKlKKKKKvKvKiKiK{K{KKKKKKK{K{K K K0KK0KK]K]K K K >K >K]>K]>K0K{K0K{KKKbKbK0KK0KK0KK0KKKK K K0KK0KK0KK0KKɛKɛK0KK0KK0KK0KK0KK0KK0KK0KK0KK0KK0sK0sK0s\K0s\K0sCK0sCK0sK0sKKKKmKKߘKjKKKKvK]K]K]K]K$?2K$K$\K0sZ߈K0sRNK0sRNK0sۚKlKZ߈Kq______U_W_w____V____L___p_W___w_____[__8_ڈ_e___l___HG?=l99EBDC@774;l;;:L55++32/<-,)(>>>'%&$#F! b:N I(݋7Ij: u$~߲߽߶regqopfnhjmkli3)/201.g]cfdeb$$ۥ$t$\$H$\$$$$$J$$$$W$$2$.$$$$$<$$${f$$$$<$ٲ$Lٲ$Lٲ-xY?-xY?*Ys-Ys*Ys-Ys??g?*gs-gs*s-sy~~v5jw3yz ݴ^2*ms-msݴ=2ݴ=8*EM-EMx*sx-s*s-s*is-is*3-3|h=ă=h|t==NRNEݳ^ڮ7 Zk Zg Z  ޒ =k =g \ k g k g 뛠 뛚 # !k !g k g  D u Z n k g k g rc< n y $u Q k g w w ~k ~g ~ ~ d k g  p (k (g ( k g T r  r k g > k g  mk mg + uw x k g   # o C r r b }g g }y y }{ { } 5 k5 +5 5 75 Y5 `5 g5 @5 V5 g5 5 5 q5 o5 A5 ޒ5 w5 <5 5 ک5 5 -w5 m5 A5 5 \5 5 5 5 i5 5 5 l5 D5 E-5 f5 K5 ڷ5 5 B5 5 +5 5 w5 5 k5 T5 ګ5 5 5 q5 5 5 z5 |5 5 5 5 5 ߑ5 5 5 5 5 5 5 c5 5 5 5 5 D5 v5 u5 b5 5 ߈5 Z5 5 5 5 T5 5 ߔ5 5 5 5 5 3ڗ5 c<5 45 5 n5 5 5 y5 5 ݲ5 5 ;5 !5 5 $u5 5 >5 5 >5 5 Q5 5 A5 ߊ5 5 l5 -5 w5 ߠ5 5 5 w5 u5 }5 5 5 5 ~5 /5 5 5 5 5 I5 5 p5 |5 o5 &5 ߆5 5 '5 5 5 ,5 5 5 5 T5 5 5 ۺ5 5 N5 5 5 5 5 5 %5 5 :5 r5 5 5 5 5 V5 >5 5 5 l5 65 ކC5 5 +5 ڦ5 5 w5 uw5 t5 5 x5 5 5 5 5 j5 5 #5 z5 5 5 5 y5 o5 5 C5 5 P5 5 5 5 5 55 5 b5 L5 s5 5 5 g5 y5 {5 5 b.~*mb.~G8b.~*mb.~G8b.~Z/b.~0a2b.~0a8b.~0asb.~0a琈荈̈pTlʈƈ)%ĈĈc鈈ȈȈˈ㓈؈K̈ڻψ8$F N$H NF NH NNFN3y4<4<4H4H4D4D4I4I4J4J444q4g4444494D44r44*4g4 4^4\444ޛ444444o4W4\4e444>4444444p4T4l44444444)4%444c4444444444444K44444ڻ448444۽4^4ۥ4H4 N4N4FN4;J.C~ڗQFٝ<JIV{HDuHVO754}xs~cXhj<AIJDsH-/2rzp^PVSaQa_W\f ٿ<6bp!NbpNbpNbp|NbpNbptNbpxNbpNbpNbpNbpZNbpNbpnNbpNbp NbpWN*brDe';''' ڃ % o s p r n q m ; . t z  ߨ ݌  { l 444g4e444p4444c44444KRVR7RRRRcRhRRRRRRRjRW"4"4"4"4"4p"4"4"4"4"4"4c"4"4"4"4"4"4"4"4"4"4K"4"4"4"4ڻ([((l((((B(|(((}((((((^(Z((T(a(`(_(^(((((( ('(((U(:(9((-((݆(((((('((i(J(K(A((((((((((((((((((b(_(f(;(P(((( (( (K(I(پ(V(Z(((((b#Tb#kb#gb#b#b#b#b#b#b#b#Ab#b#b#b#ob#b#Mb#)b#b#b#b#b#b#b#(((((O((((X((((ބ((x(,((d<(((()(((((w(dJ(dC(((t(s((i((d(((D(((d(((>((((?(X(X(X(?X(h(h(((f(0((h(h(((d(e((W(d(4((5 ((V(d((2((3 (((((s(d(h(((((((K(?( (((((*+((((((((()(( h(phb#kb#gb#b#b#b#b#b#b#b#Ab#b#b#b#ob#b#Mb#)b#b#b#b#b#b#b#b#b#b#b#b#b#b#(#l#######݈#x#d##ߞ## ####ڬX#K##;#.#Z### x#jz# ####Z## ##u:##m##B#T## # #݈#6#l###y##ߍk#+#=c####,##2#;###H<\@CA\DJxbIڥ<9TDNMPO) am@<lFOge %.-3/0216587%'&*),+! ($"#3/NKJMLogs96cG@E$#)&mPO\USTFEIGJI^SYW[Z۬ۨ۽۶>:H?_ۜ328645,+0/-._`)\5XVo^Y\ݡݝݩnaޛsqnew(W9mlrnoqp}|~cedhgkiuxv_^fb`a     >,:9_a`y[X^\]MLRNOQPWVYXEGFIKJSUTA@HDBC;:?><=C =<?> RzYPOgY`_ba31D;YXqckml9&}|~Y[ZlksnGFHNKTOfjg\dl}ڝڟڞڪڻگ*#%$dargR\V |vTVUtmGcKDC\RGQ10:724$ !#"('*)%&TVx?A@  $^8,*g>.5߸߷߽߹ߺ߼߻ߴ߳߶ߵ߿߲߰߯߱ߪߩ߮߭߫߬KJPM9;:>=A?EDHF54<867-,10./30E9 $".&34&'*),+.-2/"!(%#$ <6K?YXbZ^]`_"!$#/.;1+ rpysvuxwFCHGednh>:bB@A*(4-+,NMTOQPSREGFJILKA@HDBC=<?>     ;:C=@?BA/104385-,2.{zڂ}~ځڀpqutyw^\ha_`ٹٸٻٺٱٯٷٴٵ٠ٟ٦٣١٢ e C Y = 7 ߽       s    n   1 a   5  x A   ,  5  ۜ r ;  ? 3 S ڻ o  ? : U      .   ޛ#{EJ7/Prsڊy}<IsHJDni(%(9()((hZ߈&&&&&&&[&&"&&&&&۠&P&&&&v&&R&&T&&Z&G&[&q&&&&b&&&&H&H&&p&`&&&l&Y&T& &&&&&^&&&&&C&&&&&&*&C&&b& &&q&`&g&&>&C&<&&o&&&&&&^&&%&&&&&&۽&ޛ&#&$&&&&&&&&r&P&&{&&&&&d&&&&M&&|&&ڴ&ڰ&&W&"&&&&&&@&z&&&&&C&&&&&&@&&2&&&)&^&<&w&&6&D&W&&&ڥ&ڡ&&V&&&&&&\&8&&&&&&&o&&g&& &<&\&+&&&&]&&c&&2&J&&Q&&&ڻ&ڵ&%&X&)&&&&&&&H&e&&&& &K&&&&&&A&&;&&&9&_&D&&&8&I&&h&&&&&&\&&#&&&&&&&ۥ&W&&&&z&&\&&^&&\&H&c&r&&&&c&a&&&&&I&u&]&&Z߈&RN&&虯&&&&ݮ&&&&&ޘ&&&&}&&3&T&k&g&&&&&&&&&XXGGII{f{f{ {   $$<<ٲٲ.ٲ.ٲٲٲ\\JJFJFJ3J3JVJ$*$B7$7$75$$RR@@22ll??X`X`!!%%]]<DȋގJCH뼋b㏋uޘ訋+c؋,Ћ쟋t琋֋ઋٶ瓋읋呋璋Njڤ忋ċ>㡋쨋Vdsȋȋ\ЋCl9!㻋ċ͋q鈋$2A瑋Ⓥ6$$$Z߈CRN:H:.H::.:b:.b::.:U:t::m:T:Um:tm:m:mm:Tm:Um:tm:m:mm:Tm:=E:=7:=:-|w:lA:qA:_N:_N:m_N:}t݄:}m݄ܽܽ^^ZZ[[J::]]\\ \ \ \ \t\t\JJ<0<0<<<އ<އ00 \ \':':::  \  \00KٝKٝ\\00۝۝{{:"fPm  ^..JJCCCיי:m::7J;k1<HTDIJ9}Dp_ ;c kse%v)XK ,<HDI!C!B!A!@lYllWlKllJZN8NN[NsE{Mޛ#7/JPr<<HDIJڊaaEFa=mN3N劤劤3_M<:HD5IĞJ앞}sE{gMtٞޛ#Ϟ$О卞^Ğ˞뼞۽ڞⱞў:HD5IĞJR3Tkg$PT$Pk$Pg$P$P$P$P$P$P$P$P<$PD$P$P$P$P$P^$PPPRP3RPgPPPPPPDTDkDgDDDDDDDDDDDsDDDrDMDޛDDDDDDDDDDDD#DD۽DDDsޛ{M%d9<HDIJsuRWN[ݼ[ݻ[ݹ[ݾ[[w[r[t[[}[v[[x[[[[[[T[_[`[[ [[[[~[e[ƅ`낅Ņ<kHD,ItbtcIąJ CCsC{NC|gMggCޛޜCυgЅ,CCą˅˅뼅CgⱅaDo݇ڢڣMN|B嫅졅峅*㰅-㰅$}$k$߅$$$#$م$$$A$ATkg$ݣ$퓕<HDIĕJ압}IsE!{g@BAޛ#ϕ$rЕ单^^ĕ˕뼕۽ڕⱕ:HD槕Jĕn˕뼕''C'u'u'F'ɕ'ϕ';'Z'''ە''Tkg3N???E?{?g?M????t?$???쏛?y??:?ڊ?r???o?9?^?k?g??݄%m9%t9%m}%t}%m%t%mD%tD%mT%tT%m%t%m %t %m%t%m8%t8%m%t%me%te%m%t%m%t%m)%t)%m%%t%%mv%tv%m%t%m%t%m%t%mK%tK%m %t %mH%tH%m%t%mJ%tJ%d%:%H%n%D%I%J%d%H%m%{%%%%%d%dq%d%d%,%q%%%43 +1 + + + + + + +ݵ +y +L + + +- + +W +H + + +? +f + + +[ + +n + +] +2 + + +, + +ݶ +M +k + + + + + +U +( +d +) + +F +T +k +g + + + + + + +zz zzzzܭzܰzzzrzpzqznzaz`z^z_zdz]z\zfz;z:U0U6UUUݻUݹUݸUݾUݿUݷUwUUUUyU{UnUoUUUUUUUPUYU]UUSUaUbU`UcUUU^UfUgUXUeUUUUUUUU|U{  ~ } | { z y x w v u t s r q p o n m l k j i h g f e d c b a ` _ ^ ] \ [ Z Y X W V U T S R Q P O N M L K J I H G F E D C B A @ ? > = < ; : 9 8 7 6 5 4 3 2 1 0 / . - , + * ) ( ' & % $ # " !                            ~ } | { z y x w v u t s r q p o n m l k j i h g f e d c b a ` _ ^ ] \ [ Z Y X W V U T S R Q P O N M L K J I H G F E D C B A @ ? > = < ; : 9 8 7 6 5 4 3 2 1 0 / . - , + * ) ( ' & % $ # " ! ߨ箄Ȅa箄څW^W *۰WWWWWWWW'WWfWX7WWqWWqWcWcWcMWiW\WWMW۪W`W3WW'WWWWhWW'WW4WlWWWgW۪WiWWWc c/ c' / ' B  / ' B 开 / ' B  / ' B  L/ L' LB L / ' B  ۟/ ۟' ۟B ۟ / ' B 庀 P/ P' PB P G/ G' GB G \/ \' \B \ Z/ Z' ZB Z / ' / ' h/ h' / ' n/ n' 1/ 1' / ' B 챀 / ' B   /  '  B   S/ S' SB S l/ l' O/ O' OB O FG/ FG' B/ B' BB B / ' B  F/ F' FG/ FG' v/ v' vB v i/ i' / ' / ' iG/ ۦ/ ۦ' b/ b' b/ b' / ' B  hbcB hbcŀ FGc/ FGc' FG/ FG' FG/ FG' FGi/ FGi' FG/ FG' FG/ FG' FG/ FG' FGB hbFGc/ hbFGc' hbFGcB F/ F' FB F FG/ FGo/ FG>/ FGc/ FGF/ / o/ / >/ c/ F/ N/ No/ N/ N>/ Nc/ NF/ / >/ c/ F/ o/ >/ o/ o>/ / o/ >/ S/ So/ S/ S>/ o/ >/ / o/ / >/ ފo/ ފ>/ n>/ / >/ {/ {>/ / o/ / >/ c/ F/ o/ >/ c/ F/ c/ / o/ / / >/ c/ F/ / o/ / >/ c/ F/ >/ >o/ >/ >>/ >c/ >F/ / o/ / >/ c/ F/ / >/ c/ F/ F/ Fo/ F/ F>/ Fc/ FF/ ;c/ ;c/ c;c/ / / / / / ;c/ FG' FGk' FG>' FG' FGc' FGF' ' k' >' ' c' F' N' Nk' N>' N' Nc' NF' ' k' >' ' c' F' c' F' c' F' c' ' >' c' F' >' c' F' >c' >>' ' k' >' ' c' F' c;c' F' Fk' F>' F' Fc' FF' FGB FGoB FGB FG>B FGB B oB B >B B NB NoB NB N>B NB >B oB >B oB o>B B >B SB SoB SB S>B oB B >B B oB B >B ފoB n>B B >B {B {>B B oB B >B oB >B B oB B B >B B oB B >B B >B >oB >B >>B B oB B >B B B >B ;cB FB FoB FB F>B FB FG> FG >  N> N >  S> S >  례 > > >  F> F   π ފc/ ފF/ c/ F/ {c/ {F/ Sc/ SF/ c/ F/ oc/ oF/ c/ F/ c/ F/ c/ F/ c/ F/ / o/ / >/ / S/ / / ފc' ފF' c' F' {c' {F' Sc' SF' c' F' oc' oF' c' F' c' F' c' F' c' F' ' o' ' >' ' S' ' ' B oB B >B SB B ފ>B S So S쓀  o 쓀 ފ> n> c' c/a*a- N>B No' NoB No>B N>B N>B N>oB N>B >o' >oB o>F' o>c' SoB SoB Sc' S>o' S>oB S>B S>>' S>>B oo' ooB >>' o>' o>B F' >' >B >>' >>B oc' >' >B ފ>o' ފ>oB ފ>>B ފ>F' >' >>' >>B >c' {>>' {>F' {>c' >' >B >o' >>' o>' oF' oc' B ' >' >B >o' >oB >oB >o>B >oF' >oB >>B >B >>B >B >B >>B o>B oc' >' >B c' >F' >c' F>>' F>>B F' NF' Nc' NF' Nc' N>F' N>c' >F' oc' >c' Sc' oF' oF' oF' F' >F' FoF' FF' F>F' >>F' >F' oF' >oB o>B >F' >F' oB >F' >B >>' >' o' oF' oF' >F' >F' oF' >>B >B >>B SF' F'  #߉/  #߉/ / / / / / / / /  x7 =AB)I)))))u)j)_)T)H)=)2)')))|#E|#Eb|#EbZ߈|#E|#EC|#E_N|#ERN|#E*C[s|#E-C[|#E$*$-$3ݴ*$3ݴ-$t*$t-$s|#E|=y|#E|#E|#Em+|#Em+|#E*|#E-|#E*Os|#E-Os|#E*rs|#E-rs|#E*T[s|#E-T[s|#E*3xs|#E-3xs|#E*xs|#E-xs|#E*|s|#E-|s|#E*C|s|#E-C|s1C1|#E*(s|#E-(sIRII3Im+Rm+m+bZ߈CRN_N*-*Os-Os*rs-rs67X7xW77777 / l2 / ވk / /  /  / π /  L/ L / coG/ coG' cG/ cG' G/ G' cv/ cv' FG/ FG' FGB FG c/ c' / ' B  NI/ NI' N/ N' NB N / ' B  / ' B  o/ o' oB o / ' B 쓀 / ' / ' / ' k/ k' S/ S' SB S / ' B  / ' B ⫀ / ' B ˀ ފ/ ފ' ފB ފ n/ n' nB n / ' B  {/ {' {B { / ' B ހ / ' B 䕀 / ' B  / ' B 례 >/ >' >B > / ' B € / ' B  / ' c/ c' F/ F' FB F coG/ coG' cG/ cG' cv/ cv' c/ c'Un_NnENn67n7n7nnOn*n-nnX7nnxnZ߈nnTnkngnnnnnnnnnCnW7n7n7nRNnn]4]4]4]4]4p]4]4]4]4]4]4c]4]4]4]4]4]4]4]4]4]4K]4]4]4F N]4H N]]V]]O]7]5]4]]]]]]}]x]s]~]]]c]]X]h]]]]]]]]]j]<]]]A]]I]]]J]]]]]D]]]]]s]]HnV7n 7n7nsnn7nڶ7]zۘ]A]5A]ZA]A]T]Cpp6p87791<91I91H91J91D9191\919191o91{91r91;91+91v9191q91}991r91s9191z9191c919191>919191ǻ91{91l91%919191u91y91n91919191K919191^919191g91ޛ91W9191e91~9191x9191ڻ91r91y\9191<91;91o91|R91kQ91U919191w9191J91ޙ91m91jg91919191919191919191t91q91p91n91l91aiV91ahڷ91agP91af91aeD91adߢ91acd91ab91aa91a`91a_91a^'91a]n91a\91a[91aZ91aY91aX91aW691}V91}U91aT91aS91aR91}Q,91}P91aO91aN>91aM91aLڱ91aK91aJ91aI91aH91aG91aF91}D91aC91aB91aA91a@91a?91a>91a=91a<91a;91a:91a991a891a791a691a591a491a3x91a291a1b91a091a/91a.91a-91a,91a+91a*91a)91a(91a'91a&91a%91a91a 91a91aA91a91a91a91a91a491a491a5i91a91a91a91}91a91a91a91a91a91a91a91a91a91a91a91acE91ac$91ac#91ac"91ac!91ac 91ac91ac91ac91ac91ac91ac91ac91ac91ac91ac91ac91ac91ac91ac91ac91ac91ac91ac 91ac 91ac 91ac 91ac91acڮ7+ڮ7-N6k6g66666666A666w66E6&6666|66t66R6+6666|66t66R6+666B666x66F6'66HXZXXnXrXXZXXY~~B~~~~~~ߙBߙߙߙߙߙBߙߙB1kkgg3|}|}GGAGBAAAGGG~A7|7X77777|77t77777T7ڄ777*7:7U7D#7DS7D;7D!7D!7Dx7D=7DL7D/7D]7D7DQ7,mڷAU0z@!32oj| 4bT>4E&߀$\<I_C.H(ٝ%~D;K ڗ<-.~<JDڗ;HICߨߧu 5)('&}0<000\0I0ۥ0\000H000000J000000W0D000000.000kk0k0kA0k222d2222222222R22l2%2222{2J2ڿ2222[2jjfjjj>jjڻjSjj2jjjjjj!jgj jjjjjgjjjzjejHjDj߲jڮ0<0H0D00000ڊ00{0b0ޛ0000o0#00000000c00۽0^00000r0000000s00000ڮ06k06g06A0606HI<ʡJHI<ʡJԡFڥ忡PR+q쿡С۠vZG١͡š枡eHI<ʡJHI<ʡJԡFڥ忡PR+q쿡С۠vZG١͡š枡eqp2S[<)ڹڱSHgA?y-i G]]]ޛ]{]ڊ]]Q]]]]$]t]]]]]]]Y]]]]<]I]H]J]D]:]]]T]k]g]]]]]]]5<5I5H5J5D5{5;555q59555z5C5 555555c555>55555l5%55555K555^555g5ޛ5W55e55555ڻ5ڊ5ڇ5r555e5[5555_5~5.55555g55555f555d5W756k56g5656A56565656Btthtt@tttltt2tttttgt=ttttkt=ttit6kt6At6t6t6gt6tڮ6<C.IHZJDJ WN<HDIJ^N3^8_M}E{Mtޛ#$^۽rJ2z=8Rkg6A666iS3%0@0@0@~0@0@f0@0@0@0@e0@d0@0@0@g0@0@0@0@0@0@0@"0@[0@0@v0@.0@^0@0@0@0@0@6k0@60@x<:]IJHDڇentcrW\\jDEI4٤ۥz^\H߾Nݬ|h=|h=|h=뒃=h||\h^뒃^h|\e[_~.gfd6k6g666A666!!e![!!!!_!~!.!!!!!g!!!!!d!6k!6g!6!6!6A!6!6!60d<0<00dH0H0I0dJ0d00d 0 0d00d00d00d00d0dP0P0d00d00d00d00d00d0d0d0d0d00d00d00d00{0d00d0dx0dC0d00dE0E0d00dj0j0dC0C0d0d 0d0d00d00d00d00d\0d k g        6A 6 6 6w 6 6E 6& 6 6 6 6| 6 6t 6 6R 6+ 6 6 l lY l l|_M<:HDIJ}sE{gMytޛ#$^۽:HDIJRp7767WN3WN3<p<pp;pppp>p<   d  ;      iXiXD    ; X  ނXQQqhݰXnXXkX=># &;;hhhhhhh_hhhTU<UUh hW_h[pX9[[[T[[X9[g[W[ [[[X[[[[X8[[[X[[ނ[}XW[iophoppmnlkjiecddb[IhhhgpXXD;_nNO<OpXOpXOOOdOdOOOOOOOOOCOO|OspXXpXpX XJXRXXR;XJލނXXpXhXDiX<iXiXD}XsXJhXC6.;;qXqXXX|X;_nhnhhhxނxwjJ98cdhc\]NA>?<??r?h>?h?pX?_><=<=pX==;nZ<s>?I="#;#X; !!!X! !X;!!g!!Xp!X!XX!}X!ughh9hhhhhh;hhgh_gh_hhbc c Tc kc  c c c c c yc |c[Tc[UD% lm<m mTmmImHmEmDm|m_lCDDsDrDnCZ<omgޓ|y^2h<QDiX<hhhhޔhޔh<<\;hhhh{yghhgSRQJI54ޛޜޜpޜޜޓޔhޔ?h?hޔލvTv vvvvsނpWX;ݵݥݦނݦhݥݦhݦhhhshrDi iiDihi,h,hihi6h5ihiihi|ysttttiXiXDtiXiXittto^__X__D]YZZWX23_2301pX1pX111g1|1}X1}XT/,+()<)))e)));)))))))q)))))))iX )s)&&'D<ނ  rs;soh[*+h*)'(;"   <  x|xxtxxRx+xxxxtxxRx+xxxtDxDxRDx+DxDxDxx|xxtxxRx+xxxx|xxtxx|xx۱xtxxRx+xxxx|xx۱xtxxXxXxx|xx۱xtxx۱|x۱|xt۱|/xt۱|-xt۱|0<xt۱|0xR۱|x+۱|x+۱|<x+۱|x۱|x۱|x۱|x۱|x۱|x۱|<x|;x;xt;x;xR;xx|xxtxt۱xx۱x(x)xx|xx|xHx۱|<x|۱|<xxZx0Ix0Y0ڮE  V  ~ } | { z y x w v u t s r q p o n m l k j i h g f e d c b a ` _ ^ ] \ [ Z Y X W V U T S R Q P O N M L K J I H G F E D C B A @ ? > = - , + * ) ( ' & % $ # " !                           > = < ; : 9 8 7 6 5 4 3 2 1 0 / . - , + * ) ( ' & % $ # " !              I H G F E D C B A @ ? > = < ; : 9 8 7 6 5 4 3 2 1 0 / . - , + * ) ( ' & % $ # " !                   B A @ ? > = < ; : 9 8 7 6 5 4 3 2 1 0 / . - , + * ) ( ' & % $ # " !                         [ Z Y X W V U T S R Q P O N M L K J I     ~ } | { z y                            ~ } | { z y x w v      : 9 8 7 6 5 4 3 2 1 0 / . % $ # " !                        ޿ ޾ ޽ ޼ ޻ ޺ ޹ ޸ ޷ ޶ ޵ ޴ ޳ ޲ ޱ ް ޯ ޮ ޭ ެ ޫ ު ީ ި ާ ަ ޥ ޤ ޣ ޢ ޡ ޠ ޟ ޞ ޝ ܬ ܫ ܪ ܩ ܨ ܧ ܦ ܥ ܤ ܣ ܢ ܡ ܠ ܟ ܞ ܝ ܜ ܛ ܚ ܙ ܘ ܗ ܖ ܕ ܔ ܓ ܒ ܑ ܐ ܏ ܎ ܍ ܌ ܋ ܊ ܉ ܈ ܇ ܆ ܅ ܄ ܃ ܂ ܁ ܀  ~         ۿ ۾ ' & % $ # " !                    ږ ڕ ڔ ړ ڒ ڑ ڐ ڏ ڎ ڍ ڌ ڋ X W V U T S R Q P ٜ ٛ ٚ ٙ ٘ ٗ ٖ ٕ ٔ ٓ ْ ّ ِ ُ َ ٍ ٌ ً ي ى و ه ن م ل ك ق ف ـ  ~ } | { z y x w v u t 9 8 7 6 5 4 3 2 1 0 / . - , + * ) ( ' & % $ # " !        ....C.C.۵.۵...... .Y.Z.I..P.Q.../.8/..>.۫./././.w..ߗS.B/.۴/.T/.N.A..j/.ݯ..K./.ߕ.=/..a.M.\.4..YZ.]/..D/.C...*./.././.?...+.D.߄....C......m.m..Q.R.. ..?..۵.j...d....w..e.D......L.|A.A..E.B..@..7.).w).=..Y.U. M....m.ߖ.Bm././...T.V..M.,.!.f.fN.fO.f6.f.8m.8%.8(..&.&m.(.S.*...+.(.+...9.6.9.<=.<=.<'=.<'=..RE>.-.~..<ۯ=.<=.<70=.4"U.4".]=...]0&<.].].]=.].]=.].].]?.]?m.][.][~.=ۮ.]=.]..@..]k1.]f.I.I.1.WN.|5.c.Q.WN.|5.c.Q...W.W.. .u .u .u J.u *.u.u.uJ.u*..V.ߐ."."=.".".".".">.....B.8m3''*7-7OO8 NsߣߣߣsߣߣQߣOeqeDDXDXKKXKXttU33???ZZݱEݱXXJJXZLDژXژ((5[l[l5[*[*5[-[-5[q[q5[l-[l-5vv5XqXq5C5o5ZLD$ߒ$ߒ$a$`$_a`_$$$$$$,,ss$$ߥ$:$ߦ$G$F$$?$$[$$($q$3|$N|_cٝkyjS/7/7m7?cwctcscrcqcpcocncmcvcuuߌM7$q$l$$";NlNNJ?J.GG55AA5RR5GACWCWCWCWCWCWCWCWgK(Q#nsot_GGGGGGGGGGGGGG G G G G GGGGGGGGGGG   $K$+$e}#######T#Zݟ#閟##+## #m# S#OƟ#ß#ҟ#ٟ#崟#ן######㾟#㬟##-###W#:#U#㫟#&#h#ß#e#ӟ#~#佟#Y#㭟#놜醟#㩟#@ ##߅###ҟ#U##ۭ###x#G##i# #ߟ#5##˟###j#ğ#3##ݟ#]#%#߇#####͟##ۛ##봟#vpEIkpEIgpEIpEIpEIpEIpEIpEIpEIpE?kpE?gpE?pE?pE?pE?pE?pE?pE?<.IJCH~J;D(ڗZٝ<.IJCH~J;D(ڗZٝ<.IJCH~J;D(ڗZٝ<.IJCH~J;D(ڗZٝ<.IJCH~J;D(ڗZٝ<.IJCH~J;D(ڗZٝf<ff.fCf~fffJf;ffffDff(fڗfZfٝf<fff.fJffHf~fffff;fffffDff(fڗfZfٝf<fff.fIfJfCffHf~fffffJf;fffffDff(fڗfZfٝf<fff.fIfJfCffHf~fffffJf;fffffDff(fڗfZfٝy<yy.yIyJyCy~yyyyyJy;yyyyDyy(yڗyZy<yyy.yIyJyCyyHy~yyyyyJy;yyyyyDyy(yڗyZyٝ<.IJCH~JD(ڗZ<.IJCH~J;D(ڗZٝy<yyy.yIyJyCyyHy~yyyyyJy;yyyyyDyy(yڗyZyٝy<yyy.yIyJyCyyHy~yyyyyJy;yyyyyDyy(yڗyZyٝ!<!!!.!I!J!C!!H!~!!!!!J!;!!!!!D!!(!ڗ!Z!ٝ!<!!!.!I!J!C!!H!~!!!!!J!;!!!!!D!!(!ڗ!Z!ٝ!<!!!.!I!J!C!!H!~!!!!!J!;!!!!!D!!(!ڗ!Z!ٝ!<!!!.!I!J!C!!H!~!!!!!J!;!!!!!D!!(!ڗ!Z!ٝ!<!!!.!I!J!C!!H!~!!!!!J!;!!!!!D!!(!ڗ!Z!ٝ!<!!!.!I!J!C!!H!~!!!!!J!;!!!!!D!!(!ڗ!Z!ٝ!<!!!.!I!J!C!!H!~!!!!!J!;!!!!!D!!(!ڗ!Z!ٝ!<!!!.!I!J!C!!H!~!!!!!J!;!!!!!D!!(!ڗ!Z!ٝ<.IJCH~J;D(ڗZٝ<.IJCH~J;D(ڗZٝH~f>Sycڂldi9f>Sycڂl'i9dddddmdf>Sycڂldi9f>Sycڂl'i9dddddmdf>Sycڂldi9f>Sycڂl'i9dddddmd!!f!!>!!S!y!!!!!c!!ڂ!!l!!d!!i!9!!!!!!!f!!>!!S!y!!!!!c!!ڂ!!l!!'!!i!9!!!!!!d!d!d!d!d!md!!f!!>!!S!y!!!!!c!!ڂ!!l!!d!!i!9!!!!!!!f!!>!!S!y!!!!!c!!ڂ!!l!!'!!i!9!!!!!!d!d!d!d!d!mdTkgTkg!T!k!g!!!!!!!!T!k!g!!!!!!!TkgeQeQeQeQeQ{eQ{eQC{eQu6eQ|u6eQu6eQtu6eQu6eQRu6eQ+u6eQu6eQu6eQueQ|ueQueQtueQueQRueQ+ueQueQueQueQ|ueQueQtueQueQRueQ+ueQueQueQ-eQheQeQeQeQFeQeQھeQ5eQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQwQEwQۗwQۖwQەwQ۔wQۓwQےwQۑwQېwQۏwQێwQۍwQیwQۋwQۊwQۉwQۈwQۇwQۆwQۅwQۄwQۃwQۂwQہwQۀwQwQ~wQ}wQ|wQ{wQzwQywQxwQwwQvwQuwQtwQswQrwQqwQpwQowQnwQmwQlwQkwQjwQiwQhwQgUZ߈U|tR+R = < ; : 9 8 7 6 5 4 3 2 1 0 / . - , + * ) ( ' & % $ # " !                            ~ } | { z y x w v u t s r q p o n m l k j i h g f e d c b a ` _ ^ ] \ [ Z Y X W V U T S R Q P O N M L K J I H G F E D C B A @ ? > = < ; : 9 8 7 6 5 4 3 2 1 0 / . - , + * ) ( ' & % $ # " !    ލvv_NvENv67v7v7vvOv*v-vvX7vvxvZ߈vvTvkvgvvvvvvvvvCvW7v7v7vRNvv)<);):)9)8)7)6)5)4)3)1)0)/).)-),)+)*)))()&)%)$)#)")!) ))))))))))))))))) ) ) ) ) )))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))ᛍ {3@Close the IO object. Attempting any further operation after the object is closed will raise a ValueError. This method has no effect if the file is already closed. $)))tB9-B9B90-B9B9`-B9B9-B9B9P-C9C9-)C9@C9Խ-HC9_C9d-jC9C9 ľ-C9 C9-C9 C9hG+C9 C9G+C9 C9G+D9 D9H+)D9@D9H+JD9aD9I+kD9D9 J+D9D98L+D9D9L+D9D9N+D9E9PH+E9(E9H+6E9ME9I+YE9pE9PJ+{E9E9K+E9E9L+E9E9N+E9E9(P+F9F9Q+,F9CF9R+RF9iF9J+yF9F9`K+F9 F9L+F9!F9HN+F9"F9O+G9#G9HQ+*G9$AG9R+OG9%fG9T+nG9&G9U+G9'G9 W+G9(G9 M+G9)G9O+G9*H9P+H9+)H9PR+7H9,NH9S+TH9-kH9U+yH9.H9V+H9/H9X+H90H9Z+H91H9\+H92I9 R+I93.I9XS+7I94NI9T+YI95pI9V+xI96I9hX+I97I9TZ+I98I9[+I99I9\+I9: J9_+J9;/J9a+4J9<KJ9@V+RJ9=iJ9X+oJ9>J9 LY+J9?J9\[+J9@J9|\+J9AJ9\_+J9BK9Ta+K9C&K9Lc+4K9DKK9$d+UK9ElK9Tf+tK9FK9[+K9GK94\+K9HK9 T^+K9IK9`+K9JL9b+L9K0L9c+9L9LPL9$f+ZL9MqL9f+zL9NL9tg+L9OL9h+L9PL9`+L9QL9,b+L9RM9c+M9S1M9e+?M9TVM9f+aM9!!!!!!!!!!!!ą!ą!̅!̅!ԅ!ԅ!܅!܅!!!!!!!!!!! ! !!!!!$!$!,!,!4!4! imap object Make an iterator that computes the function using arguments from each of the iterables. Like map() except that it returns an iterator instead of a list and that it stops when the shortest iterable is exhausted instead of filling in None for shorter iterables.CDATAidnamesymbolsvarnameschildrenoptimizednestedtypelinenosymtable entrytopthis compiler does not handle Suitesunknown symbol table entryname '%s' is local and globalfailed to set scope for %scontains a nested function with free variablesis a nested functionimport * is not allowed in function '%.100s' because it %sunqualified exec is not allowed in function '%.100s' it %sfunction '%.100s' uses import * and bare exec, which are illegal because it %sduplicate argument '%s' in function definition'return' with argument inside generatorname '%.400s' is assigned to before global declarationname '%.400s' is used prior to global declarationlambda'return' with argument inside generator.%dinvalid expression in parameter list*import * only allowed at module level_[%d]genexprsetcompdictcompopenpty() -> (master_fd, slave_fd) Open a pseudo-terminal, returning open fd's for both master and slave end. /env/env/_fdinfo_sighdlrnohandlempexp: negative exponent"A" H"n" x"" "" "" %"!j #$%&'()*+  #-08BES< ! " #> $V % ' (V ) * +> -W . / 0 1.253046B.rfind(sub [,start [,end]]) -> int Return the highest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.B.title() -> copy of B Return a titlecased version of B, i.e. ASCII words start with uppercase characters, all remaining cased characters have lowercase.,- - S.rjust(width[, fillchar]) -> unicode Return S right-justified in a Unicode string of length width. Padding is done using the specified fill character (default is a space).Python's standard exception class hierarchy. Exceptions found here are defined both in the exceptions module and the built-in namespace. It is recommended that user-defined exceptions inherit from Exception. See the documentation for the exception inheritance hierarchy. exc_info() -> (type, value, traceback) Return information about the most recent exception caught by an except clause in the current stack frame or in an older stack frame../0123456789setprofile(function) Set the profiling function. It will be called on each function call and return. See the profiler chapter in the library manual. # ## #"#*#2#9#@#N#\#k#z# ##$#starmap(function, sequence) --> starmap object Return an iterator whose values are returned from the function evaluated with a argument tuple taken from the given sequence.iterablekeyO|O:groupbyitertools.groupbyitertools._grouperitertools.tee_dataobjecttee__copy__itertools.teeO|nn must be >= 0__copy____copy__cycle()cycleitertools.cycledropwhile()dropwhileitertools.dropwhiletakewhile()takewhileitertools.takewhileislice()isliceStop argument for islice() must be None or an integer: 0 <= x <= maxint.Stop argument for islice() must be None or an integer: 0 <= x <= maxint.Indices for islice() must be None or an integer: 0 <= x <= maxint.Step for islice() must be a positive integer or None.itertools.islicestarmap()starmapitertools.starmapimap()imap() must have at least two arguments.itertools.imapchain()from_iterableitertools.chainrepeat|n:productrepeat argument cannot be negativeitertools.productiterablerOn:combinationsr must be non-negativeitertools.combinationsiterablerOn:combinations_with_replacementr must be non-negativeitertools.combinations_with_replacementiterablerO|O:permutationsr must be non-negativeitertools.permutationsdataselectorsOO:compressitertools.compressifilter()ifilteritertools.ifilterifilterfalse()ifilterfalseitertools.ifilterfalsestartstep|OO:counta number is requiredcount(%zd)count(%s)count(%s, %s)O(OO)O(n)__reduce__itertools.countizip()izip argument #%zd must support iterationitertools.izipobjecttimesO|n:repeatrepeat(%s)repeat(%s, %zd)len() of unsized object__length_hint__itertools.repeatfillvalueizip_longest() got an unexpected keyword argumentizip_longest argument #%zd must support iterationitertools.izip_longestteeitertools; h2{p#%1h2{p#%;h2}'Ih2}'Rh2}4b#^h2}4b#ch2}t1rh2~z#|h2:~P1h2O~DQ"Oj@complex.conjugate() -> complex Returns the complex conjugate of its argument. (3-4j).conjugate() == 3+4j. @H)%A -This module is always available. It provides access to mathematical functions for complex numbers.Write string to file. Returns the number of characters written, which is always equal to the length of the string. HIMifilterfalse(function or None, sequence) --> ifilterfalse object Return those items of sequence for which function(item) is false. If function is None, return the items that are false.?@ABCbc <* <Ȼ;?b^ cM UM J NPPsetdefaulttimeout(timeout) Set the default timeout in seconds (float) for new socket objects. A value of None indicates that new socket objects have no timeout. When the socket module is first imported, the default is None.writable() -> bool. Returns True if the IO object can be written.WXYZ[rPPCompiled regular expression objects?pw_nameuser namepw_passwdpasswordpw_uiduser idpw_gidgroup idpw_gecosreal namepw_dirhome directorypw_shellshell programpwd.struct_passwdO&:getpwuidgetpwuid(): uid not foundgetpwuid(): uid not found: %ldgetpwuid(): uid not found: %lus:getpwnamgetpwnam(): name not found: %sgetpwuidgetpwnampwdstruct_passwdstruct_pwent6K6kLsth]^ENDMARKERNAMENUMBERSTRINGNEWLINEINDENTDEDENTLPARRPARLSQBRSQBCOLONCOMMASEMIPLUSMINUSSTARSLASHVBARAMPERLESSGREATEREQUALDOTPERCENTBACKQUOTELBRACERBRACEEQEQUALNOTEQUALLESSEQUALGREATEREQUALTILDECIRCUMFLEXLEFTSHIFTRIGHTSHIFTDOUBLESTARPLUSEQUALMINEQUALSTAREQUALSLASHEQUALPERCENTEQUALAMPEREQUALVBAREQUALCIRCUMFLEXEQUALLEFTSHIFTEQUALRIGHTSHIFTEQUALDOUBLESTAREQUALDOUBLESLASHDOUBLESLASHEQUALATOPutf-8utf-8-utf-8latin-1iso-8859-1iso-latin-1latin-1-iso-8859-1-iso-latin-1-iso-8859-1codingutf-8iso-8859-1with BOMencoding problem: %sutf-8rbreadlineNon-ASCII character '\x%.2x' in file %.200s on line %i, but no encoding declared; see http://www.python.org/peps/pep-0263.html for detailsstdinstdinutf-8 tok_backup: beginning of buffer%s: inconsistent use of tabs and spaces in indentation tab-width::tabstop=:ts=set tabsize=Tab size set to %d <> not supported in 3.x; use !=replacereplaceuhangupinterruptquitalarmsys: trap: illegal instructionsys: trap: reserved instructionsys: trap: reservedsys: trap: arithmetic overflowabortsys: fp:exitdiekillsys: trap: bus errorsys: trap: address errorsys: trap: TLBsys: write on closed pipealarmtermusr1usr2unknown signalislice(iterable, [start,] stop [, step]) --> islice object Return an iterator whose next() method returns selected values from an iterable. If start is specified, will skip all preceding elements; otherwise, start defaults to zero. Step defaults to one. If specified as another value, step determines how many values are skipped between successive calls. Works like a slice() on a list but returns an iterator.j^T&~X&T&P&&>?&ps&N&&&F&#&j&nH&"&4&&&1:&&&0&&a''o'n'h''x' 'W '9P '. '''T''\' @'''';'Z'w<'8 '"'$'%''')'+'|-'^/' J1',3'5' 6'8':'<'>'@' ^B'*D'E'G' I'K'M'O'Q'S'U' nW'bY'\['&]' _'`'b'd'f'h'j'l' n'p'\r'Rt'&v'x'y'${';|'~' ~'t'h'b' J'F'('''''9' '|'t'p'h'f'^'r<'x ''r'R'<','$' '''.''jf'EFj' vwxyz{|Us}klread([size]) -> read at most size bytes, returned as a string. If the size argument is negative or omitted, read until EOF is reached. Notice that when in non-blocking mode, less data than what was requested may be returned, even if no size parameter was given.m0_?sclassobj(name, bases, dict) Create a class object. The name must be a string; the second argument a tuple of classes, and the third a dictionary.^/Built-in functions, exceptions, and other objects. Noteworthy: None is the `nil' object; Ellipsis represents `...' in slices.@ kn{7b c !E1:e % '"%a -\      index(x) Return index of first occurrence of x in the array.pTj3|p3!>#!$/%F&A4H.&%R6,b! /N.get_magic() -> string Return the magic number for .pyc or .pyo files.;ifilter(function or None, sequence) --> ifilter object Return those items of sequence for which function(item) is true. If function is None, return the items that are true.writelines(sequence_of_strings) -> None. Write the strings to the file. Note that newlines are not added. The sequence can be any iterable object producing strings. This is equivalent to calling write() for each string.property(fget=None, fset=None, fdel=None, doc=None) -> property attribute fget is a function to be used for getting an attribute value, and likewise fset is a function for setting, and fdel a function for del'ing, an attribute. Typical use is to define a managed attribute x: class C(object): def getx(self): return self._x def setx(self, value): self._x = value def delx(self): del self._x x = property(getx, setx, delx, "I'm the 'x' property.") Decorators make defining new properties or modifying existing ones easy: class C(object): @property def x(self): return self._x @x.setter def x(self, value): self._x = value @x.deleter def x(self): del self._x <ARar,567;<=@ABCGHILMNPLRZT`VhX\]_ab&d.hjklmnopqrstuvwxyz{|#'+-035:>CGKMVt'HJ( 0 3 G F F  %   :<>B6Zb 8@HPY`t|!!!!!!"" "#"%" <"!C""E"#H"$M"%a"&d"'r")v"+z"-"1"3"5"7"8":";F0?K0@M0AO0BQ0CS0DU0EW0FY0G[0H]0I_0Ja0Kd0Lf0Mh0No0Or0Pu0Qx0R{0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0nopqdefault_int_handler(...) The default handler for SIGINT installed by Python. It raises KeyboardInterrupt.sequencestartO|O:enumerateenumeratereversed()reversed__reversed____reversed__argument to reversed() must be a sequence__length_hint__reversed M  L.reverse() -- reverse *IN PLACE*{GzL.__reversed__() -- return a reverse iterator over the listclock() -> floating point number Return the CPU time or real time since the start of the process or since the first call to clock(). This has as much precision as the system records.M----readable() -> bool. True if file was opened in a read mode.@0T !@0R X.@07S pA)@0R !Bisection algorithms. This module provides support for maintaining a list in sorted order without having to sort the list after each insertion. For long lists of items with expensive comparison operations, this can be an improvement over the more common approach. S.rfind(sub [,start [,end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure."_!""M" "@"r"N""w#""#"2"&:"p"7u""'8""z8""A0"<"(7F"{"8""."["G(e""(""z(""s3""4"A":L"vv^u|{uvvvupuqvKz,v^uprivate identifier too large to be mangled__doc__no symtablecompile.c compiler unitcompile.c compiler unitcompiler_exit_scope()opcode = %d opcode_stack_effect()suite should not be possiblemodule kind %d should not be possibleunknown scope for %.100s in %.100s(%s) in %s symbols: %s locals: %s globals: %slookup %s in %s %d %d freevars of %s: %s compiler_make_closure().%d__name____module__default 'except:' must be last__future__from __future__ imports must occur at the beginning of the fileAssertionErrorassertion is always true, perhaps remove parentheses?'return' outside function'break' outside loopunary op %d should not be possiblebinary op %d should not be possibleinplace binary op %d should not be possiblecan not delete variable '%s' referenced in nested scopeparam invalid for deref variableparam invalid for local variableparam invalid for global variableparam invalid for name variableunknown comprehension type %d__debug__'yield' outside functionparam invalid in attribute expressionparam invalid in subscript expressioninvalid node type (%d) for augmented assignmenttoo many statically nested blocks(ziOO)(zO)invalid %s kind %d in subscript param invalid in simple sliceextended slice invalid in nested sliceindexellipsissliceextended sliceinvalid subscript kind %dS.__format__(format_spec) -> string Return a formatted version of S as described by format_spec.pwrite(fd, string, offset) -> byteswritten Write a string to a file descriptor.0A"0B!08B80D$0D10J)0Jd /0K30FHg"0I861ctermid() -> string Return the name of the controlling terminal for this process.readinto(bytearray) -> int. Read up to len(b) bytes into b. Returns number of bytes read (0 for EOF), or None if the object is set not to block as has no data to read.;L hypot(x, y) Return the Euclidean distance, sqrt(x*x + y*y).fsum(iterable) Return an accurate floating point sum of values in the iterable. Assumes IEEE-754 floating point arithmetic.!:o !(p !] ! ! n_unnamed_fieldsproxy(object[, callback]) -- create a proxy object that weakly references 'object'. 'callback', if given, is called with a reference to the proxy when 'object' is about to be finalized.set_debug(flags) -> None Set the garbage collection debugging flags. Debugging information is written to sys.stderr. flags is an integer and can have the following bits turned on: DEBUG_STATS - Print statistics during collection. DEBUG_COLLECTABLE - Print collectable objects found. DEBUG_UNCOLLECTABLE - Print unreachable but uncollectable objects found. DEBUG_INSTANCES - Print instance objects. DEBUG_OBJECTS - Print objects other than instances. DEBUG_SAVEALL - Save objects to gc.garbage rather than freeing them. DEBUG_LEAK - Debug leaking programs (everything but STATS). O"\ "H)' A!4!(-j@@Return a copy of the hash object.S.encode([encoding[,errors]]) -> string or unicode Encodes S using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle UnicodeEncodeErrors.deepcopy helper not foundjoinO|O!:ElementO!O|O!:SubElementO!:append:clear:__copy__O:__deepcopy__O:extendexpected sequence, not "%.200s"O|O:findfindOOOO|OO:findtextfindtextOOOOO|O:findallfindallOOOO|O:iterfinditerfindOOOO|O:get:getchildren|O:iteriter helper not found:itertextitertext helper not foundchild index out of rangeiO!:insert:items:keysOO:makeelement:__reduce__copyelement helper not foundO(N)O!:removelist.remove(x): x not in listlist.remove(x): x not in listOO:setchild assignment index out of rangeelement indices must be integersexpected sequence, not "%.200s"attempt to assign sequence of size %zd to extended slice of size %zdelement indices must be integerscleargetsetfindfindtextfindallappendextendinsertremoveiteritertextiterfindgetiteratorgetchildrenitemskeysmakeelement__copy____deepcopy__!__reduce__tagtexttailattribcan't delete element attributestagtexttailattribElement:TreeBuildermultiple elements on top levelpop from empty stackOOO:dataO:end:closeO|O:startOO:xmldatastartendxmlcloseTreeBuilderstrictstrict%s: line %d, column %ds(ii)positionOundefined entity &%.100s;OOOOOOOreplacetargetencoding|Oz:XMLParser}xmlstartdataendcommentpiclose:closes#:feedO:_parsereadiO!|O:_seteventsevent handling only supported for cElementTree.Treebuilder targetsendstartendstart-nsend-nsunknown event '%s'invalid event tuplefeedclose_parse_seteventsentitytargetversionExpat %d.%d.%dXMLParserElementSubElementTreeBuilderXMLParserXMLTreeBuilder_elementtree__builtins__from copy import copy, deepcopy try: from xml.etree import ElementTree except ImportError: import ElementTree ET = ElementTree del ElementTree import _elementtree as cElementTree try: copy(cElementTree.Element('x')) except: def copyelement(elem): return elem class CommentProxy: def __call__(self, text=None): element = cElementTree.Element(ET.Comment) element.text = text return element def __cmp__(self, other): return cmp(ET.Comment, other) cElementTree.Comment = CommentProxy() class ElementTree(ET.ElementTree): def parse(self, source, parser=None): close_source = False if not hasattr(source, 'read'): source = open(source, 'rb') close_source = False try: if parser is not None: while 1: data = source.read(65536) if not data: break parser.feed(data) self._root = parser.close() else: parser = cElementTree.XMLParser() self._root = parser._parse(source) return self._root finally: if close_source: source.close() cElementTree.ElementTree = ElementTree def iter(node, tag=None): if tag == '*': tag = None if tag is None or node.tag == tag: yield node for node in node: for node in iter(node, tag): yield node def itertext(node): if node.text: yield node.text for e in node: for s in e.itertext(): yield s if e.tail: yield e.tail def parse(source, parser=None): tree = ElementTree() tree.parse(source, parser) return tree cElementTree.parse = parse class iterparse(object): root = None def __init__(self, file, events=None): self._close_file = False if not hasattr(file, 'read'): file = open(file, 'rb') self._close_file = True self._file = file self._events = [] self._index = 0 self._error = None self.root = self._root = None b = cElementTree.TreeBuilder() self._parser = cElementTree.XMLParser(b) self._parser._setevents(self._events, events) def next(self): while 1: try: item = self._events[self._index] self._index += 1 return item except IndexError: pass if self._error: e = self._error self._error = None raise e if self._parser is None: self.root = self._root if self._close_file: self._file.close() raise StopIteration # load event buffer del self._events[:] self._index = 0 data = self._file.read(16384) if data: try: self._parser.feed(data) except SyntaxError as exc: self._error = exc else: self._root = self._parser.close() self._parser = None def __iter__(self): return self cElementTree.iterparse = iterparse class PIProxy: def __call__(self, target, text=None): element = cElementTree.Element(ET.PI) element.text = target if text: element.text = element.text + ' ' + text return element def __cmp__(self, other): return cmp(ET.PI, other) cElementTree.PI = cElementTree.ProcessingInstruction = PIProxy() def XML(text): parser = cElementTree.XMLParser() parser.feed(text) return parser.close() cElementTree.XML = cElementTree.fromstring = XML def XMLID(text): tree = XML(text) ids = {} for elem in tree.iter(): id = elem.get('id') if id: ids[id] = elem return tree, ids cElementTree.XMLID = XMLID try: register_namespace = ET.register_namespace except AttributeError: def register_namespace(prefix, uri): ET._namespace_map[uri] = prefix cElementTree.register_namespace = register_namespace cElementTree.dump = ET.dump cElementTree.ElementPath = ElementPath = ET.ElementPath cElementTree.iselement = ET.iselement cElementTree.QName = ET.QName cElementTree.tostring = ET.tostring cElementTree.fromstringlist = ET.fromstringlist cElementTree.tostringlist = ET.tostringlist cElementTree.VERSION = '1.0.6' cElementTree.__version__ = '1.0.6' ElementPathcopyelement__reduce__deepcopyiteritertextcElementTree.ParseErrorParseErrorpop([i]) Return the i-th element and delete it from the array. i defaults to -1.d#-d#W#d#8'd#M'd#;e#(}#e#l#w)~))S.pack_into(buffer, offset, v1, v2, ...) Pack the values v1, v2, ... according to this Struct's format, write the packed bytes into the writable buffer buf starting at offset. Note that the offset is not an optional argument. See struct.__doc__ for more on format strings.!h)This module provides access to the Unix password database. It is available on all Unix versions. Password database entries are reported as 7-tuples containing the following items from the password database (see `'), in order: pw_name, pw_passwd, pw_uid, pw_gid, pw_gecos, pw_dir, pw_shell. The uid and gid items are integers, all others are strings. An exception is raised if the entry asked for cannot be found.-fd2path(fd) -> path Return the pathname used to open fd.?Update this hash object's state with the provided string.p7cx77Jd7fstat(fd) -> stat result Like stat(), but for an open file descriptor.unable to select on socket(is)host not found(is)0unsupported address familyaddress family mismatched%d.%d.%d.%d%cunknown address familyOiis#t#AF_UNIX path too longgetsockaddrarg: AF_INET address must be tuple, not %.500seti:getsockaddrargidnagetsockaddrarg: port must be 0-65535.getsockaddrarg: bad familygetsockaddrlen: bad familytimed outTimeout value out of rangeiii:setsockoptiis#:setsockoptgetsockopt not supportedtimed outr|si:makefiletimed outi|i:recvnegative buffersize in recvbuffernbytesflagsw*|ii:recv_intonegative buffersize in recv_intobuffer too small for requested bytestimed outi|i:recvfromnegative buffersize in recvfrombuffernbytesflagsw*|ii:recvfrom_intonegative buffersize in recvfrom_intolNs*|i:sendtimed outs*|i:sendalltimed outs*O:sendtos*iO:sendtosendto() takes 2 or 3 arguments (%d given)timed outacceptbindcloseconnectconnect_exdupfilenogetpeernamegetsocknamegetsockoptlistenmakefilerecvrecv_intorecvfromrecvfrom_intosendsendallsendtosetblockingsettimeoutgettimeoutsetsockoptshutdownfamilythe socket familytypethe socket typeprotothe socket protocoltimeoutthe socket timeoutfamilytypeproto|iii:socket_socket.sockets:gethostbynameunsupported address familysOOs:gethostbyname_exs:gethostbyaddrunsupported address familys|s:getservbynameservice/proto not foundi|s:getservbyportgetservbyport: port must be 0-65535.port/proto not founds:getprotobynameprotocol not found|iii:socketpairiii|i:fromfdi:ntohscan't convert negative number to unsigned longcan't convert negative number to unsigned longexpected int/long, %s foundi:htonscan't convert negative number to unsigned longcan't convert negative number to unsigned longexpected int/long, %s founds:inet_aton255.255.255.255illegal IP address string passed to inet_atons#:inet_ntoapacked IP wrong length for inet_ntoais:inet_ptoncan't use AF_INET6, IPv6 is disabledillegal IP address string passed to inet_ptonunknown address familyis#:inet_ntopinvalid length of packed IP address stringunknown address family %dinvalid handling of inet_ntopOO|iiii:getaddrinfoencodesidnagetaddrinfo() argument 1 must be string or None%ldgetaddrinfo() argument 2 must be integer or stringiiisOOi:getnameinfogetnameinfo() argument 1 must be a tuplesi|IIgetsockaddrarg: flowinfo must be 0-1048575.%dsockaddr resolved to multiple addressesIPv4 sockaddr must be 2 tuplessTimeout value out of rangegethostbynamegethostbyname_exgethostbyaddrgethostnamegetservbynamegetservbyportgetprotobynamefromfdsocketpairntohsntohlhtonshtonlinet_atoninet_ntoainet_ptoninet_ntopgetaddrinfogetnameinfogetdefaulttimeoutsetdefaulttimeout_socketsocket.errorerrorsocket.herrorherrorsocket.gaierrorgaierrorsocket.timeouttimeoutSocketTypesockethas_ipv6CAPI_socket.CAPIAF_UNSPECAF_INETAF_INET6AF_UNIXAF_APPLETALKAF_INET6AF_DECnetAF_ROUTEAF_SNASOCK_STREAMSOCK_DGRAMSOCK_RAWSOCK_SEQPACKETSOCK_RDMSO_DEBUGSO_ACCEPTCONNSO_REUSEADDRSO_KEEPALIVESO_DONTROUTESO_BROADCASTSO_USELOOPBACKSO_LINGERSO_OOBINLINESO_SNDBUFSO_RCVBUFSO_SNDLOWATSO_RCVLOWATSO_SNDTIMEOSO_RCVTIMEOSO_ERRORSO_TYPESOMAXCONNMSG_OOBMSG_PEEKMSG_DONTROUTESOL_SOCKETSOL_IPSOL_TCPSOL_UDPIPPROTO_IPIPPROTO_ICMPIPPROTO_GGPIPPROTO_TCPIPPROTO_EGPIPPROTO_PUPIPPROTO_UDPIPPROTO_IDPIPPROTO_TPIPPROTO_EONIPPROTO_RAWIPPROTO_MAXIPPORT_RESERVEDIPPORT_USERRESERVEDINADDR_ANYINADDR_BROADCASTINADDR_LOOPBACKINADDR_UNSPEC_GROUPINADDR_ALLHOSTS_GROUPINADDR_MAX_LOCAL_GROUPINADDR_NONEIP_OPTIONSIP_HDRINCLIP_TOSIP_TTLEAI_AGAINEAI_BADFLAGSEAI_FAILEAI_FAMILYEAI_MEMORYEAI_NONAMEEAI_OVERFLOWEAI_SERVICEEAI_SOCKTYPEEAI_SYSTEMAI_PASSIVEAI_CANONNAMEAI_NUMERICHOSTAI_NUMERICSERVAI_ALLAI_ADDRCONFIGAI_V4MAPPEDNI_MAXHOSTNI_MAXSERVNI_NOFQDNNI_NUMERICHOSTNI_NAMEREQDNI_NUMERICSERVNI_DGRAMSHUT_RDSHUT_WRSHUT_RDWRa6Ew6%"Llgamma(x) Natural logarithm of absolute value of Gamma function at x.normalize(form, unistr) Return the normal form 'form' for the Unicode string unistr. Valid values for form are 'NFC', 'NFKC', 'NFD', and 'NFKD'.*@#c/ppid/dev/bintime---c6666 7Private method returning an estimate of len(list(it)). 6,E=6r@@)L4^4 !4 )4D 64 ;4 H4Rh S4B\ \4N c4< i4fq4y44?4I4X4'4 44w44p4:44444U4^4,4 4  4n4(44$$4!,47}84x>4NC4@J4>V4y[4f4Qq4{4S4X4(4w4e4ɒ44Vb4S4R4N4`44444 4{4k42]%4S,4K44I <4 @4^E4N4Z4^4i4ɒl4 ' Objects that know how to pickle objects copysign(x, y) Return x with the sign of y.compress(data) -> string Provide more data to the compressor object. It will return chunks of compressed data whenever possible. When you've finished providing data to compress, call the flush() method to finish the compression process, and return what is left in the internal buffers. ntohl(integer) -> integer Convert a 32-bit integer from network to host byte order.OOOlOOnnOO\ No newline at end of file lOOlllladdlinesadd lines to a hunk fix_newlinefixup newline counters testhunktest lines in a hunk diffhelpersdiffhelpers.diffhelpersError6,E6r?9Lout of memorysyntax errorno element foundnot well-formed (invalid token)unclosed tokenpartial charactermismatched tagduplicate attributejunk after document elementillegal parameter entity referenceundefined entityrecursive entity referenceasynchronous entityreference to invalid character numberreference to binary entityreference to external entity in attributeXML or text declaration not at start of entityunknown encodingencoding specified in XML declaration is incorrectunclosed CDATA sectionerror in processing external entity referencedocument is not standaloneunexpected parser state - please send a bug reportentity declared in parameter entityrequested feature requires XML_DTD support in Expatcannot change setting once parsing has begununbound prefixmust not undeclare prefixincomplete markup in parameter entityXML declaration not well-formedtext declaration not well-formedillegal character(s) in public idparser suspendedparser not suspendedparsing abortedparsing finishedcannot suspend in external parameter entityreserved prefix (xml) must not be undeclared or bound to another namespace namereserved prefix (xmlns) must not be declared or undeclaredprefix must not be bound to one of the reserved namespace namesexpat_2.1.0sizeof(XML_Char)sizeof(XML_LChar)XML_DTDXML_CONTEXT_BYTESXML_NSasin(x) Return the arc sine of x.S.rindex(sub [,start [,end]]) -> int Like S.rfind() but raise ValueError when the substring is not found./dev/ptty%d/dev/ttym%d/devptyfs/bin/ape/ptyfs/dev@`)f)l)extend(array or iterable) Append items to the end of the array.76,EN6r$L_iterencode(obj, _current_indent_level) -> iterableC2LFExEgrwME|L|;6GDGGL@LB6RsnpWLQOGELl|MJF#k%rTZc>a?MfV}Y=4{[^Z%6Z[\ngEatt11111 1111111111LQ+Mka##E e=NnNߑ5wdO(OOVQtQQQRR;SNSSSVXYY2Y4Yf[[[\^;`eghehNmp5u~~~~~~7zςoƉfgnt|}Fiz'Rx^ ǞLɝ >Lp 35n>uIlyl*$NNNNNN7OL4OH>PP}444QYQQRNyRR'S5SQ5SS5S#Tm5r56TTTTTTU#U(U5?U55U5}%UB  +QU,9AFMS@zw8,4:G]iMd|  d~ d,VDF MGN,g:?5RԗxD-nC`dTL-+w9ofgydRPC h!L1 H?sX-E`L yU@CJf* yc9u'V|dC> *,99:x5I^ RV1, 4=l;Ntu."[͌z4 h(9)5Q?0G OL H =?&2d39v+~  Q,U,:.2PkҌʌTĂUÞ&^w-@qm\re47_Sw5M 6 V'xxHUyPN-TZWv͂{~Q7RI:wA|XhR6=W{h[H,K'It[=1U5V(NYxQ[NN>5#\Q__8Lb5ezk5l:llp+r,NrHR;y|Sjb4KcfQi]SdxxuΘޘc|Ğok7N7b;Pms=NAwp\ KQY50]"a2qgs2<KxtQ @cj#Bo *zGUMp$S~ v㉧wNOP/NO4T}XX^^_'e3iCjcJ[t\Vz{|l~Ϗ_!?q@BZhkgvB=Wօ{I qLtm{]ko[f[~Wny=DV2'C6E\;x\=Q5x]WqXE@#wLx9J4Al̊O9YlV;_ !mAFy?@7FFl|AsmE8TaEEM{LvME?Ka6DDA>]H]V]=8]] 888B^^%__99?9M9`=a\9aaa9,bbbc9V:ccdZdK:d]!V:e:eSf:f";gB;ghX;Jhhr;q;{; iCi\rdiii;i;ejtjqjj;j;jjjjkkkull<mm&mmWn>qWN6it[IzXٔez}zYzzzzqdAzzzAT\ {U{){S\{o{[l{!{ ]=e\{5|\D||H|}fxE|||t|||g~EDn]}nt}}5q}W@)`}=}}m!aZan~~+Cl'~@AG6ybᙗQcah\Ef7E:d/l;mkk5=U EmӃ~4nWjZ4Bn.X[q=DjJI|; qzÎԒ-eP *Iމ==^b2%#9n7Il{lAnaxSIltdJ 31B6J=EEJupA[ՑWJ[_%P00җlTt3zyJ43Kf;uqQ=0\AWʘȘǘJ'mUx9)JrKW ;X%W6՛L-4P4i8}0P@>EZcKB hԝ#ߡ~4hĝ[! ;394MdC`;9=2O7+K$m9VVEbizrKuIIwqIHCQJsڋy~6iD쒁˓lDr>rwCzpsDC~qp5>/T"796tK_#7[W%J6UIeq1>\U>RpD6&og37<=lX"hW@?7@@A!lTVfV ƓN+Q86DNeKOOQVhZ9 54)Ouڊ NP QOOJ>BO.PlPPOOXPPvn59>>rm>QQDzYRRsRzFqC Ii>ttVtsKJ@S5r@UET W]fWWW>6XZFo,ZY~ZZZFYaB6mCt!Z^Z׋tqrI7\\^^H^|:^O[766*Gr4 __'kZ;D[u`~``(+&_>%%soa>F&aau`,-FMqdeFj+):"+P4x.7c[d1ccIg-b,;dkeri;02I2 U2?f21:AU"U[U%Tx1*42d421Bf$mkfK0fpxcf22frX8:87;73t;g*Fhh;jc87D3jRjjkehLj;zjWk?<ˊ܉gm oI?=n<@=Z nGX$mBx;qCvBpPrrrG%GyQJzt>_6JJI_?>J#5?`>tIH2WBdP!RQxw22ww{wF7^:H8tt>JJ@JaUxxxxsYyAwVAy-j>:zynA2A5yL I=n5kUp56 zYZ&ZZ Z[x*Z[zA]|m|B[^^|I||||j}~}Nab\aH{}^jBuk gN5WdcbI'{,ZC] {^Ecj?49Iee'qlD7Dƀ BgØBjbeQjSmrZA@+[Z=-"tZnEOeMVTwwً>FF7=HM_+Be)qpEm}YwYnC6* L0JBXlo!#Hyon雵6/IqUIKb@';+4Et>HBJC>%2fe>IxJ?tkt>AGhJWh&/c[itc>Jjss>>JJfJ$IHtIpvIs_1ΊU5IkqCI V Uy}PJR.E 7IYtZ6[=6_yZbt< J9Pi=L=uqBnDWmO~gpln oo=Qu64F>qHYn>IAkXW6RpbCqJ/#hgi4{673Lj6l>DD&mQmloo q=:타lSpYZaZqZA-7Y<6qfBnZ+ZB+j>6w[DBqYBተO(m\DM~C jVBp3qC=l%OJe~Y/]=\_]J}&T:3~W?p[p]s|Y Orsz8s9sVAsHs>{lqHs> w>lVttt>>>>t?S?Bumuruu|?uu?Mv?tv?zv\Oq#ViX@Cw9@agE@5wj@o@^\wwXxpx@9xGxQxfxH5U3yh2yA AyyzgAzAzyAzzA!Nb{l{{{||`BzB{||B|B|p }}}}rC %9{.1T=WpC *s`uD9;VYZD:X|%D-DWTDvʂ؂DWiipd`E8R;EopwErEFF$Ggy)8QԌG_XÍGN:UTWqU7HΎ򎷏ʏ̏3ęHI(XkCEIQIS->jITy-I3Ig$J@5J—TVJ`KDXQ7B]bpKřK<ziݛmL o7I:PV{ƞܔzDiÔY@X7vWWsq jT; T ; S e | ` zV o Ui/-s \ ^\Ovg{G6/;dSu6wxNp-j-E*pbqUhE i6|"##*'q(O)g))**+?+GL,,,[----B.t//30f033_Hffyzg55I67FXgi:Wv_>>u HJAB C;@4CCEJQY;<DDWtF9/Gəb7!^NHHJ rJx eYNOyڎ,PR?WqqRTJ?JUFTnTRks4?U2v^UGbUfUW?I]XfP43Y|GHZ[\WQqa|VaObdJd[]kdId?eKef'eWa'ZV!EfjN4IVml6wgnhd^hhB{ &i9iEzi&-j_6id!y4j[k,]5kFl;uemX7%KpqTzf=Uv<5VVYN^XbVmm[>Lc{0e-VJ\TS=}L"VVI^uY@=pNI 6^;vENvwE2TH%V2UbyCVT5VUf-64uUUTrUA ^HQvb,Z}UubmT͌qvccciUC+r.Q4 QMTUUfv-huLjDsG[ h{V&/}As}nrp<frNGO@]e-HG| uH`q~PNNw5 [lgS69}S6FXnK-KTWZy R:e$ts M<0[LOޟ\=rg 7.c%}>,>*:Rt>z6E@vZzx.X@|Vt]Tv4L7a0C]VWcI4Rp5|V|9WlS\dД5cdq( "mJq Q]L{\{hb5c{*~|B||{ >IZsU[OO`R>RgWVPY^ȗ\iT@,S0a,iS ;LAiPFumڙsRY\Qc#mjVzubOsp|!\<Iv*N BJ\izWR]N1l9OTTR55Rk|.zq{kx VJwSԍOb}(uzwJ>zxlgvZ&lևuSx@ rqs-st댻J/_D;n~%`gvךDn,s!5rLQ|JYaYaL}a_Woab9b\:aS3dch5W]‹ڏ9PFy2S8;e@w|_|-zfcM}ut gbt[t$wgSun·ȁIC+wtڄ56im@t=vq`a?@ABCDEFGHIJKLMNO!!!1ZNRDQv12!!!00............................P[TuSKjxψXR`|ZT%f%W%`%l%c%Z%i%]%R%d%U%^%j%a%X%g%[%S%e%V%_%k%b%Y%h%\%Q%P%m%n%p%o%Gے?LBsQI6BID<i-7{_ R&R8qDmStS~SwSSSSsrWY?sSSIlINWS: S?-Sw Typ+UWf[mmTSkt ]UTTG =M &GUL/TtUU:@RE5Df7Vf2ffMVOVxVSWVVf#6OFWAnlpBW6~lWXTcC&XK\XXa5XX<X[CWPxBӓ5Yh6Yn>$ZSUYN l*mYmqm(YEnZcZ6I7ZetZoT%=27^Rv[e|[z@]H[`a4Y[[M\D\s\(kI\H\\\]7]]F]\]-8II s!68;.^jz^D SNSq ^^^^8^>h _:H::_h#q$c_nnr_@6_]_=PRjph&֑)1`fwc9=96W'qy@>``IISztPZda$BanaQVa[?_(a]a29)(#`\aecbpb .lcI:8dco6.@Wdd{f::dW:Meo(J#Jeme_e~0e@I7Ke@)ee_4f11Df11KfugfQsf=121Sw(gC!J+;i7ggbgAgD"hPn<h3m]ho4i jߊsih5ii2=:<6;gaiJB6ii;cPiY6*!Ej7j;gj <k# `5ktk'n:X@7!TZ;k>k7l$HQkZl&yl=D=A II<6<2 1$7h%mmmm\m|noI@rn3toQ.!/>St?yOnZK0o 7o0>n=@UEDo\oN=top;=oDAo@UA9@???AQVAWA@AaKp~pppppppA=qqwB+qEqZJq\eCOqbB,qZD'J"Jq苽prBrYC$rAV.r@rtIhUrWrU>D0 h=or+s#H+H(s.sss: .jsItA$J#f6IIIsti&J9t>(`tGtsvtlt07tt,jtSIJ_AyJF[tuuَK[MuJugunuO?Mu]tuuv,vQvOvovvvcv7iivvvvobP}Qw&w@wd RXw2wdhwvJhxxx.yUx4yx v+`&yiyWXy9{y y../Objects/listobject.cGC object already tracked../Objects/listobject.c../Objects/listobject.clist index out of range../Objects/listobject.clist assignment index out of range../Objects/listobject.ccannot add more objects to list../Objects/listobject.ccannot add more objects to list../Objects/listobject.c[...][, ][...][] while getting the repr of a list[], list index out of range../Objects/listobject.ccan only concatenate list (not "%.200s") to listcan only assign an iterable../Objects/listobject.clist assignment index out of rangenO:insertargument must be iterable|n:poppop from empty listpop index out of rangecomparison function must return int, not %.200ssortwrapperexpected a sortwrapperobjectexpected a sortwrapperobjectexpected a sortwrapperobjectcmpwrappercmpkeyreverse|OOi:sortthe cmp argument is not supported in 3.xlist modified during sort../Objects/listobject.c../Objects/listobject.c../Objects/listobject.cO|O&O&:index%r is not in listlist.remove(x): x not in listsequence|O:list__getitem____reversed____sizeof__appendinsertextendpopremoveindexcountreversesortlist indices must be integers, not %.200smust assign iterable to extended sliceattempt to assign sequence of size %zd to extended slice of size %zdlist indices must be integers, not %.200slist__length_hint__listiterator../Objects/listobject.cGC object already tracked__length_hint__listreverseiteratortruncate([size]) -> None. Truncate the file to at most size bytes. Size defaults to the current file position, as returned by tell().ceil(x) Return the ceiling of x as a float. This is the smallest integral value >= x.S.isalnum() -> bool Return True if all characters in S are alphanumeric and there is at least one character in S, False otherwise.stack_size([size]) -> size Return the thread stack size used when creating new threads. The optional size argument specifies the stack size (in bytes) to be used for subsequently created threads, and must be 0 (use platform or configured default) or a positive integer value of at least 32,768 (32k). If changing the thread stack size is unsupported, a ThreadError exception is raised. If the specified size is invalid, a ValueError exception is raised, and the stack size is unmodified. 32k bytes currently the minimum supported stack size value to guarantee sufficient stack space for the interpreter itself. Note that some platforms may have particular restrictions on values for the stack size, such as requiring a minimum stack size larger than 32kB or requiring allocation in multiples of the system memory page size - platform documentation should be referred to for more information (4kB pages are common; using multiples of 4096 for the stack size is the suggested approach in the absence of more specific information).lookup_error(errors) -> handler Return the error handler for the specified error handling name or raise a LookupError, if no handler exists under this name.@Ł>@finditer(string[, pos[, endpos]]) --> iterator. Return an iterator over all non-overlapping matches for the RE pattern in string. For each match, the iterator returns a match object.,@atol(s [,base]) -> long Return the long integer represented by the string s in the given base, which defaults to 10. The string s must consist of one or more digits, possibly preceded by a sign. If base is 0, it is chosen from the leading characters of s, 0 for octal, 0x or 0X for hexadecimal. If base is 16, a preceding 0x or 0X is accepted. A trailing L or l is not accepted, unless base is 0.44?4!4$4c string,string -> int. Compares two strings according to the locale.Return size of C struct described by format string fmt.6(-O.E6[-~,8"-L"@y"@"@X"@"@R"@ "@N""@#"@H%"@&"@D("@)"@@+"@,"@<."@/"@81"@2"@44"@5"@07"@8"@,:"@;"@(="@>"b?"@@"@^B"B"@.D"@E"@*G"@H"@,151%.80s (%.80s) %.80s2.7.5dumps(value[, version]) Return the string that would be written to a file by dump(value, file). The value must be a supported type. Raise a ValueError exception if value has (or contains an object that has) an unsupported type. New in version 2.4: The version argument indicates the data format that dumps should use.versionB.zfill(width) -> copy of B Pad a numeric string B with zeros on the left, to fill a field of the specified width. B is never truncated.\)D+T8+TH+TI+Y0+YL+YM+ZC+ZN+ZO+7+J+K+`+f+d+e+K0+$0K0w$M0-$0M0x$O0/$0O0y$Q01$0Q0z$S03$0S0{$0+%00w%0-%00x%0/%00y%01%00z%03%00{%0;%00|%0D%00}%0H%00~%1u&01x&?6,E6r"LB.isdigit() -> bool Return True if all characters in B are digits and there is at least one character in B, False otherwise.append(x) Append new value x to the end of the array.strftime(format[, tuple]) -> string Convert a time tuple to a string according to a format specification. See the library reference manual for formatting codes. When the time tuple is not present, current time as returned by localtime() is used. ?4?4S.join(iterable) -> string Return a string which is the concatenation of the strings in the iterable. The separator between elements is S.__enter__() -> self.writerow(sequence) Construct and write a CSV record from a sequence of fields. Non-string elements will be converted to string.:@close() -> None or (perhaps) an integer Close the file. Sets data attribute .closed to true. A closed file cannot be used for further I/O operations. close() may be called more than once without error.  6 <D!-p-+1˛  :dD)$tD)8ttyname(fd) -> string Return the name of the terminal device connected to 'fd'.#D/ssl/clone#D/ssl/%s/datafd %dsecretin %ssecretout %salg %sclient finishedserver finished#a/tls/clone#a/tls/%s#a/tls/%s/data#a/tls/%s/handfd %d 0x301version 0x301secret %s %s %d %schangecipheropened_socket.CAPIsha1 rc4_256SSLv2SSLv3TLSv1/SSLv3TLSv1PySSL_cryptoalgs(%s) finish cryptoalgs %s:%d _p9ssl.cThe operation did not complete (X509 lookup)EOF occurred in violation of protocolSome I/O error occurredTLS/SSL connection has been closed%s:%d %s(is)%s/status Status:EstablishedHandshakingRemoteClosedLocalClosedAlertingErroredClosed%s:%d %s _p9ssl.c_p9ssl.c:203 : Both the key & certificate files must be specified_p9ssl.c:210 : Both the key & certificate files must be specified for server-side operation_p9ssl.c:222 : Invalid SSL protocol varient specified._p9ssl.c:227 : No cipher can be selected.O!i|zziizz:sslwrap _p9ssl.c:313 : No root certificates specified for verification of other-side certificates._p9ssl.c:321 : Invalued cacerts file._p9ssl.c:332 : Unabled to read certificate._p9ssl.c:340 : Unable to read certificate chain._p9ssl.c:352 : SSL2 incompletestrictcommonNamesurnamecountryNamelocalityNamestateOrProviceNameorganizationNameorganizationUnitNametitlenamegivenNameinitialsgenerationQualifierdnQualifiersubjectissuerversion%BserialNumber%snotBefore%snotAfters|i:test_decode_certificateCan't open fileError decoding PEM-encoded fileError decoding X509 cert|O:peer_certificate_p9ssl.c#a/tls/%s/status EncIn:|n:read_p9ssl.cs*:writeSocket error.Alert.Underlying socket has been closed._p9ssl.cfinish pending, %s:%d _p9ssl.cUnderlying socket has been closed._p9ssl.c:1227 : Service inactivedo_handshakewritereadpendingserverissuerpeer_certificateciphershutdownssl.SSLContexts#d:RAND_addRAND_egd() expected string, found %ssslwrap_test_decode_certRAND_addRAND_egdRAND_status_sslssl.SSLErrorSSLErrorSSLTypeSSL_ERROR_ZERO_RETURNSSL_ERROR_WANT_READSSL_ERROR_WANT_WRITESSL_ERROR_WANT_X509_LOOKUPSSL_ERROR_SYSCALLSSL_ERROR_SSLSSL_ERROR_WANT_CONNECTSSL_ERROR_EOFSSL_ERROR_INVALID_ERROR_CODECERT_NONECERT_OPTIONALCERT_REQUIREDPROTOCOL_SSLv2PROTOCOL_SSLv3PROTOCOL_SSLv23PROTOCOL_TLSv1OPENSSL_VERSION_NUMBERIIIIIOPENSSL_VERSION_INFOPlan 9 devssl, ssl(3)OPENSSL_VERSIONS.upper() -> unicode Return a copy of S converted to uppercase.readlines([size]) -> list of strings, each a line from the file. Call readline() repeatedly and return a list of the lines so read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned.acos(x) Return the arc cosine of x.v,~,w.100p/\r4r4 r4RAND_egd(path) -> bytes Queries the entropy gather daemon (EGD) on the socket named by 'path'. Returns number of bytes read. Raises SSLError if connection to EGD fails or if it does provide enough data to seed PRNG. Plan 9 version uses libmp and genrandom.y!nr !D~ !Ѕ !y ! { !n| ! r !x ! ! !W ! !} !W !~ !( ! ! !3s !t ! *% % EN/ H9p'H)vO"A tP9S.islower() -> bool Return True if all cased characters in S are lowercase and there is at least one cased character in S, False otherwise.)));@.@_multibytecodec__create_codecencoding name must be a string.no such codec is supported.multibytecodec.__map_*getcodecmultibytecodec.__map_*jisx0208jisx0212jisxcommonjisx0213_1_bmpjisx0213_2_bmpjisx0213_bmpjisx0213_1_empjisx0213_2_empjisx0213_empjisx0213_paircp932extshift_jiscp932euc_jpshift_jis_2004euc_jis_2004euc_jisx0213shift_jisx0213_codecs_jpHUUUU?3333*$I$qtEUUU;$I8^Cy 0 ,d! p= ^B{ I$ B|uPq/net/cs!sys=%s ip=*!dom=%s ip=*!ip=%sdomsysip}-DT! @n1E$n10n1GCn1Qn1en1n1n1]n1\&n1Bn1;n1mAn1rEo1Jo1T,o1Oo17]o17no1&9xo1b9o19o19o1:o1Q:o1:o1:o1;o1=;o1;o1H&o1- p16p1IB/p1BHp1=Tp1>bp1x@xp1Hp1Jp1cOp1Tp1Up1uUp1 V߰swapcase(s) -> string Return a copy of the string s with upper case characters converted to lowercase and vice versa.x"x"x"x"no mem for new parser no mem for next token S.index(sub [,start [,end]]) -> int Like S.find() but raise ValueError when the substring is not found.S.zfill(width) -> unicode Pad a numeric string S with zeros on the left, to fill a field of the specified width. The string S is never truncated.sin(x) Return the sine of x..C<@sys.flags Flags provided through command line arguments or environment vars.gethostbyname(host) -> address Return the IP address (a string of the form '255.255.255.255') for a host.NMTOKEN L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#cPTWX]^knqstuyVUZ\[`_becdhijoprxwz{}|ªêĪŪƪǪȪɪʪ˪̪ͪΪϪЪѪҪӪԪժ֪תت٪ڪ۪ܪݪުߪ«ëīūƫǫȫɫʫ˫̫ͫΫϫЫѫҫӫԫի֫׫ث٫ګ۫ܫݫޫ߫¬ìĬŬƬǬȬɬʬˬ̬ͬάϬЬѬҬӬԬլ֬׬ج٬ڬ۬ܬݬެ߬­íĭŭƭǭȭɭʭ˭̭ͭέϭЭѭҭӭԭխ֭׭ح٭ڭۭܭݭޭ߭®îĮŮƮǮȮɮʮˮ̮ͮήϮЮѮҮӮԮծ֮׮خٮڮۮܮݮޮ߮¯ïįůƯǯȯɯʯ˯̯ͯίϯЯѯүӯԯկ֯ׯدٯگۯܯݯޯ߯@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~٦ڦۦܦݦަߦ§çħŧƧǧȧɧʧ˧̧ͧΧϧЧ¨èĨX[]^_QRSYafglmv~execv(path, args) Execute an executable path with arguments, replacing current process. path: path of executable file args: tuple or list of stringsmkdir(path [, mode=0777]) Create a directory.Ŗ!5|E!| }{"h/26\x3D/+Ellipsisellipsisslice step cannot be zeroslice()sliceslice(, )startstopstep(nnn)O(OOO)indices__reduce__unhashable typeslice $- <=@float.fromhex(string) -> float Create a floating-point number from a hexadecimal string. >>> float.fromhex('0x1.ffffp10') 2047.984375 >>> float.fromhex('-0x1p-1074') -4.9406564584124654e-324=\9w38.D\9 4؈-\9U|\.\9P@H1\9@`"\9$Cz-]9VH2-]9H4!]9&I4]9EI']9dI;&]9It.0]9ILu17]9J$?]9K)G]9Kh.N]9.K܏3W]9K|F+\]9!L<9b]9M$i]9M$$p]9R8$u]9PP,{]9^Q,0]9Q07]9U']9U8;-]9BVt1]9V;]9V=0]9W8)]9#X3]9X$]9 Y51]9YR-]9Zk8]9[91]9~\ count object Return a count object whose .next() method returns consecutive values. Equivalent to: def count(firstval=0, step=1): x = firstval while 1: yield x x += step H)*/oV{z]6%48yhx{ASqq;;Hgetsignal(sig) -> action Return the current action for the given signal. The return value can be: SIG_IGN -- if the signal is being ignored SIG_DFL -- if the default action for the signal is in effect None -- if an unknown handler is in effect anything else -- the callable Python object used as a handler3):)@)readline([size]) -> next line from the file, as a string. Retain newline. A non-negative size argument limits the maximum number of bytes to return (an incomplete line may be returned then). Return an empty string at EOF. 6| 6-6CחARemove and return the rightmost element.  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~f8L@0f8΃XY"f8$f8 $f8υ6-f8e$;SG.^\N]eg^ggXa dAegj`shh    !"# $_##\##@$\#$$%Efficient content parsing."(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDl43)=3Q3_Z36,E6rc/L->@6,('!E@ʔ6r$"8Ln; &C vkkMPG&"֊/aK+d 5ӆ1 Cͼ-}wp4mG0K=V9'C#=.r *ϝxO K} xV|iqލuݓklRobfF^[^Z}Wf`Sc0M-ZI D@ƥ d'NK`%#/+6lA/ ]D@hf+*{Pu&6>;;kvqUP2M_}1>φ˃4y:Z iYmێ`7Od2z~\sKwV OK86F+GB{\=fX@US]CQ;%)&!,G^(BM6P2,v?kZ;&H VM#RV/K`mpl +e= hﶻ'؀odj#ͳ`~>ɐ}:{y`6q}[Fu2 t-0q].KYT@PENOJ+ GC!}{`COFr[v hJGl0a$-eK^VZp0m5= ^[ Q7R3?>:З$:V -T)y&;h+̠ȥPMlk/|vˡv`#ds'ě yg:Ջb}>  q+2h6mf{u]6@q3q3q3B.endswith(suffix [,start [,end]]) -> bool Return True if B ends with the specified suffix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. suffix can also be a tuple of strings to try.Read and return up to n bytes. If the argument is omitted, None, or negative, reads and returns all data until EOF. If the argument is positive, and the underlying raw stream is not 'interactive', multiple raw reads may be issued to satisfy the byte count (unless EOF is reached first). But for interactive raw streams (as well as sockets and pipes), at most one raw read will be issued, and a short result does not imply that EOF is imminent. Returns an empty bytes object on EOF. Returns None if the underlying raw stream was open in non-blocking mode and no data is available at the moment. SRE 2.2.2 Copyright (c) 1997-2002 by Secret Labs AB }t3t3t3t3days=%d; must have magnitude <= %dyear is out of rangemonth must be in 1..12day is out of range for monthhour must be in 0..23minute must be in 0..59second must be in 0..59microsecond must be in 0..999999date value out of rangetzinfo argument must be None or of a tzinfo subclass, not type '%s'Otzinfo.%s() must return a whole number of minutestzinfo.%s() must return None or timedelta, not '%s'tzinfo.%s() returned %d; must be in -1439 .. 1439utcoffsetdsttznameOtzinfo.tzname() must return None or a string, not '%s', tzinfo=)MonTueWedThuFriSatSunJanFebMarAprMayJunJulAugSepOctNovDec%s %s %2d %02d:%02d:%02d %04d%c%02d%s%02d%06d%06d%06dyear=%ld is before 1900; the datetime strftime() methods require year >= 1900strftime format ends with raw %replacess%%%tzname.replace() did not return a stringtimestrftimeOO%04d-%02d-%02d%02d:%02d:%02d.%06dtimetime()timestruct_time((iiiiiiiii))can't compare %s to %snormalized days too large to fit in a C intunsupported type for timedelta %s component: %sdayssecondsmicrosecondsmillisecondsminuteshoursweeks|OOOOOOO:__new__microsecondsmillisecondssecondsminuteshoursdaysweeks%s(%d, %d, %d)%s(%d, %d)%s(%d)%d day%s, s%d:%02d:%02d.%06dgoofy result from PyOS_snprintfiiiONdaysNumber of days.secondsNumber of seconds (>= 0 and less than 1 day).microsecondsNumber of microseconds (>= 0 and less than 1 second).total_secondsTotal seconds in the duration.__reduce____reduce__() -> (cls, state)datetime.timedeltayearmonthdayyearmonthdayiiiiiitimestamp out of range for platform localtime() functionfromtimestampOd:fromtimestampi:fromordinalordinal must be >= 1iii%s(%d, %d, %d)isoformat()formats#:strftimetimetuple()O:__format____format__ expects str or unicode, not %.200sstrftimeOiiitimetuple|iii:replaceiii(N)(ON)fromtimestamptimestamp -> local date from a POSIX timestamp (like time.time()).fromordinalint -> date corresponding to a proleptic Gregorian ordinal.todayCurrent date or datetime: same as self.__class__.fromtimestamp(time.time()).ctimeReturn ctime() style string.strftimeformat -> strftime() style string.__format__Formats self with strftime.timetupleReturn time tuple, compatible with time.localtime().isocalendarReturn a 3-tuple containing ISO year, week number, and weekday.isoformatReturn string in ISO 8601 format, YYYY-MM-DD.isoweekdayReturn the day of the week represented by the date. Monday == 1 ... Sunday == 7toordinalReturn proleptic Gregorian ordinal. January 1 of year 1 is day 1.weekdayReturn the day of the week represented by the date. Monday == 0 ... Sunday == 6replaceReturn date with new specified fields.__reduce____reduce__() -> (cls, state)datetime.datea tzinfo subclass must implement %s()tznameutcoffsetdstfromutc: argument must be a datetimefromutc: dt.tzinfo is not selffromutc: non-None utcoffset() result requiredfromutc: non-None dst() result requiredfromutc: tz.dst() gaveinconsistent results; cannot convert__getinitargs____getstate__(ON)(ONN)tznamedatetime -> string name of time zone.utcoffsetdatetime -> minutes east of UTC (negative for west of UTC).dstdatetime -> DST offset in minutes east of UTC.fromutcdatetime in UTC -> datetime in local time.__reduce__-> (cls, state)datetime.tzinfohourminutesecondmicrosecondtzinfohourminutesecondmicrosecondtzinfobad tzinfo state arg|iiiiOutcoffsetdst%s(%d, %d, %d, %d)%s(%d, %d, %d)%s(%d, %d)isoformat():formats#:strftimeiiiiiiiiican't compare offset-naive and offset-aware timesiiii|iiiiO:replaceiiiiO(ON)isoformatReturn string in ISO 8601 format, HH:MM:SS[.mmmmmm][+HH:MM].strftimeformat -> strftime() style string.__format__Formats self with strftime.utcoffsetReturn self.tzinfo.utcoffset(self).tznameReturn self.tzinfo.tzname(self).dstReturn self.tzinfo.dst(self).replaceReturn time with new specified fields.__reduce____reduce__() -> (cls, state)datetime.timehourminutesecondmicrosecondtzinfoyearmonthdayhourminutesecondmicrosecondtzinfobad tzinfo state argiii|iiiiOiiiiiiiOtimestamp out of range for platform localtime()/gmtime() functiontz|O:nowfromutcOtimestamptzd|O:fromtimestampfromutcOd:utcfromtimestampss:strptime_strptime_strptimessiiiiiiiunexpected value from _strptime._strptimedatetimeO!O!:combineiiiiiiiOutcoffsetdstcan't subtract offset-naive and offset-aware datetimes%s(%d, %d, %d, %d, %d, %d, %d)%s(%d, %d, %d, %d, %d, %d)%s(%d, %d, %d, %d, %d)isoformat(s) sep|c:isoformat:timetuplecan't compare offset-naive and offset-aware datetimes|iiiiiiiO:replaceiiiiiiiOtzO!:astimezonefromutcOastimezone() cannot be applied to a naive datetime(ON)now[tz] -> new datetime with tz's local day and time.utcnowReturn a new datetime representing UTC day and time.fromtimestamptimestamp[, tz] -> tz's local time from POSIX timestamp.utcfromtimestamptimestamp -> UTC datetime from a POSIX timestamp (like time.time()).strptimestring, format -> new datetime parsed from a string (like time.strptime()).combinedate, time -> datetime with same date and time fieldsdateReturn date object with same year, month and day.timeReturn time object with same time but with tzinfo=None.timetzReturn time object with same time and tzinfo.ctimeReturn ctime() style string.timetupleReturn time tuple, compatible with time.localtime().utctimetupleReturn UTC time tuple, compatible with time.localtime().isoformat[sep] -> string in ISO 8601 format, YYYY-MM-DDTHH:MM:SS[.mmmmmm][+HH:MM]. sep is used to separate the year from the time, and defaults to 'T'.utcoffsetReturn self.tzinfo.utcoffset(self).tznameReturn self.tzinfo.tzname(self).dstReturn self.tzinfo.dst(self).replaceReturn datetime with new specified fields.astimezonetz -> convert to local time in new timezone tz __reduce____reduce__() -> (cls, state)datetime.datetimedatetimeFast implementation of the datetime type.resolutionminmaxminmaxresolutionminmaxresolutionminmaxresolutionMINYEARMAXYEARdatedatetimetimetimedeltatzinfodatetime.datetime_CAPIdatetime_CAPIThis module contains functions that can read and write Python values in a binary format. The format is specific to Python, but independent of machine architecture issues. Not all Python object types are supported; in general, only objects whose value is independent from a particular invocation of Python can be written and read by this module. The following types are supported: None, integers, long integers, floating point numbers, strings, Unicode objects, tuples, lists, sets, dictionaries, and code objects, where it should be understood that tuples, lists and dictionaries are only supported as long as the values contained therein are themselves supported; and recursive lists and dictionaries should not be written (they will cause infinite loops). Variables: version -- indicates the format that the module uses. Version 0 is the historical format, version 1 (added in Python 2.4) shares interned strings and version 2 (added in Python 2.5) uses a binary format for floating point numbers. (New in version 2.4) Functions: dump() -- write value to a file load() -- read value from a file dumps() -- write value to a string loads() -- read value from a stringdt3kt3N,A 8O,D P$ O,B u4O,C <!O,E (#)O,7F C0C0[ C0#e/_fdinfo/env/_sighdlr/env/cos(x) Return the cosine of x.@CSV reader Reader objects are responsible for reading and parsing tabular data in CSV format. z!gAd/fgtime() -> floating point number Return the current time in seconds since the Epoch. Fractions of a second may be present if the system clock provides them.R.F Y.6 E6>.eLntohs(integer) -> integer Convert a 16-bit integer from network to host byte order./BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqsqrt(x) Return the square root of x.{/ɪ '/6/-,j8/{-//t//R/#////`/'/̰8/I/VZ/,h/y//V//////1/έ'/ZA/$[/j/y//"////K//<_-/%PU"__sizeof__() -> int Size of the array in memory, in bytes.?@S.__sizeof__() -> size of S in memory, in bytesReturns a reverse iterator.usage: %s [option] ... [-c cmd | -m mod | file | -] [arg] ... Options and arguments (and corresponding environment variables): -B : don't write .py[co] files on import; also PYTHONDONTWRITEBYTECODE=x -c cmd : program passed in as string (terminates option list) -d : debug output from parser; also PYTHONDEBUG=x -E : ignore PYTHON* environment variables (such as PYTHONPATH) -h : print this help message and exit (also --help) -i : inspect interactively after running script; forces a prompt even if stdin does not appear to be a terminal; also PYTHONINSPECT=x -m mod : run library module as a script (terminates option list) -O : optimize generated bytecode slightly; also PYTHONOPTIMIZE=x -OO : remove doc-strings in addition to the -O optimizations -R : use a pseudo-random salt to make hash() values of various types be unpredictable between separate invocations of the interpreter, as a defense against denial-of-service attacks -Q arg : division options: -Qold (default), -Qwarn, -Qwarnall, -Qnew -s : don't add user site directory to sys.path; also PYTHONNOUSERSITE -S : don't imply 'import site' on initialization -t : issue warnings about inconsistent tab usage (-tt: issue errors) -u : unbuffered binary stdout and stderr; also PYTHONUNBUFFERED=x see man page for details on internal buffering relating to '-u' -v : verbose (trace import statements); also PYTHONVERBOSE=x can be supplied multiple times to increase verbosity -V : print the Python version number and exit (also --version) -W arg : warning control; arg is action:message:category:module:lineno also PYTHONWARNINGS=arg -x : skip first line of source, allowing use of non-Unix forms of #!cmd -3 : warn about Python 3.x incompatibilities that 2to3 cannot trivially fix file : program read from script file - : program read from stdin (default; interactive mode if a tty) arg ...: arguments passed to program in sys.argv[1:] Other environment variables: PYTHONSTARTUP: file executed on interactive startup (no default) PYTHONPATH : '%c'-separated list of directories prefixed to the default module search path. The result is sys.path. PYTHONHOME : alternate directory (or %c). The default module search path uses %s. PYTHONCASEOK : ignore case in 'import' statements (Windows). PYTHONIOENCODING: Encoding[:errors] used for stdin/stdout/stderr. PYTHONHASHSEED: if this variable is set to 'random', the effect is the same as specifying the -R option: a random value is used to seed the hashes of str, bytes and datetime objects. It can also be set to an integer in the range [0,4294967295] to get hash values with a predictable seed. Try `python -h' for more information. /pythonX.XPYTHONSTARTUPrCould not open PYTHONSTARTUP runpyCould not import runpy module _run_module_as_mainCould not access runpy._run_module_as_main (si)Could not create arguments for runpy._run_module_as_main path__main__3bBc:dEhiJm:OQ:RsStuUvVW:xX?PYTHONHASHSEED3bBc:dEhiJm:OQ:RsStuUvVW:xX?not enough memory to copy -c argument not enough memory to copy -m argumentoldwarnwarnallnew-Q option should be `-Qold', `-Qwarn', `-Qwarnall', or `-Qnew' only Python %s 2.7.5PYTHONINSPECTPYTHONUNBUFFEREDPYTHONNOUSERSITEPYTHONWARNINGSnot enough memory to copy PYTHONWARNINGS,,-Python %s on %s %s Type "help", "copyright", "credits" or "license" for more information.-c-creadliner%s: can't open file '%s': [Errno %d] %s %s: '%s' is a directory, cannot continue PYTHONINSPECTTransform list into a heap, in-place, in O(len(heap)) time.all(iterable) -> bool Return True if bool(x) is True for all values x in the iterable. If the iterable is empty, return True.L`88L8U8!yE!yYzxH $B.capitalize() -> copy of B Return a copy of B with only its first character capitalized (ASCII) and the rest lower-cased.(bin) -> ascii. Base64-code line of data8V;s"8\75-89@ +#8D#)8E 0/8-jy678jH%?8gs$G8i` +O8kg8W8nhX8_8iP"g8Gx;r8G$x8q_o-8888@548T@,"8]D%8[y88@T/8@"8D88Y9Pl;8^l /8D0o;8I\i/8fJH~68'F$8ueHL)8e c/8wf)8g0.18w68D!8؃58DG8`,z1N8a $U8b(t6`8l 1k8l$w/v8lRemove all elements from the deque.q'x''''' '9'I'FS'''8SetBase(base_url) Set the base URL for the parser.CObject type is not supported in 3.x. Please use capsule objects instead.PyCObject_FromVoidPtrAndDesc called with null descriptionPyCObject_AsVoidPtr with non-C-objectPyCObject_AsVoidPtr called with null pointerPyCObject_GetDesc with non-C-objectPyCObject_GetDesc called with null pointerInvalid call to PyCObject_SetVoidPtrPyCObject1113Ixz;3Kw83Jh?) $$$$$ -$.$ :$;$$G$H$$T$U$(~]$x$,rx$$<S$$@2$$Dx$$H[u$;$H[G$H$LT$$L$$dM($$dMS$$dM$ $dM$*$dMׂ1$F$dMM$c$l xl$$p$/$$R$$Z$ $ބ$-$C6$u$}$~$|$$v$$v$$jv$$jv$$1v $!$1v*$A$vI$_$vh$$v$$v$$v$$v$$w!$G$uxP$w$x$$œx$$x$$ou$$x$$#v$$>$#vJ$e$vp$$v$$v$$v$$xv$ $xv$-$?v4$I$?vQ$g$&wr$$ Bx$$px$$x$$̪x$$x%$=$ (uF$^$$^ug$$(u$$,ʫu$$0u$$46u$$8lu$,$<u8$T$@جu]$u$Du~$$HDu$$Lzv$$Lzv$ $PGv$/$PGv<$W$Tue$$XJu$$\Ǟx$$` u$$dَu $&$h}2$R$hk~^$}$l u$$pu$$t'y$$t'y$$x3z$ $|z-$${$${$$_|$[$|h$$o}$$u$$'y#$3N"QM"UM"YM"  #%&)*,/12478;=>@CEFIJLOQRTWX[]^abdghkmnpsuvyz|Module implements the Mersenne Twister random number generator. _DR, W+n &v2DGd@ H 0T0D5& @ + c($P`*h5O Ă(Q C57`zm =9" t0Р )߀@`v}Ӆ n /`Txh"pV%^,]lmC`6J`>b ">%\h JD54[ڐۇ-v:vb}W'[7 n!@ xn_?~=k꺺]s%K^*඙tO)&umRP`~oP#%u{R = (" P@0J$!E!#~Ř  !"#$%&'()*+,-./0123456789:;<=>??@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]00^_0`abcdefghijklmnopqrstuvwxyz{|}~00000000000000ZO0000000000000000000000000000000009+u9+:+!:+P:+4a:+h"i:+ȥ64m:+x:+:+:+08:+' 0:+X/+`3+ %+!/"%/bytearray.fromhex(string) -> bytearray Create a bytearray object from a string of hexadecimal numbers. Spaces between two numbers are accepted. Example: bytearray.fromhex('B9 01EF') -> bytearray(b'\xb9\x01\xef').H)=!9HS#p+.D;5Base85 Data Encodingi%lqSets an upper limit on parsed fields. csv.field_size_limit([limit]) Returns old limit. If limit is not given, no new limit is set and the old limit is returned #+3;CScsType basestring cannot be instantiated; it is the base for str and unicode.D.get(k[,d]) -> D[k] if k in D, else d. d defaults to None.ҙ!6ۥE8$1N@Remove and return the leftmost element.__import__(name, globals={}, locals={}, fromlist=[], level=-1) -> module Import a module. Because this function is meant for use by the Python interpreter and not for general use it is better to use importlib.import_module() to programmatically import a module. The globals argument is only used to determine the context; they are not modified. The locals argument is unused. The fromlist should be a list of names to emulate ``from name import ...'', or an empty list to emulate ``import name''. When importing a module from a package, note that __import__('A.B', ...) returns package A when fromlist is empty, but its submodule B when fromlist is not empty. Level is used to determine whether to perform absolute or relative imports. -1 is the original strategy of attempting both absolute and relative imports, 0 is absolute, a positive number is the number of parent directories to search relative to the current module.k-AxPrivate method returning an estimate of len(list(it)).High performance data structures. - deque: ordered collection accessible from endpoints only - defaultdict: dict subclass with a default value factory bin(number) -> string Return the binary representation of an integer or long integer.K8K8 X6f\!X6qXD0X6u(m8X6$y/(X6iv/X6T- Y6T^3Y6U4Y6A[ 3Y66^Є3'Y6_%,Y65x36Y6pa@j/ integer Return the configuration limit name for the file descriptor fd. If there is no limit, return -1.RAND_status() -> 0 or 1 Returns 1 if the OpenSSL PRNG has been seeded with enough data and 0 if not. It is necessary to seed the PRNG with RAND_add() on some platforms before using the ssl() function.matchOwarningsonceregistrydefaultactionfilters_warnings.filters must be a list_warnings.filters item %zd isn't a 5-tuple_warnings.defaultaction not found.py:%d: __name__stderrlost sys.stderr : 'registry' must be a dictOerroralwaysignoreoncemoduledefault???Unrecognized action (%s) in warnings.filters: %sshowwarningwarnings.showwarning() must be set to a function or method__warningregistry____warningregistry____name____file____main__argv__main____main__category is not a subclass of WarningmessagecategorystacklevelO|On:warnmessagecategoryfilenamelinenomoduleregistrymodule_globalsOOOi|OOO:warn_explicitget_sourcesplitlines__loader____name__get_sourcewarnwarn_explicitignoreignoreerrorerrordefaultdefaultunknown actionignoreignoreignoreerrordefaultignore_warningsfiltersonce_registrydefaultdefault_actionI.encode(unicode[, errors]) -> (string, length consumed) Return an encoded string version of `unicode'. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle UnicodeEncodeErrors.next(iterator[, default]) Return the next item from the iterator. If default is given and the iterator is exhausted, it is returned instead of raising StopIteration.!4 /adm/usersS.isalpha() -> bool Return True if all characters in S are alphabetic and there is at least one character in S, False otherwise.callstats() -> tuple of integers Return a tuple of function call statistics, if CALL_PROFILE was defined when Python was built. Otherwise, return None. When enabled, this function returns detailed, implementation-specific details about the number of function calls executed. The return value is a 11-tuple where the entries in the tuple are counts of: 0. all function calls 1. calls to PyFunction_Type objects 2. PyFunction calls that do not create an argument tuple 3. PyFunction calls that do not create an argument tuple and bypass PyEval_EvalCodeEx() 4. PyMethod calls 5. PyMethod calls on bound methods 6. PyType calls 7. PyCFunction calls 8. generator calls 9. All other calls 10. Number of stack pops performed by call_function()select(rlist, wlist, xlist[, timeout]) -> (rlist, wlist, xlist) Wait until one or more file descriptors are ready for some kind of I/O. The first three arguments are sequences of file descriptors to be waited for: rlist -- wait until ready for reading wlist -- wait until ready for writing xlist -- wait for an ``exceptional condition'' If only one kind of condition is required, pass [] for the other lists. A file descriptor is either a socket or file object, or a small integer gotten from a fileno() method call on one of those. The optional 4th argument specifies a timeout in seconds; it may be a floating point number to specify fractions of seconds. If it is absent or None, the call will never time out. The return value is a tuple of three lists corresponding to the first three arguments; each contains the subset of the corresponding file descriptors that are ready. *** IMPORTANT NOTICE *** On Windows and OpenVMS, only sockets are supported; on Unix, all file descriptors can be used.)))H)B<{;<#D~4p;&t-a~ "9iv  :readable() -> bool. Returns True if the IO object can be read.load_module(fullname) -> module. Load the module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the imported module, or raises ZipImportError if it wasn't found.6 666B.lstrip([bytes]) -> bytearray Strip leading bytes contained in the argument. If the argument is omitted, strip leading ASCII whitespace.<)L .@)B1F)HHw1S)r$X)j !<`)H#k)1}) ?0)n2)S1)g3)O`m-);)=l3)v(3)c"%)(k-)o$)-)iv6ކ666666l6q6x6666 6'6+6F6M6(s(Llb)(ci)lllLsss)s(Olb)(ci)lllOsss:(f)wstatss|i:bindnot holding the import lockmkdir: %s already exists mkdir: can't create %s: %r et|i:mkdiri:dirreadnot a directorys:listdirnot a directoryiisis:mounts:stati:fstatsO:wstatiO:fwstats:removes:_exitsO:execvargv must be tuple or listempty argument listsall arguments must be stringsi:fork:awaitsisiii:closeis:fauthi:fd2pathii:dupiOi:seekiiL:readis#L:writeri|si(fdopen):pipe(ii)ss:putenv#e/%ss|s:unmount:abortabort() called from Python code didn't abort!i:sleepss:gettokens_exitabortawaitbindclosecreatedupexecvfauthforkfstatfwstatmkdirmountunmountopenfd2pathpipepreadpwriteremoverforkseeksleepstatwstatdirreaddirreadallgettokensfdopenplan9errorMREPLMBEFOREMAFTERMCREATEMCACHEOREADOWRITEORDWROEXECRFPROCRFNOWAITRFNAMEGRFCNAMEGRFNOMNTRFENVGRFCENVGRFNOTEGRFFDGRFCFDGRFRENDRFMEMatanh(x) Return the hyperbolic arc tangent (measured in radians) of x.Truncate size to pos. The pos argument defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new absolute position. ../../../../libmp/port/mpdiv.cconnect(address) Connect the socket to a remote address. For IP sockets, the address is a pair (host, port).%s: %s %s Return whether object supports random access. If False, seek(), tell() and truncate() will raise IOError. This method may need to do a test seek().66H))dJ))dx$E;:`Y# Return state information for pickling.ɀv~zM@exit() (exit_thread() is an obsolete synonym) This is synonymous to ``raise SystemExit''. It will cause the current thread to exit silently unless the exception is caught.zipimporter()s:zipimporterarchive path is emptyarchive path too longnot a Zip file???path too longs|O:zipimporter.find_modules:zipimporter.load_module__loader__%s%c%s%s[O]__path__import %s # loaded from Zip %s s:zipimporter.get_filenames:zipimporter.is_packagecan't find module '%.200s's:zipimporter.get_datas:zipimporter.get_codes:zipimporter.get_sourcecan't find module '%.200s'__init__.py.pyfind_moduleload_moduleget_dataget_codeget_sourceget_filenameis_packagearchiveprefix_fileszipimport.zipimporterZip path name is too longrbcan't open Zip file: '%.200s'can't read Zip file: %scan't read Zip file: '%.200s'not a Zip file: '%.200s'siiiiiii# zipimport: found %ld names in %s can't read Zip file: %szlibdecompress# zipimport: zlib %s availableUNAVAILABLEslllllllrbzipimport: can not open file %scan't read Zip file: %sbad local file header in %scan't read Zip file: %scan't read Zip file: %szipimport: can't read datacan't decompress data; zlib not availableOibad pyc data# %s has bad magic # %s has bad mtime compiled module %.200s is not a code objectzipimport: no memory to allocate source buffer# trying %s%c%s can't find module '%.200s'zipimportzipimport.ZipImportErrorZipImportErrorzipimporter_zip_directory_cacheENTITYReturn a new hash object using the named algorithm. An optional string argument may be provided and will be automatically hashed. The MD5 and SHA1 algorithms are always supported. nested_scopesgeneratorsdivisionabsolute_importwith_statementprint_functionunicode_literalsbracesnot a chancefuture feature %.100s is not defined__future__from __future__ imports must occur at the beginning of the file-6,EK6r@;Lז6,E6r$Lizip(iter1 [,iter2 [...]]) --> izip object Return a izip object whose .next() method returns a tuple where the i-th element comes from the i-th iterable argument. The .next() method continues until the shortest iterable in the argument sequence is exhausted and then it raises StopIteration. Works like the zip() function but consumes less memory by returning an iterator instead of a list.is_package(fullname) -> bool. Return True if the module specified by fullname is a package. Raise ZipImportError if the module couldn't be found.GetInputContext() -> string Return the untranslated text of the input that caused the current event. If the event was generated by a large amount of text (such as a start tag for an element with many attributes), not all of the text may be available.x].@^.@t`.@ta.@b.@pd.@e.@lg.@h.@hj.@k.@dm.@n.@`p.@q.@\s.@t.@Xv.@w.@Ty.@z.@P|.@}.@L.@ʀ.@H.@ƃ.@D.@†.@@.@.@<.@.@8.@.@4.@.@0.@.@(.@.@$.@.@ .@.@.@.@.@.@.@.@.@.@ .@.@.@.@.@.@.@~.@.@z.@.@v.@.@r.@.@n.@.@j.@.@f.@.@b.@.@^.@.@Z.@.@V.@.@R.@.@N.@.@J.@.@IDREFSuu3w ?#u3x Du;u3x d#u3y L'u3z 3u3| HD#u3| T-u3 $$u3 x )u3  ;u3' 46u3D Ы$u3, 4(u3 P1u3݆ D6u3X ;u3| `]4u3 `l-u3 L#u3( `*(u3A Q/u3 )v3 \h/v3m d- v3 3v3 8v3t $!v3 `k9,v3+ 11v3ՙ 745v3 ?) integer Return a non-zero integer that uniquely identifies the current thread amongst other threads that exist simultaneously. This may be used to identify per-thread resources. Even though on some platforms threads identities may appear to be allocated consecutive numbers starting at 1, this behavior should not be relied upon, and the number should be seen purely as a magic cookie. A thread's identity may be reused for another thread after it exits.super(type, obj) -> bound super object; requires isinstance(obj, type) super(type) -> unbound super object super(type, type2) -> bound super object; requires issubclass(type2, type) Typical use to call a cooperative superclass method: class C(B): def meth(self, arg): super(C, self).meth(arg)p-get_filename(fullname) -> filename string. Return the filename for the specified module.m6,E6r$L6,E6r$Lbisect_left(a, x[, lo[, hi]]) -> index Return the index where to insert item x in list a, assuming a is sorted. The return value i is such that all e in a[:i] have e < x, and all e in a[i:] have e >= x. So if x already appears in the list, i points just before the leftmost x already there. Optional args lo (default 0) and hi (default len(a)) bound the slice of a to be searched. !ՖE!Pf_backf_codef_builtinsf_globalsf_lastif_exc_traceback has been removed in 3.xf_exc_traceback has been removed in 3.xf_exc_type has been removed in 3.xf_exc_type has been removed in 3.xf_exc_value has been removed in 3.xf_exc_value has been removed in 3.xlineno must be an integerf_lineno can only be set by a line trace functionline %d comes before the current code blockline %d comes after the current code blockcan't jump to 'except' line as there's no exceptioncan't jump into or out of a 'finally' blockcan't jump into the middle of a blockf_localsf_linenof_tracef_restrictedf_exc_tracebackf_exc_typef_exc_value__sizeof__frame__builtins__NoneGC object already trackedXXX block stack overflowXXX block stack underflowrange(stop) -> list of integers range(start, stop[, step]) -> list of integers Return a list containing an arithmetic progression of integers. range(i, j) returns [i, i+1, i+2, ..., j-1]; start (!) defaults to 0. When step is given, it specifies the increment (or decrement). For example, range(4) returns [0, 1, 2, 3]. The end point is omitted! These are exactly the valid indices for a list of 4 elements.S.lower() -> string Return a copy of the string S converted to lowercase.u12}|1}1~1integerunsigned byte integer is less than minimumintegerunsigned byte integer is greater than maximumintegerintegerintegerintegerintegersigned short integer is less than minimumintegersigned short integer is greater than maximumintegerintegerintegerintegerintegersigned integer is greater than maximumintegersigned integer is less than minimumintegerintegerintegerintegerintegerintegerlonglongintegerfloatfloatcomplexchar(unicode conversion error)(cleanup problem)size does not fit in an int(unicode conversion error)size does not fit in an intsize does not fit in an int(unicode conversion error)stringstring without null bytes(unicode conversion error)(cleanup problem)size does not fit in an int(unicode conversion error)size does not fit in an intsize does not fit in an int(unicode conversion error)string or Nonesize does not fit in an intstring without null bytes or None(unknown parser marker combination)(buffer is NULL)string or unicode or text buffer(encoding failed)(encoder failed to return a string)(buffer_len is NULL)(memory error)(cleanup problem)(buffer overflow)size does not fit in an intencoded string without NULL bytes(memory error)(cleanup problem)size does not fit in an intcannot convert raw buffersunicodestringunicode(unspecified)(unspecified)pinned bufferread-write buffer(cleanup problem)contiguous bufferread-write buffersingle-segment read-write buffer(unspecified)size does not fit in an intinvalid use of 't' format characterstring or read-only character bufferstring or single-segment read-only bufferstring or pinned buffer(unspecified)size does not fit in an intimpossiblestring or read-only bufferstring or single-segment read-only buffer(unspecified)string or bufferconvertible to a buffercontiguous bufferconvertible to a buffer../Python/getargs.c../Python/getargs.c../Python/getargs.c../Python/getargs.c%s%s takes at most %d argument%s (%d given)function()sMore keyword list entries (%d) than format specifiers (%d)Argument given by name ('%s') and position (%d)Required argument '%s' (pos %d) not found%s: '%s'more argument specifiers than keyword list entries (remaining format:'%s')keywords must be strings'%s' is an invalid keyword argument for this functionUnmatched left paren in format stringUnmatched right paren in format stringimpossiblePyArg_UnpackTuple() argument list is not a tuple%s expected %s%zd arguments, got %zdat least unpacked tuple should have %s%zd elements, but has %zdat least %s expected %s%zd arguments, got %zdat most unpacked tuple should have %s%zd elements, but has %zdat most ../Python/getargs.c%s does not take keyword argumentsNative operating system services.jYo`tY6\ 66&66_z6;6v6666oz6x6x6x6v6t6t6j6h6h6^6^6Z6V6R6R6L6H6H6F6464646(667777 7 7 7777777777 7"7$7&7(7*7,7.707176z37x57t77r97n;7l=7l?7jA7jC7fE7dG7dI7J776L74N70P7.R7.T7.V7.X7*Z72[7w\7]7_7a7c7e7g7i7k7m7n7! !!!! !!'!product(*iterables) --> product object Cartesian product of input iterables. Equivalent to nested for-loops. For example, product(A, B) returns the same as: ((x,y) for x in A for y in B). The leftmost iterators are in the outermost for-loop, so the output tuples cycle in a manner similar to an odometer (with the rightmost element changing on every iteration). To compute the product of an iterable with itself, specify the number of repetitions with the optional repeat keyword argument. For example, product(A, repeat=4) means the same as product(A, A, A, A). product('ab', range(3)) --> ('a',0) ('a',1) ('a',2) ('b',0) ('b',1) ('b',2) product((0,1), (0,1), (0,1)) --> (0,0,0) (0,0,1) (0,1,0) (0,1,1) (1,0,0) ...ee2/o3re2/o3ze2oO1e2oO1e2p7-e2p7-e2/o3e2oO1".!+.6Fpyw"%'128?AJRSY\TOw*:21=YB/\c^kjrL/tu%2`/>GcOUV{/~078;:E@?HJKnO[fl"S+0Pemr$2)*549V$}:u#:B==@R]^nystwu}{"$'/.54=BOikry5:FVXZ]_cjps]zDDN3{]u!"~I{36edkns*),l{4<>BVcwyz%/29BHI|Y^Q|fkz~!,/POWefqr~!-,67>=NOWZ\]aegiq"#8BLVY]v,KYL][gpm%+)52f~XZnprv k6 k6 k6 k6 k6l6$l63l6Pl6`l6 tl6 l6l6l6 l6l6 m6 m6 #m6*;m67Vm67mm6 m6m6"m6m6 m6m6n62n6!Kn6\n69pn6&n6&n6 n6n6 n6 n6<n6 o6!o6:o6Po6io6zo6(o6o6 o6o6 o6o6 p6 %p6 Rp6tp6p6 p6p6p6 p6q6 .q6Oq6 cq6}q6q6 q6q6 q6r6 r65r6Sr6$vr6%r6&r6'r6(r6)r6*r6< s6۟8H)"P!%1;-H)j-  'X29Aj<getattr(object, name[, default]) -> value Get a named attribute from an object; getattr(x, 'y') is equivalent to x.y. When a default argument is given, it is returned when the attribute doesn't exist; without it, an exception is raised in that case.Return the difference of two or more sets as a new set. (i.e. all elements that are in this set but not the others.)  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~t-8c"t-zf`>9d>9h>9l>9p>9t>9x>9getsizeof(object, default) -> int Return the size of object in bytes.{1/qv|1a||1B~(}1!P}1!w6~1!w~1!~1!~\1!~1!~ԁ1!~1!~L1!~1!~Ą1!~1!~<1!~1!~1!~p1!~,1!~1!~1!~`1!~1!~،1!~1!~P1!~ 1!~ȏ1!~1!~@1!~1!~1!~t1!~01!~1!~1!~d1!~ 1!~ܗ1!~1!~T1!~1!~̚1!~1!~D1!~1!~1!~x1!~41!~1!~1!~h1!~$1!~1!~1!~X1!~1!~Х1!~1!~H1!~1!~1!~|1!~81!~1!~1!cencodingencodingstrictstrictobject_hookobject_hookobject_pairs_hookobject_pairs_hookparse_floatparse_floatparse_intparse_intparse_constantparse_constantmarkersmarkersdefaultdefaultencoderencoderindentindentkey_separatorkey_separatoritem_separatoritem_separatorsort_keyssort_keysskipkeysskipkeys0123456789abcdef0123456789abcdef0123456789abcdef0123456789abcdef0123456789abcdef0123456789abcdef0123456789abcdef0123456789abcdefstrictjson.decodererrmsg(zOO&)joinend is out of boundsInvalid control character atUnterminated string starting atUnterminated string starting atInvalid \escapeInvalid \uXXXX escapeInvalid \uXXXX escapeUnpaired high surrogateUnpaired high surrogateInvalid \uXXXX escapeUnpaired high surrogateUnpaired low surrogateend is out of boundsInvalid control character atUnterminated string starting atUnterminated string starting atInvalid \escapeInvalid \uXXXX escapeInvalid \uXXXX escapeUnpaired high surrogateUnpaired high surrogateInvalid \uXXXX escapeUnpaired high surrogateUnpaired low surrogateOO&|zi:scanstringutf-8first argument must be a string, not %.80sfirst argument must be a string, not %.80sExpecting property nameExpecting : delimiterExpecting , delimiterExpecting objectExpecting property name enclosed in double quotesExpecting ':' delimiterExpecting ',' delimiterExpecting objectExpecting , delimiterExpecting objectExpecting ',' delimiterExpecting object while decoding a JSON object from a byte string while decoding a JSON array from a byte stringNaNInfinity-Infinity while decoding a JSON object from a unicode string while decoding a JSON array from a unicode stringNaNInfinity-InfinitystringidxOO&:scan_oncefirst argument must be a string, not %.80scontextO:make_scannerencodingutf-8encoding must be a string, not %.80sstrictobject_hookobject_pairs_hookparse_floatparse_intparse_constant_json.Scannermarkersdefaultencoderindentkey_separatoritem_separatorsort_keysskipkeysallow_nanOOOOOOOOO:make_encoderobj_current_indent_levelOO&:_iterencodenulltruefalsenot a constOut of range float values are not JSON compliantInfinity-InfinityNaN while encoding a JSON object while encoding a JSON objectCircular reference detected while encoding a JSON object{}{}Circular reference detectedkeys must be a string[][]_iterencode_list needs a sequenceCircular reference detected_json.Encoderencode_basestring_asciiscanstring_jsonmake_scannermake_encoderPython wrapper for Expat parser.V/ V/PT9)8Y/ getpgrp() -> pgrp Return the current process group id.^|6e@,2c|6@ /i|6@01n|6@X[.t|6@(P/y|6A03|6>A^#|6bAhP"|6A"|6Aw1|6A|6\0|6A844|6B'|6,B<|6QB,%|6vBt)|6 Jn;|6B(y6|6SF+|6.L(/|6D!|6B3|6Ul!|6]<3|6p]8B8|6XM-|6B "}6lR8$}6B4' }6S74}6O6}6ZX.1}6']<)"}6C(/1&}6?Ct;+}6dC<30}6CO.4}6CH/9}6 L/k0-6_[Om>Ic3n+ecc1^'Oo;{mqi_IzOU!jrRd!3M\cX~Twb)bUfXDu&6(GwCji \0BO$`>a[p_#^]bc4aDOrvoQr} ,5NWN`~YfkD|Rdpk)w4X^QX%.Nq}E) f3&bwA@ir~o<8.);W8V^l;lw0IWa:v6Il1l=RWq&'; $z<P5+R?# %85e&`z=jnt7& {drY 2lrefRZl~load_module(name, file, filename, (suffix, mode, type)) -> module Load a module, given information returned by find_module(). The module name must include the full package name, if any.BytesIO([buffer]) -> object Create a buffered I/O implementation using an in-memory bytes buffer, ready for reading and writing.reload(module) -> module Reload the module. The module must have been successfully imported before.() -> dict. Returns numeric and monetary locale-specific parameters.Ş$ ̞$ў$FSimple type for output to strings.Pack the values v1, v2, ... according to fmt. Write the packed bytes into the writable buffer buf starting at offset.})$s68" ="M"U"""Operator interface. This module exports a set of functions implemented in C corresponding to the intrinsic operators of Python. For example, operator.add(x, y) is equivalent to the expression x+y. The function names are those used for special methods; variants without leading and trailing '__' are also provided for convenience.Return a shallow copy of a set.CnLuLlLtMnMcMeNdNlNoZsZlZpCcCfCsCoCnLmLoPcPdPsPePiPfPoSmScSkSoLLRELRORALRLERLOPDFENESETANCSNSMBNBSWSONFHWNaANunidata_versionneed a single Unicode character as parameterO!|O:decimalnot a decimalO!|O:digitnot a digitO!|O:numericnot a numeric characterO!:categoryO!:bidirectionalO!:combiningO!:mirroredO!:east_asian_widthO!:decomposition%04XsO!:normalizeNFCNFKCNFDNFKDinvalid normalization formGAGGAEGNYAGGDYAEGSDDEONRENJMYEONHBYEDBBOLSWALGSSWAELMOELBJYOLSJJULTCWEOLPKWELHTWIMPYUBHEUBSYISISSNGJCKTPHHANGUL SYLLABLE CJK UNIFIED IDEOGRAPH-%XHANGUL SYLLABLE CJK UNIFIED IDEOGRAPH-O!|O:nameno such namess#:lookupundefined character name '%s'decimaldigitnumericcategorybidirectionalcombiningmirroredeast_asian_widthdecompositionnamelookupnormalizeunicodedata.UCDunicodedataunidata_version5.2.0UCD3.2.0ucd_3_2_0unicodedata.ucnhash_CAPIucnhash_CAPIIGNOREH)aO"t;-E;IDm;0  /dev/consFind the n smallest elements in a dataset. Equivalent to: sorted(iterable)[:n] /srv/UD.%dԃ# s{7!t4q/&t4/?0.t4au;7t4Q6=t4Jv;Bt4@)Gt4;0Pt4<6Vt4w$_t4Z!ht4|.qt43Ĵxt4l@+type(object) -> the object's type type(name, bases, dict) -> a new type>8>8>8>8>8?87?8C?8PNN@)>?456789:;<=  !"#$%&'()*+,-./0123input contains non-hex characterO!O!s#:parse_manifestmanifest entry has no separatormanifest contains trailing garbageO!O!s#:parse_dirstates#s#overflow in dirstateciiiexpected an int or longO!O!Od:pack_dirstateexpected 2-element sequenceexpected string keyexpected string keyexpected a 20-byte hashexpected a 20-byte hashexpected a 4-tupleexpected one bytebad dirstate size: %ld != %ldKiiiiiis#revlog index out of range20-byte hash requiredlO8-tuple requiredinsert only supported at index -1currently only 2**31 revs supportedindex entries addedrevs on diskrevs in memorynode trie capacitynode trie depthnode trie countnode trie lookupsnode trie missesnode trie last rev scannednode trie splitsrevlog parents are invalidout of memorymercurial.errorRevlogErrorcould not find RevlogErrors#key too shortkey too longcould not access rev %dObitset size (%ld) > capacity (%ld)arguments must all be intsindex out of rangebitset size (%d) > capacity (%d)revlog index delete requires step size of 1revlog index deletion indices are invalidrev out of rangecorrupt index fileOOdata is not a stringcorrupt index fileancestorsreturn the gca set of the given revsclearcachesclear the index cachesgetget an index entryheadrevsget head revisionsinsertinsert an index entrypartialmatchmatch a potentially ambiguous node IDstatsstats for the indexnodemapnodemapparsers.indexrevlog indexiONNpack_dirstatepack a dirstate parse_manifestparse a manifest parse_dirstateparse a dirstate parse_index2parse a revlog index encodedirencodedir a path pathencodefncache-encode a path lowerencodelower-encode a path indexiiiiiiis#ciiiparsersS.endswith(suffix[, start[, end]]) -> bool Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.:default%s%s%s, %.20s, %.9sJul 1 201319:06:51Unversioned directoryunknownv2.7.5tipplan9B%8.8lx%8.8lx.Aauthoritative answer host not foundnon-authoritive host not foundnon recoverable errorvalid name, no data record of requested typeunknown error%s: %sD.remove(value) -- remove first occurrence of value.H)=6b6b;2y?bool(x) -> bool Returns True when the argument x is true, False otherwise. The builtins True and False are the only two instances of the class bool. The class bool is a subclass of the class int, and cannot be subclassed. !"#%&'()*+.234567:;=>?ABCDEFGHIJLNOPQRSUVWYZ[]^_`abcdefghijklmnorsuvy{|}~¬ìŬƬǬɬʬˬͬάϬЬѬҬӬԬ֬ج٬ڬ۬ܬݬެ߬ !"#$%&'(*+./0123679:;=>?@ABCFHJKLMNOQRSUVWYZ[\]^_`bdefghijknoqrwxyz~­íŭƭǭɭʭ˭̭ͭέϭҭԭխ֭׭ح٭ڭۭݭޭ߭  !"#$%&'()*+,-./23569;<=>?BDGHIKOQRSUWXYZ[^bcdfgjkmnoqrstuvwz~®îŮƮǮȮɮʮˮήҮӮԮծ֮׮ڮۮݮޮ߮  !"#$%&'()*+./1356789:;>@DEFGJKLMNOQRSTUVWXYZ[^_`abcfghijklmnopqrstuvwxz{|}~¯ïįůƯʯ̯ϯЯѯүӯկ֯ׯدٯگۯݯޯ߯  !"#$%&')*+,-./0123456789:;<=>?@ABCFGIKMOPQRVXZ[\^_`abcdefghijklmnopqrstuvwxyz{~°ðưʰ˰̰ͰΰϰҰӰհְװٰڰ۰ܰݰް߰  !"&')*+-./01236:;<=>?BCEFGIJKLMNORSVWYZ[]^_abcdefghijklmnopqrstuvwz{}~±ñıűƱDZȱɱʱ˱ͱαϱѱұӱձֱױرٱڱ۱ޱ !"#$%&'()*+,-./012356789:;=>?@ABCDEFGHIJKLMNOPQRSTUVWYZ[]^_abcdefgjklmnopqrsvwxyz{}~²òIJŲƲDzʲ˲ͲβϲѲӲԲղֲײڲܲ޲߲  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSWYZ]`abcfhjlmorsuvwyz{|}~³óƳdzɳʳͳϳѳҳӳֳسڳܳ޳߳ !"#$%&'*,-./012356789:;<=>?@ABCDEFGHIJKLMNORSUVWYZ[\]^_bdfghijkmnopqrstuvwxyz{|}~´ôŴƴǴɴʴ˴̴ʹδϴѴҴӴԴִ״شٴڴ۴޴ߴ  !"#&+,-./235679:;<=>?BFGHIJNOQRSUVWXYZ[^bcdefghijklmnopqrstuvwxyz{|}~µõŵƵǵȵɵʵ˵εҵӵԵյֵ׵ٵڵ۵ܵݵ޵ߵ  !"#$&'()*+-./012356789:;<=>?@ABCDEFGIJKLMNOPQRSTUVWXYZ[\]^_`abcefgijklmnopqrstuvwxyz{|}~¶öĶŶƶǶȶɶʶ˶̶Ͷζ϶жѶҶӶնֶ׶ضٶڶ۶ܶݶ޶߶  !"#$%&'*+-.1234567:<=>?@ABCEFGIJKMNOPQRSVWXYZ[\]^_abcefgijklmnortvwxyz{~·÷ķŷƷȷʷ˷̷ͷηϷзѷҷӷԷշַ׷طٷڷ۷ܷݷ޷߷  !"#&')*+-./01236:;<=>?ABCEFGHIJKLMNOPRTUVWXYZ[^_abcefghijknprstuvwyz{}~¸ĸƸǸȸɸʸ˸͸θϸѸҸӸոָ׸ظٸڸ۸ܸ޸ !"#$%&'()*+,-./0123456789:;>?ABCEFGHIJKMNPRSTUVWZ[]^_abcdefgjlnopqrsvwyz{}~¹ùĹŹƹǹʹ˹͹ӹԹչֹ׹ڹܹ߹  !"#$%&'()*+,-./01234567:;=>?ACDEFGJLOPQRVWYZ[]^_`abcfjklmnorsuvwyz{|}~ºúźƺǺɺʺ˺̺ͺκϺкѺҺӺԺպֺ׺ںۺܺݺ޺ߺ !"#$%&'(*,-./012379:?@ABCFHJKLNQRSUVWYZ[\]^_`bdefghijkmnopqrstuvwxyz{|}~»ûŻƻǻɻʻ˻̻ͻλϻѻһԻջֻ׻ػٻڻۻܻݻ޻߻  !"#&(*+,./235679:;<=>?BFGHJKNOQRSTUVWXYZ[\^_`abcdefghijklmnopqrstuvwxyz{|}~¼üżƼǼȼɼʼ˼̼μҼӼԼּ׼ټڼۼݼ޼߼  !"#%&'()*+-./0123456789:;<=>?ABCDEFGJKMNOQRSTUVWZ[\]^_`abcefgijklmnopqrstuvwxyz{|}~½ýĽŽƽǽȽɽʽ˽̽ͽνϽнѽҽӽֽ׽ٽڽ۽ݽ޽߽  !"#$%&'()*+,-./0123456789:;<=>?@ABCFGIJKMOPQRSVX\]^_bcefgiklmnorvwxyz~¾þľžƾǾȾɾʾ˾̾;ξϾҾӾվ־پھ۾ܾݾ޾߾  !"#$%&'()*+,-./0123456789:;<=>?BCEFGIJKLMNORSTVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~¿ÿĿƿǿȿɿʿ˿οϿѿҿӿտֿ׿ؿٿڿۿݿ޿  !"#$%&'()*+,-./0123456789:;=>?@ABCDEFGHIJKLMNOPRSTUVWYZ[]^_abcdefgjklmnopqrstuvwxyz{|}~ !"%()*+.23457:;=>?ABCDEFGJNOPQRSVWYZ[]^_`abcfjklmnoqrsuvwyz{|}~ !"#$%&'*,.0356789:;<=>?@ABCDEFGIJKLMNORSUVWYZ[\]^_abcdfghijknoqrsuvwxyz{~€‚ƒ„…†‡Š‹ŒŽ‘’“”•–—™šœžŸ ¡¢£¦§©ª«®¯°±²³¶¸º»¼½¾¿  !"#&'*+,-./0123456789:;<=>?@ABCDFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefgjkmnoqstuvwz{~ÀÁÂÃÅÆÇÉÊËÍÎÏÐÑÒÓÔÕÖרÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿ  !"#%&'()*+-./12356789:;>?@ABCDEFGIJKLMNOPQRSTUVWXYZ[\]^_`abcfgijkmnopqrsvwxz{|}~āĂ㥹ĆćĈĉĊċČčĎďĐđĒēĕĖėĘęĚěĝĞğĠġĢģĤĥĦħĨĩĪīĬĭĮįİıIJijĴĵĶķĹĺĻĽľĿ  !"#$%&'*+-./1234567:<>?@ABCFGKOPQRVZ[\_bcefgijklmnorvwxyz{~ŁłŃŅņňʼnŊŋŎŐŒœŔŖřŚśŝŞşšŢţŤťŦŧŨŪūŬŭŮůŰűŲųŶźſ  !"#&')*+/1268:<=>?BCEFGIJKLMNORVWXYZ[^_abcdefghijkmnprstuvwz{}~ƁƂƃƄƅƆƇƊƌƎƏƐƑƒƓƖƗƙƚƛƝƞƟƠơƢƣƦƨƪƫƬƭƮƯƲƳƵƶƷƻƼƽƾƿ "#%&')*+,-./24689:;>?ABCEFGHIKNPYZ[]^_abcdefgijlmnopqrsvwyz{ǀǁǂdžNjnjǍǏǒǓǕǙǛǜǝǞǟǢǧǨǩǪǫǮǯDZDzdzǵǶǷǸǹǺǻǾ !"#%&'()*+.02345679:;=>?ABCDEFGJKNOPQRSUVWXYZ[\]^_`abcdefghijklmnorsuvwy{|}~ȂȄȈȉȊȎȏȐȑȒȓȕȖȗȘșȚțȜȞȠȢȣȤȥȦȧȩȪȫȬȭȮȯȰȱȲȳȴȵȶȷȸȹȺȻȾȿ  !"#$%&'()*+-./012356789:;<=>?@ABCDEFGHIJKLMNORSUVWYZ[\]^_bdefghijkmnoqrsuvwxyz{}~ɀɁɂɃɄɅɆɇɊɋɍɎɏɒɓɔɕɖɗɚɜɞɟɠɡɢɣɤɥɦɧɨɩɪɫɬɭɮɰɱɲɳɴɵɶɷɸɹɺɻɼɽɾɿ  !"#$%&'(*+,-./0123456789:;<=>?@ABCDEFGHIJKNOQRSUVWXYZ[^bcdefgijklmnopqrstuvwxyz{|~ʀʁʂʃʅʆʈʉʊʋʌʍʎʏʐʑʒʓʔʕʖʗʙʚʛʜʝʞʟʠʡʢʣʤʥʦʧʨʩʪʫʬʭʮʯʰʱʲʳʴʵʶʷʸʹʺʻʾʿ "#$%&'()*+,-./0123456789:;<=>?@BCDEFGJKMNOQRSTUVWZ[\^_`abcefghijklmnopqrstuvwz{|}~ˀˁ˂˃˄˅ˆˇˈˊˋˌˍˎˏːˑ˒˓˔˕˖˗˘˙˚˛˝˞˟ˠˡˢˣ˥˦˧˨˩˪˫ˬ˭ˮ˯˰˱˲˳˴˵˶˷˹˺˻˼˽˾˿  #$%&*+-/1234567:?@ABCFGIJKMNOPQRSVZ[\]^_abcegijklmnoqrstvwxyz{|}~̶̷̡̢̧̛̖̗̝̞̟̣̤̥̦̪̮̯̰̱̲̳̹̻̀́̂̃̄̅̆̇̈̉̊̋̌̍̎̏̐̑̒̓̔̽̾̿̕̚  !"#%&')*+-./012345678:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[]^_abcefghijknprstuvwyz{|}~͇͉͍͎̀͂̓̈́͆͊͋͌ͅ͏͓͖͙͚͐͑͒͗͛ͣͦͨͪͫͬͭͮͯ͟͢͝͞͡ͱͲͳʹ͵Ͷͷ͸͹ͺͻͼͽ;Ϳ "#%&')*+,-./246789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWZ[]^bcdefgjlnopqrsvwyz{}~΀΁΂΃ΆΈΊ΋Ό΍ΎΏΒΓΕΖΗΙΚΛΜΝΞΟ΢ΦΧΨΩΪΫήίΰαβγδεζηθικμνξο !"#%&'()*+.2345679:;<=>?@ABCDEFGHIJKLMNOPQRSVWYZ[]^_`abcfhjklmnorsuvwyz{|}~ρςστφχψωϊϋύϏϐϑϒϓϔϕϖϗϘϙϚϛϜϝϞϟϠϢϣϤϥϦϧϩϫϬϭϮϯϱϲϳϴϵ϶ϷϸϹϺϻϼϽϾϿ  !"#$%&'()*+,./0123679:;=>?@ABCFHJKLMNOQRSUVWYZ[\]^_abcdefghijknoqrsuvwxyz{~ЀЂЃЄЅІЇЈЉЊЋЌЍЎЏАБВГДЕЖЗИЙКЛМНОПРСТУЦЧЩЪЫЭЮЯабвжиклмноп  !"#$%&'()*+,-./235679;<=>?BFGHIJKNOQRSUVWXYZ[^`bcdefgijkmnopqrstuvwxyz{}~рстухцчщъьэюяѐёђѓєѕіїјљњћќѝўџѢѣѥѦѧѪѫѬѭѮѯѲѴѶѷѸѹѻѽѾѿ  !"#$%&'()*+./12356789:;>@BCDEFGIJKLMNOPQRSTUVWXYZ[]^_`abcefghijklmnopqrstuvwxyz{|}~҂҃҅҆҇҉ҊҋҌҍҎҏҒғҔҖҗҘҙҚқҝҞҟҡҢңҥҦҧҨҩҪҫҭүҰҲҳҴҵҶҷҺһҽҾ "#$&'*+-./1234567:>?@ABCFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{~ӁӂӃӅӆӇӉӊӋӎӒӓӔӕӖӗӚӛӝӞӟӡӢӣӤӥӦӧӪӬӮӰӱӲӳӵӶӷӹӺӻӽӾӿ  !"#$%&'()*+,-./0123456789:;<=>?ABCEFGHIJKLMNOPQRSTUVWXYZ[]^_abcefghijklnpqrstuvwz{}~ԁԃԄԅԆԇԊԌԎԏԐԑԒԓԕԖԗԘԙԚԛԜԝԞԟԠԡԢԣԤԥԦԧԨԪԫԬԭԮԯ԰ԱԲԳԴԵԶԷԸԺԻԼԽԾԿ  !"#$%&'()*+,-./0123456789:;>?ABCEFGHIJKNPRSTUVWZ[]^_abcdfgjlnopqrsvwyz{}~ՀՁՂՃՆՊՋՍՎՏՑՒՓՔՕՖ՗՘ՙ՚՛՜՝՞՟ՠաբգդզէթժիլխծկհձղճմյնշոչպջռսվտ !"#%&'()*+,./01234567:;=>?ABCDFGJLNOPRSVWYZ[]^_`abcdefhjklmnorsuvwxyz{|}~րւքֆևֈ։֊֋֎֏ֱֲֳִֵֶַָֺּֽ֑֖֛֢֣֤֥֦֧֪֚֭֮֒֓֕֗֘֙֜֞֠֩֫֯־ֿ !"#$%&'*,./0123679:;=>?@ABCEFHJKLMNORSUZ[\]^_bdfghjkmnoqrsuvwxyz{~׀ׂ׃ׅׄ׆ׇ׊׋׍׎׏בגדהוזחךלמןנסעף [/b/}///9/z;Update a set with the symmetric difference of itself and another.t4\E<8'$4q$ %decompressobj([wbits]) -- Return a decompressor object. Optional arg wbits is the window buffer size.H)-ŝОA4Ԛ-Z t4t4t49t4t4Ut4k2__dict____name____doc____package__../Objects/moduleobject.c__name__nameless module__file__module filename missing# clear[1] %s __builtins__# clear[2] %s namedocS|O:module.__init____name____doc__?modulefileno() -> integer "file descriptor". This is needed for lower-level file interfaces, such os.read().B.__alloc__() -> int Returns the number of bytes actually allocated.S.isspace() -> bool Return True if all characters in S are whitespace and there is at least one character in S, False otherwise.NMTOKENSS.unpack(str) -> (v1, v2, ...) Return tuple containing values unpacked according to this Struct's format. Requires len(str) == self.size. See struct.__doc__ for more on format strings.assertion failed: file :writelines(sequence_of_strings) -> None. Write the strings to the file. Note that newlines are not added. The sequence can be any iterable object producing strings. This is equivalent to calling write() for each string.listdir(path) -> list_of_strings Return a list containing the names of the entries in the directory. path: path of directory to list The list is in arbitrary order. It does not include the special entries '.' and '..' even if they are present in the directory.;f?QRT6,E˜6r61Lseekable() -> bool. True if file supports random-access.r;r;Return state information for pickling.UTF-8}The io module provides the Python interfaces to stream handling. The builtin open function is defined in this module. At the top of the I/O hierarchy is the abstract base class IOBase. It defines the basic interface to a stream. Note, however, that there is no separation between reading and writing to streams; implementations are allowed to raise an IOError if they do not support a given operation. Extending IOBase is RawIOBase which deals simply with the reading and writing of raw bytes to a stream. FileIO subclasses RawIOBase to provide an interface to OS files. BufferedIOBase deals with buffering on a raw byte stream (RawIOBase). Its subclasses, BufferedWriter, BufferedReader, and BufferedRWPair buffer streams that are readable, writable, and both respectively. BufferedRandom provides a buffered interface to random access streams. BytesIO is a simple stream of in-memory bytes. Another IOBase subclass, TextIOBase, deals with the encoding and decoding of streams into text. TextIOWrapper, which extends it, is a buffered text interface to a buffered raw stream (`BufferedIOBase`). Finally, StringIO is a in-memory stream for text. Argument names are not part of the specification, and only the arguments of open() are intended to be used as keyword arguments. data: DEFAULT_BUFFER_SIZE An int containing the default buffer size used by the module's buffered I/O classes. open() uses the file's blksize (as obtained by os.stat) if possible. mount(fd, afd, old, flag, aname) -> int Change name space.expand(template) -> str. Return the string obtained by doing backslash substitution on the string template, as done by the sub() method.a3 j3~3@3333#Ö3$#$Ķ$$%$Return string containing values v1, v2, ... packed according to fmt.str(object='') -> string Return a nice string representation of the object. If the argument is a string, the return value is the same object.close() -> None or (perhaps) an integer. Close the file. Sets data attribute .closed to True. A closed file cannot be used for further I/O operations. close() may be called more than once without error. Some kinds of file objects (for example, opened by popen()) may return an exit status upon closing.flush() -> None. Does nothing.Copyright (c) 2001-2013 Python Software Foundation. All Rights Reserved. Copyright (c) 2000 BeOpen.com. All Rights Reserved. Copyright (c) 1995-2001 Corporation for National Research Initiatives. All Rights Reserved. Copyright (c) 1991-1995 Stichting Mathematisch Centrum, Amsterdam. All Rights Reserved. !"#$%&' unicode Return a copy of the string S with leading whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is a str, it will be converted to unicode before strippinge"o""""A"" "-"B4"U" Y"w""""Rotate the deque n steps to the right (default n=1). If n is negative, rotates left.UseForeignDTD([flag]) Allows the application to provide an artificial external subset if one is not specified as part of the document instance. This readily allows the use of a 'default' document type controlled by the application, while still getting the advantage of providing document type information to the parser. 'flag' defaults to True if not provided.s*:a2b_uuIllegal charTrailing garbages*:b2a_uuAt most 45 bytes at onces*:a2b_base64Incorrect paddings*:b2a_base64Too much data for base64 lines*:a2b_hqxIllegal charString has incomplete number of bytesOis*:rlecode_hqxs*:b2a_hqxs*:rledecode_hqxOrphaned RLE code at starts*i:crc_hqxis*|I:crc32s*:b2a_hexs*:a2b_hexOdd-length stringNon-hexadecimal digit founddataheaders*|i0123456789ABCDEF0123456789ABCDEFdataquotetabsistextheaders*|iiia2b_uub2a_uua2b_base64b2a_base64a2b_hqxb2a_hqxb2a_hexa2b_hexhexlifyunhexlifyrlecode_hqxrledecode_hqxcrc_hqxcrc32a2b_qpb2a_qpbinascii__doc__binascii.ErrorErrorbinascii.IncompleteIncompleteH)O"A>p!-----BEGIN ----- -----END ----- incorrect .pem file format: bad header or trailerout of memoryincorrect .pem file format: bad base64 encoded data6$:)`<)))repeat(object [,times]) -> create an iterator which returns the object for the specified number of times. If not specified, returns the object endlessly./"/a/ f/p/<y//@/log(x[, base]) Return the logarithm of x to the given base. If the base not specified, returns the natural logarithm (base e) of x.D.items() -> list of D's (key, value) pairs, as 2-tuples!%N&-(){-Text I/O implementation using an in-memory buffer. The initial_value argument sets the value of object. The newline argument is like the one of TextIOWrapper's constructor.)ĝ)ɝ)8484Fi-g"Mi-]^-Yi-)bi-*/.ki-&4qi-*/.~i-T"i-b/i-)y#i-R/i-Y+i-!i- A+i-!i-b/i-/i-4/i-;i-9X8i- -i-p7i-l$i-X8j-0"' t8h#:-DT! k4s}tounicode() -> unicode Convert the array to a unicode string. The array must be a type 'u' array; otherwise a ValueError is raised. Use array.tostring().decode() to obtain a unicode string from an array of some other type.write(str) -> None. Write string str to file. Note that due to buffering, flush() or close() may be needed before the file on disk reflects the data written./etc/groupT.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.w*:readintoreadnread() should return bytesdetachreadread1writedetachreadread1readintowrite_io._BufferedIOBasereentrant call inside %sraw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectnameraw stream has been detachedI/O operation on uninitialized objectmoderaw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectisnRaw stream returned invalid position %lldRaw stream returned invalid position %lldbuffer size must be strictly positivecan't allocate read lockraw stream has been detachedI/O operation on uninitialized objectflush of closed fileraw stream has been detachedI/O operation on uninitialized object|n:peekraw stream has been detachedI/O operation on uninitialized object|O&:readread length must be positive or -1read of closed fileraw stream has been detachedI/O operation on uninitialized objectn:read1read length must be positiveraw stream has been detachedI/O operation on uninitialized objectreadline of closed fileraw stream has been detachedI/O operation on uninitialized object|O&:readlineraw stream has been detachedI/O operation on uninitialized objectraw stream has been detachedI/O operation on uninitialized objectO|i:seekwhence must be between 0 and 2, not %dseek of closed fileraw stream has been detachedI/O operation on uninitialized object|O:truncateraw stream has been detachedI/O operation on uninitialized objectreadline() should have returned a bytes object, not '%.200s'name<%s><%s name=%s>rawbuffer_sizeO|n:BufferedReaderraw readinto() returned invalid length %zd (should have been between 0 and %zd)read() should return bytesdetachflushcloseseekablereadablewritablefilenoisattyreadpeekread1readlineseektelltruncate__sizeof__rawclosednamemode_io.BufferedReadermax_buffer_size is deprecatedrawbuffer_sizemax_buffer_sizeO|nn:BufferedWriterraw write() returned invalid length %zd (should have been between 0 and %zd)write could not complete without blockingraw stream has been detachedI/O operation on uninitialized objects*:writewrite to closed filewrite could not complete without blockingwrite could not complete without blockingclosedetachseekablereadablewritablefilenoisattywritetruncateflushseektell__sizeof__rawclosednamemode_io.BufferedWriterOO|nn:BufferedRWPairOnOnreadpeekread1readintowriteflushreadablewritableclosecloseisattyisattythe BufferedRWPair object is being garbage-collectedreadpeekread1readintowriteflushreadablewritablecloseisattyclosed_io.BufferedRWPairrawbuffer_sizemax_buffer_sizeO|nn:BufferedRandomclosedetachseekablereadablewritablefilenoisattyflushseektelltruncatereadread1readintoreadlinepeekwrite__sizeof__rawclosednamemode_io.BufferedRandom؆)݆))-DT!setuid(uid) Set the current process's user id./net/cs!protocol=%s ipv4proto=*protocolipv4protok4chain.from_iterable(iterable) --> chain object Alternate chain() contructor taking a single iterable argument that evaluates lazily.compress(data, selectors) --> iterator over selected data Return data elements corresponding to true selector elements. Forms a shorter iterator from selected data elements using the selectors to choose the data elements.$u4œ$|"ʓ$'2-Г$ٓ$;T(9chr(i) -> character Return a string of one character with ordinal i; 0 <= i < 256.single-segment buffer object expectedPy_TPFLAGS_HAVE_GETCHARBUFFER neededreadwritecharno%s buffer type not availablesize must be zero or positiveoffset must be zero or positiveoffset must be zero or positivebuffer object expectedbuffer object expectedsize must be zero or positivebuffer() not supported in 3.xbuffer()O|nn:bufferread-onlyread-write<%s buffer ptr %p, size %zd at %p><%s buffer for %p, size %zd, offset %zd at %p>writable buffers are not hashablesingle-segment buffer object expectedresult too largebuffer index out of rangesequence index must be integerbuffer is read-onlybuffer assignment index out of rangesingle-segment buffer object expectedright operand must be a single bytebuffer is read-onlysingle-segment buffer object expectedright operand length must match slice lengthbuffer is read-onlysingle-segment buffer object expectedright operand length must match slice lengthbuffer indices must be integersaccessing non-existent buffer segmentbuffer is read-onlyaccessing non-existent buffer segmentaccessing non-existent buffer segmentbuffer?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDread([size]) -> read at most size bytes, returned as a string. If the size argument is negative, read until EOF is reached. Return an empty string at EOF.$))).)7)@)))));f?This module performs file control and I/O control on file descriptors. It is an interface to the fcntl() and ioctl() Unix routines. File descriptors can be obtained with the fileno() method of a file or socket object. @ord(c) -> integer Return the integer ordinal of a one-character string.6SB16E196|FHj36Gv467CL>06D'6B~$6Hɉ6HUnpack the buffer, containing packed C structure data, according to fmt, starting at offset. Requires len(buffer[offset:]) >= calcsize(fmt).remove(path) -> None Remove a file.delattr(object, name) Delete a named attribute on an object; delattr(x, 'y') is equivalent to ``del x.y''.Q)W)\)tg/(7~7v;S.decode([encoding[,errors]]) -> object Decodes S using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle UnicodeDecodeErrors.S.title() -> string Return a titlecased version of S, i.e. words start with uppercase characters, all remaining cased characters have lowercase.heappushpop(heap, item) -> value. Push item on the heap, then pop and return the smallest item from the heap. The combined action runs more efficiently than heappush() followed by a separate call to heappop().setgid(gid) Set the current process's group id.f3N1Y`JIcY`__basicsize____itemsize____flags____weakrefoffset____base____dictoffset____mro__can't set %s.__name__can't delete %s.__name__can only assign string to %s.__name__, not '%s'__name__ must not contain null bytes__module____module____builtin__can't set %s.__module__can't delete %s.__module____module____abstractmethods____abstractmethods____abstractmethods____abstractmethods____abstractmethods__can't set %s.__bases__can't delete %s.__bases__can only assign tuple to %s.__bases__, not %scan only assign non-empty tuple to %s.__bases__, not ()%s.__bases__ must be tuple of old- or new-style classes, not '%s'a __bases__ item causes an inheritance cycle__bases____doc____name____bases____module____abstractmethods____dict____doc__type inequality comparisons not supported in 3.xclasstype__builtin__<%s '%s.%s'><%s '%s'>cannot create '%.100s' instancesGC object already trackedGC object already trackedGC object already tracked__name__duplicate base class %s?Cannot create a consistent method resolution order (MRO) for bases %s?[O]mromro() returned a non-class ('%.500s')mro() returned base with unsuitable layout ('%.500s')bases must be typesmultiple bases have instance lay-out conflicta new-style class can't have only classic bases__dict__this __dict__ descriptor does not support '%.200s' objectsThis object has no __dict__This object has no __dict____dict__ must be set to a dictionary, not a '%.200s'This object has no __weakref____dict__dictionary for instance variables (if defined)__weakref__list of weak references to the object (if defined)__dict__dictionary for instance variables (if defined)__weakref__list of weak references to the object (if defined)__slots__ items must be strings, not '%.200s'__slots__ must be identifierstype.__init__() takes no keyword argumentstype.__init__() takes 1 or 3 argumentsnamebasesdicttype() takes 1 or 3 argumentsSO!O!:typemetaclass conflict: the metaclass of a derived class must be a (non-strict) subclass of the metaclasses of all its basestype '%.100s' is not an acceptable base type__slots__nonempty __slots__ not supported for subtype of '%s'__dict____dict__ slot disallowed: we already got one__weakref____weakref__ slot disallowed: either we already got one, or __itemsize__ != 0__dict____weakref____module____name____module____doc____new____new__attribute name must be string, not '%.200s'type object '%.50s' has no attribute '%.400s'can't set attributes of built-in/extension type '%s'mromro() -> list return a type's method resolution order__subclasses____subclasses__() -> list of immediate subclasses__instancecheck____instancecheck__() -> bool check if an object is an instance__subclasscheck____subclasscheck__() -> bool check if a class is a subclasstypeobject.__init__() takes no parametersobject.__init__() takes no parametersobject() takes no parametersobject() takes no parameterssorted, joinOCan't instantiate abstract class %s with abstract methods %s__builtin__<%s.%s object at %p><%s object at %p>%s assignment: '%s' deallocator differs from '%s'%s assignment: '%s' object layout differs from '%s'can't delete __class__ attribute__class__ must be set to new-style class, not '%s' object__class__ assignment: only for heap types__class____class__the object's classcopy_reg__slotnames___slotnamesOcopy_reg._slotnames didn't return a list or None__class____getnewargs____getnewargs__ should return a tuple, not '%.200s'__getstate____dict__(NO)iteritems__newobj___reduce_ex(Oi)|i:__reduce__|i:__reduce_ex____reduce____class____reduce____reduce__O:__format__argument to __format__ must be unicode or strobject.__format__ with a non-empty format string is deprecated__reduce_ex__helper for pickle__reduce__helper for pickle__subclasshook____format__default object formatter__sizeof____sizeof__() -> int size of object in memory, in bytesobjectThe most base typemethod cannot be both class and static__hash____eq__Overriding __eq__ blocks inheritance of __hash__ in 3.xtype '%.100s' participates in gc and is a base type but has inappropriate tp_free slot__doc____doc____doc__PyArg_UnpackTuple() argument list is not a tupleexpected %d arguments, got %zdnnnnOnn%s.__cmp__(x,y) requires y to be a '%s', not a '%s'can't apply this %s to %s object__setattr____delattr____get__(None, None) is invalid__new__() called with non-type 'self'%s.__new__(): not enough arguments%s.__new__(X): X is not a type object (%s)%s.__new__(%s): %s is not a subtype of %s%s.__new__(%s) is not safe, use %s.__new__()?__new__T.__new__(S, ...) -> a new object with type S, a subtype of T__new____new____len__()__len__() should return >= 0__getitem__in 3.x, __getslice__ has been removed; use __getitem____getslice__nn__delitem__(n)__setitem__(nO)in 3.x, __delslice__ has been removed; use __delitem____delslice__(nn)in 3.x, __setslice__ has been removed; use __setitem____setslice__(nnO)__contains____getitem__(O)__delitem__(O)__setitem__(OO)__radd____radd__(O)__add__(O)__radd__(O)__rsub____rsub__(O)__sub__(O)__rsub__(O)__rmul____rmul__(O)__mul__(O)__rmul__(O)__rdiv____rdiv__(O)__div__(O)__rdiv__(O)__rmod____rmod__(O)__mod__(O)__rmod__(O)__rdivmod____rdivmod__(O)__divmod__(O)__rdivmod__(O)__rpow____rpow__(O)__pow__(O)__rpow__(O)__pow__(OO)__neg__()__pos__()__abs__()__nonzero____len__%s should return bool or int, returned %s__len____nonzero____index__()__invert__()__rlshift____rlshift__(O)__lshift__(O)__rlshift__(O)__rrshift____rrshift__(O)__rshift__(O)__rrshift__(O)__rand____rand__(O)__and__(O)__rand__(O)__rxor____rxor__(O)__xor__(O)__rxor__(O)__ror____ror__(O)__or__(O)__ror__(O)__coerce__(O)__coerce__ didn't return a 2-tuple__coerce__(O)__coerce__ didn't return a 2-tuple__int__()__long__()__float__()__oct__()__hex__()__iadd__(O)__isub__(O)__imul__(O)__idiv__(O)__imod__(O)__ipow__(O)__ilshift__(O)__irshift__(O)__iand__(O)__ixor__(O)__ior__(O)__rfloordiv____rfloordiv__(O)__floordiv__(O)__rfloordiv__(O)__rtruediv____rtruediv__(O)__truediv__(O)__rtruediv__(O)__ifloordiv__(O)__itruediv__(O)__cmp____repr__<%s object at %p>__str____hash____eq____cmp____call____getattribute__(O)__getattr____getattribute____delattr__(O)__setattr__(OO)__lt____le____eq____ne____gt____ge____iter____getitem__'%.200s' object is not iterablenext()__get____delete__(O)__set__(OO)__init____init__() should return None, not '%.200s'__new____del____str____repr____getattribute____getattr____setattr____delattr____cmp__x.__cmp__(y) <==> cmp(x,y)__repr__x.__repr__() <==> repr(x)__hash__x.__hash__() <==> hash(x)__call__x.__call__(...) <==> x(...)__str__x.__str__() <==> str(x)__getattribute__x.__getattribute__('name') <==> x.name__getattr____setattr__x.__setattr__('name', value) <==> x.name = value__delattr__x.__delattr__('name') <==> del x.name__lt__x.__lt__(y) <==> x x<=y__eq__x.__eq__(y) <==> x==y__ne__x.__ne__(y) <==> x!=y__gt__x.__gt__(y) <==> x>y__ge__x.__ge__(y) <==> x>=y__iter__x.__iter__() <==> iter(x)nextx.next() -> the next value, or raise StopIteration__get__descr.__get__(obj[, type]) -> value__set__descr.__set__(obj, value)__delete__descr.__delete__(obj)__init__x.__init__(...) initializes x; see help(type(x)) for signature__new____del____add__x.__add__(y) <==> x+y__radd__x.__radd__(y) <==> y+x__sub__x.__sub__(y) <==> x-y__rsub__x.__rsub__(y) <==> y-x__mul__x.__mul__(y) <==> x*y__rmul__x.__rmul__(y) <==> y*x__div__x.__div__(y) <==> x/y__rdiv__x.__rdiv__(y) <==> y/x__mod__x.__mod__(y) <==> x%y__rmod__x.__rmod__(y) <==> y%x__divmod__x.__divmod__(y) <==> divmod(x, y)__rdivmod__x.__rdivmod__(y) <==> divmod(y, x)__pow__x.__pow__(y[, z]) <==> pow(x, y[, z])__rpow__y.__rpow__(x[, z]) <==> pow(x, y[, z])__neg__x.__neg__() <==> -x__pos__x.__pos__() <==> +x__abs__x.__abs__() <==> abs(x)__nonzero__x.__nonzero__() <==> x != 0__invert__x.__invert__() <==> ~x__lshift__x.__lshift__(y) <==> x< y< x>>y__rrshift__x.__rrshift__(y) <==> y>>x__and__x.__and__(y) <==> x&y__rand__x.__rand__(y) <==> y&x__xor__x.__xor__(y) <==> x^y__rxor__x.__rxor__(y) <==> y^x__or__x.__or__(y) <==> x|y__ror__x.__ror__(y) <==> y|x__coerce__x.__coerce__(y) <==> coerce(x, y)__int__x.__int__() <==> int(x)__long__x.__long__() <==> long(x)__float__x.__float__() <==> float(x)__oct__x.__oct__() <==> oct(x)__hex__x.__hex__() <==> hex(x)__iadd__x.__iadd__(y) <==> x+=y__isub__x.__isub__(y) <==> x-=y__imul__x.__imul__(y) <==> x*=y__idiv__x.__idiv__(y) <==> x/=y__imod__x.__imod__(y) <==> x%=y__ipow__x.__ipow__(y) <==> x**=y__ilshift__x.__ilshift__(y) <==> x<<=y__irshift__x.__irshift__(y) <==> x>>=y__iand__x.__iand__(y) <==> x&=y__ixor__x.__ixor__(y) <==> x^=y__ior__x.__ior__(y) <==> x|=y__floordiv__x.__floordiv__(y) <==> x//y__rfloordiv__x.__rfloordiv__(y) <==> y//x__truediv__x.__truediv__(y) <==> x/y__rtruediv__x.__rtruediv__(y) <==> y/x__ifloordiv__x.__ifloordiv__(y) <==> x//y__itruediv__x.__itruediv__(y) <==> x/y__index__x[y:z] <==> x[y.__index__():z.__index__()]__len__x.__len__() <==> len(x)__getitem__x.__getitem__(y) <==> x[y]__setitem__x.__setitem__(i, y) <==> x[i]=y__delitem__x.__delitem__(y) <==> del x[y]__len__x.__len__() <==> len(x)__add__x.__add__(y) <==> x+y__mul__x.__mul__(n) <==> x*n__rmul__x.__rmul__(n) <==> n*x__getitem__x.__getitem__(y) <==> x[y]__getslice__x.__getslice__(i, j) <==> x[i:j] Use of negative indices is not supported.__setitem__x.__setitem__(i, y) <==> x[i]=y__delitem__x.__delitem__(y) <==> del x[y]__setslice__x.__setslice__(i, j, y) <==> x[i:j]=y Use of negative indices is not supported.__delslice__x.__delslice__(i, j) <==> del x[i:j] Use of negative indices is not supported.__contains__x.__contains__(y) <==> y in x__iadd__x.__iadd__(y) <==> x+=y__imul__x.__imul__(y) <==> x*=yOut of memory interning slotdef names__thisclass__the class invoking super()__self__the instance invoking super(); may be None__self_class__the type of the instance invoking super(); may be None, <%s object>>NULL, NULL>NULL__class____class__super(type, obj): obj must be an instance or subtype of typesuperO!|O:supersuper4Hx/4$4.4D]2/ 4K8K8@@isinstance(object, class-or-type-or-tuple) -> bool Return whether an object is an instance of a class or of a subclass thereof. With a type as second argument, return whether that is the object's type. The form using a tuple, isinstance(x, (A, B, ...)), is a shortcut for isinstance(x, A) or isinstance(x, B) or ... (etc.).7'{O^BI1E>K1AGLK1NK1Implementation module for SSL socket operations. See the socket module for documentation.dirread(fd) -> list_of_dir_tuples Return a list containing tuple stat structures for some of the directory. fd: fd of directory to list ;ud'#;%/);4.(=8*=8Ć/̆/Ԇ///////$/0/?/W/h/r/////Ƈ/Շ////$/ string Read up to len bytes from the SSL socket.sub(repl, string[, count = 0]) --> newstring Return the string obtained by replacing the leftmost non-overlapping occurrences of pattern in string by the replacement repl.`!g!q!v! |!!!Ϧ!!!!!! ! !9!H! b! h! m! r! UTF-16BE/dev/randomFailed to open /dev/randomFailed to read bytes from /dev/random/dev/random/dev/random (or equivalent) not foundFailed to read %zi bytes from /dev/randomnegative argument not allowedPYTHONHASHSEEDrandomPYTHONHASHSEED must be "random" or an integer in range [0; 4294967295]!3|7@7@7@7@7@7@7@7@7@7@7@ 7@7@7@7@7@7@7@|7@7@x7@7@t7@7@p7@7@l7@7@h7@7@d7@7@`7n777@7@^7@ 7@7@7@f7@(7@7@7@n7@07@7@7@v7@87@7@7@~7@@7@7@7@7@H7@ 7@7@7@P7@7@7@7@X7@7@7@7@`7@"7@7@7@h7@*7@7@7@p7@27@7@7@x7@:7@7@7@7@B7@7@7@7@J7@ 7@7@7@R7@7@7@7@Z7@7@7@7@b7@$7@7@7@j7@,7@7@7@r7@47@7@7@z7@<7@7@7@7@D7@7@Osharedmpkaratsuba: %rUTF-16LE36,EL6re"Lsetsockopt(level, option, value) Set a socket option. See the Unix manual for level and option. The value argument can either be an integer or a string.-DT!B.rstrip([bytes]) -> bytearray Strip trailing bytes contained in the argument. If the argument is omitted, strip trailing ASCII whitespace.JSON scanner objectH)M)>O.$!#&MpAe3t!IJWLgr_namegroup namegr_passwdpasswordgr_gidgroup idgr_memgroup memebersgrp.struct_groupgetgrgid(): gid not found: %ldgetgrgid(): gid not found: %lugetgrnam(): name not found: %sgetgrgidgetgrgid(id) -> tuple Return the group database entry for the given numeric group ID. If id is not valid, raise KeyError.getgrnamgetgrnam(name) -> tuple Return the group database entry for the given group name. If name is not valid, raise KeyError.getgrallgetgrall() -> list of tuples Return a list of all available group entries, in arbitrary order. An entry whose name starts with '+' or '-' represents an instruction to use YP/NIS and may not be accessible via getgrnam or getgrgid.grpstruct_groupB.startswith(prefix [,start [,end]]) -> bool Return True if B starts with the specified prefix, False otherwise. With optional start, test B beginning at that position. With optional end, stop comparing B at that position. prefix can also be a tuple of strings to try.))  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~H)2; u^E <^ _.A__  wait() -> (pid, status) Wait for completion of a child process.o3x3 3create(filename, omode, perm) -> fd Create a file (for low level IO).maketrans(frm, to) -> string Return a translation table (a string of 256 bytes long) suitable for use in string.translate. The strings frm and to must be of the same length.gmtime([seconds]) -> (tm_year, tm_mon, tm_mday, tm_hour, tm_min, tm_sec, tm_wday, tm_yday, tm_isdst) Convert seconds since the Epoch to a time tuple expressing UTC (a.k.a. GMT). When 'seconds' is not passed in, convert the current time instead.dup(fd) -> fd2 Return a duplicate of a file descriptor.!M{@S.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of substring sub in string S[start:end]. Optional arguments start and end are interpreted as in slice notation.isatty(fd) -> bool Return True if the file descriptor 'fd' is an open file descriptor connected to the slave end of a terminal.8-L8-L8-L8-L8-L9-LerrnoerrorcodeENODEVEHOSTUNREACHENOSYSEPIPEEINVALEINTRENOTEMPTYENOBUFSECHILDEXDEVE2BIGESRCHEMSGSIZEEAFNOSUPPORTEHOSTDOWNEPFNOSUPPORTENOPROTOOPTEBUSYEWOULDBLOCKEISCONNESHUTDOWNEBADFEIOEPROTOTYPEENOSPCENOEXECEALREADYENETDOWNEACCESENOTDIREPERMEDOMECONNREFUSEDEISDIREPROTONOSUPPORTEROFSEADDRNOTAVAILENFILEESPIPEENETRESETETIMEDOUTENOENTEEXISTEFAULTEFBIGEDEADLKENOTCONNEDESTADDRREQENOLCKECONNABORTEDENETUNREACHENOMEMENOTSOCKEMLINKERANGEECONNRESETEADDRINUSEEOPNOTSUPPEAGAINENAMETOOLONGENOTTYESOCKTNOSUPPORTETOOMANYREFSEMFILEETXTBSYEINPROGRESSENXIO(% T<( +t)Q @@>9>9>9>9?9?9 ?9?9?9!?9)?92?9isinf(z) -> bool Checks if the real or imaginary part of z is infinite.X@peer_certificate([der=False]) -> certificate Returns the certificate for the peer. If no certificate was provided, returns None. If a certificate was provided, but not validated, returns an empty dictionary. Otherwise returns a dict containing information about the peer certificate. If the optional argument is True, returns a DER-encoded copy of the peer certificate, or None if no certificate was provided. This will return the certificate even if it wasn't validated.D.clear() -> None. Remove all items from D.getweakrefs(object) -- return a list of all weak reference objects that point to 'object'.Tell the current file position.@@  (08@P`pz7f  {7f writelines(sequence_of_strings) -> None. Write strings to the file. Note that newlines are not added. The sequence can be any iterable object producing strings. This is equivalent to calling write() for each string.+eG?$E0E0E0hF0Q G0>bG0H0I0`}J0K0B`L0^N0)N0N0:O0:Q08S08U04W04Y0$[0"]0 _0 a0c0e0g0i0k0m0o0q0s0u0w0y0z0|0~000000000000000000000000|006D0B0B0@0@0>0>0<0<0:08080x07000000000w00000000000 00kf0GC object already trackedGC object already tracked../Objects/dictobject.c../Objects/dictobject.c{...}{, : }{...}{}: {}, __missing__fromkeyskeysupdatecannot convert dictionary update sequence element #%zd to a sequencedictionary update sequence element #%zd has length %zd; 2 is required../Objects/dictobject.ckeys../Objects/dictobject.c../Objects/dictobject.c../Objects/dictobject.c../Objects/dictobject.c../Objects/dictobject.cdict inequality comparisons not supported in 3.xdict.has_key() not supported in 3.x; use the in operatorgetsetdefaultpoppopitem(): dictionary is empty__contains____getitem____sizeof__has_keygetsetdefaultpoppopitemkeysitemsvaluesviewkeysviewitemsviewvaluesupdatefromkeysclearcopyiterkeysitervaluesiteritemsdictdictGC object already tracked__length_hint__dictionary changed size during iterationdictionary-keyiteratordictionary changed size during iterationdictionary-valueiteratordictionary changed size during iterationdictionary-itemiterator../Objects/dictobject.c%s() requires a dict argument, not '%s'GC object already tracked%s(%s)difference_updateOintersection_updateOupdateOsymmetric_difference_updateOdict_keysdict_itemsdict_valuesSetParamEntityParsing(flag) -> success Controls parsing of parameter entities (including the external DTD subset). Possible flag values are XML_PARAM_ENTITY_PARSING_NEVER, XML_PARAM_ENTITY_PARSING_UNLESS_STANDALONE and XML_PARAM_ENTITY_PARSING_ALWAYS. Returns true if setting the flag was successful.getcwd() -> path Return a string representing the current working directory.NOTATIONp)s)subn(repl, string[, count = 0]) --> (newstring, number of subs) Return the tuple (new_string, number_of_subs_made) found by replacing the leftmost non-overlapping occurrences of pattern with the replacement repl.S.isupper() -> bool Return True if all cased characters in S are uppercase and there is at least one cased character in S, False otherwise."S.find(sub [,start [,end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure."H"M"U"b"o"w"}" "M6R6Private method returning an estimate of len(list(it)).z""The result of re.match() and re.search(). Match objects always have a boolean value of True.""""""Decode hexbin RLE-coded stringF"K"88x8bidirectional(unichr) Returns the bidirectional class assigned to the Unicode character unichr as string. If no such value is defined, an empty string is returned.Y`JY`S.lstrip([chars]) -> string or unicode Return a copy of the string S with leading whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is unicode, S will be converted to unicode before strippingargument must be callablestring is too largeno codec search functions registered: can't find encodingcodec search functions must return 4-tuplesunknown encoding: %ssOsOincrementalencoderincrementaldecoderencoder must return a tuple (object,integer)decoder must return a tuple (object,integer)handler must be callablestrictunknown error handler name '%.400s'__class____name__don't know how to handle %.400s in error callbackcodec must pass exception instance(u#n)(On)(u#n)(On)(On)(On)strictstrict_errorsImplements the 'strict' error handling, which raises a UnicodeError on coding errors.ignoreignore_errorsImplements the 'ignore' error handling, which ignores malformed data and continues.replacereplace_errorsImplements the 'replace' error handling, which replaces malformed data with a replacement marker.xmlcharrefreplacexmlcharrefreplace_errorsImplements the 'xmlcharrefreplace' error handling, which replaces an unencodable character with the appropriate XML character reference.backslashreplacebackslashreplace_errorsImplements the 'backslashreplace' error handling, which replaces an unencodable character with a backslashed escape sequence.can't initialize codec error registrycan't initialize codec error registrycan't initialize codec registryencodingsK+8U++͕++.++(+"+ؙ'+P+W++%+++++6+2B+s+|++++++2#+T+ ]+0123456789abcdefgq8nq8Ptq86݌zq8z7e f S.__sizeof__() -> size of S in memory, in bytes"0q7"\#ɇ"#ԇ"3"U-"D!"x0")"`9*"Td";8"*-X'A"start_new_thread(function, args[, kwargs]) (start_new() is an obsolete synonym) Start a new thread and return its identifier. The thread will call the function with positional arguments from the tuple args and keyword arguments taken from the optional dictionary kwargs. The thread exits when the function returns; the return value is ignored. The thread will also exit when the function raises an unhandled exception; a stack trace will be printed unless the exception is SystemExit. takewhile object Return successive entries from an iterable as long as the predicate evaluates to true for each entry.lstat(path) -> stat result Like stat(path), but do not follow symbolic links.QUOTE_MINIMALQUOTE_ALLQUOTE_NONNUMERICQUOTE_NONEunknown dialect"%s" must be an integer"%s" must be an 1-character string"%s" must be an stringbad "quoting" valuedelimiterskipinitialspacedoublequotestrictescapecharlineterminatorquotecharquotingdialectdelimiterdoublequoteescapecharlineterminatorquotecharquotingskipinitialspacestrict|OOOOOOOOOdelimiterdoublequoteescapecharlineterminatorquotecharquotingskipinitialspacestrictdelimiterdoublequoteescapecharlineterminator quotecharquotingskipinitialspacestrictdelimiter must be setquotechar must be set if quoting enabledlineterminator must be set_csv.Dialect(O)()field larger than field limit (%ld)'%c' expected after '%c'new-line character seen in unquoted field - do you need to open the file in universal-newline mode?unexpected end of dataline contains NULL bytedialectline_num_csv.readerargument 1 must be an iteratorneed to escape, but no escapechar setsingle empty field record must be quotedsequence expected(s#)writerows() argument must be iterablewriterowwriterowsdialect_csv.writerwriteargument 1 must have a "write" methoddialect name must be a string or unicodeunknown dialectfield_size_limitlimit must be an integerreaderwriterlist_dialectsregister_dialectunregister_dialectget_dialectfield_size_limit_csv__version__1.0_dialectsDialect_csv.ErrorErrori//z02W4557<U8|888:b;; <<<<=/=S= 23<expm1(x) Return exp(x)-1. This function avoids the loss of precision involved in the direct evaluation of exp(x)-1 for small x.couldn't parse wait message  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~T@ !#'),.02468:<>@BEHKNRV[`einsx| #(-15:>CHMRW[^bdhmpsvy|"(/6>EMUZbiov} #+08?ELSZ]cjpw~ &-4;BIPW^fnv~ $,49@GOW_gq{&.5<DLT\dlt|&.6>FKQW^ejou| %,16=DHMRW^gnu~  ! & 0 5 : D I P W _ g n u |     $ , 4 < C J T ^ f n v {     ( 1 : D N V ^ g p y    ' . 5 < F P Z d k r |     & - 4 ? I P W ^ e j o u {  '05:DKS\agmty~ &.3;AIQW]cksy $,38=AFKOTZ`fmrw| #(.39AIMQV\bhns{ "(.38=@FKPTY_ehlptwz  $*/49>DGKPU^dimrv{",038@EMU]emu (38=BGLQV[`ejoty~  #',059>CHMRW\afkpuz !&+39>BGLQV[`eiosx} !&+059>BGLQV\agkpt|%.38=BGLQValqv}%.6>FNU\cjpv|  (08=BIPZdhpx~ '/7?GNU]emu| ")07>ELSZahov}#+38=BGLQV[_dinsx}  %*/48=BGLQV[`ejoty~     # * 1 6 = B G L S X ] d m r w | ! !!!!!!%!)!-!1!5!9!=!A!F!J!N!S!W!\!`!d!h!m!q!v!z!~!!!!!!!!!!!!!!!!!!!!!!!!!" """"#"'"+"/"2"9"="A"H"N"U"["a"e"i"o"s"w"{""""""""""""""""""""""""""""## ####### ###'#*#-#2#7#=#@#G#P#U#Y#`#e#i#m#q#u#y#}########################$$ $$$$!$($,$0$4$;$B$N$R$V$Z$d$m$q$y$$$$$$$$$$$$$$$$$% %%%%%%)%/%6%=%A%I%M%T%X%`%d%l%t%{%%%%%%%%%%%%%%%%%%%%%&& &&&&$&)&1&6&:&G&T&Z&a&f&l&q&w&&&&&&&&&&&&&&&&&&&&''''' '&','2'9'@'G'M'U'^'d'k'r'w'|''''''''''''''''''''''''''(( ((((((#('(+(/(3(7(=(C(I(M(Q(V(Z(^(c(g(k(r(y(}((((((((((((((((((((((()))$)+)6)E)P)V)_)g)s)}))))))))))))))))**$*.*9*D*Q*^*l*x*******************+ +++++"+'+,+1+6+;+@+E+J+O+T+Y+^+c+h+l+q+v+{++++++++++++++++++++++++++++++++,, ,,,,,#,',,,1,6,;,?,D,K,O,T,X,\,a,e,l,s,z,,,,,,,,,,,,,,,,,,,,,,,--- ----- -$-(-,-0-4-8-<-@-D-H-L-P-W-]-b-f-m-s-x-~---------------------------. ......".%.).,.0.4.8.=.B.E.I.N.S.V.Z.].a.e.i.m.q.u.y.}..................................// ////!/&/,/2/6/;/?/E/H/N/T/Y/^/e/i/m/q/u/y/}/////////////////////////////////000 000000!0%0(0,0004080<0@0D0H0L0P0T0X0\0`0d0h0l0p0s0v0z0~00000000000000000000000000000011 1111111!1$1'1*131<1@1D1J1P1V1\1j1q1t1x1~1111111111111111111111111111111111222 222222!2%2(2,21252:2>2C2H2M2R2W2[2_2c2g2k2o2s2w2z2}222222222222222222222222222222222222233 333333#3'3+3/3336393=3A3E3H3K3N3R3V3Z3^3b3f3i3m3q3v3z33333333333333333333333333333333344 4 44444 4#4'4*4.42464:4>4B4F4J4N4R4V4Z4^4b4f4j4n4r4u4x4|444444444444444444444444444444455 555555"5%5(5+5.5154575;5?5C5F5J5M5Q5T5X5[5_5c5f5j5n5q5u5y5}55555555555555555555555555555555566 6 6666666"6&6+6064686<6@6D6I6M6P6T6X6\6_6c6f6j6m6q6u6y6|6666666666666666666666666666666666677 7 77777!7&7*7/747:7>7C7H7L7Q7V7Z7^7d7h7l7q7v7{777777777777777777777888 888888!8%8)8,8084878;8?8C8G8K8O8S8W8[8_8c8g8k8o8s8w8{88888888888888888888888888888888899 9999 9&9*9-909396999<9?9B9E9I9M9Q9U9X9\9_9c9f9j9n9r9u9y9}99999999999999999999999999999999999:: ::::::#:':,:1:7:;:@:E:I:N:S:W:]:b:g:l:r:v:y:|:::::::::::::::::::::::::::::::;; ;;;;;;#;';-;3;9;?;E;K;Q;W;];c;i;q;w;};;;;;;;;;;;;;;;;;;;;;;;;< <<<<<#<*<1<8<?<F<K<P<W<^<g<r<{<<<<<<<<<<<<<<<<<<<<<<<= ====!='=-=3=9=?=E=K=Q=V=\=b=f=l=p=v=|========================> >>>>>$>*>.>2>6>:>>>A>D>G>J>M>P>S>V>Y>]>a>e>k>q>u>y>>>>>>>>>>>>>>>>>>>>>>>>>>>>?? ????"?(?.?2?7?;?@?E?J?P?V?\?b?f?i?m?p?s?v?y?|?????????????????@ @@@@"@*@4@<@I@O@W@_@k@r@z@@@@@@@@@@@@@@@@@@@@@@@@@@@@AAA"A(A0A8A@AHANATAWA[A_AcAgAkAoAsAwA{AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABB BBBBB$B*B.B3B7BDDDRDaDfDkDsD{D~DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDEEE EEEEEE$E)E-E2E6E;E?EDEKEQEVEZE^EbEfEjEpEvE}EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEF FFF#F+F4F=FHFRF\FgFrF|FFFFFFFFFFFFFFFFFGG GGGG$G)G2G9G?GFGNGTGZG`GfGnGvGGGGGGGGGGGGGGGGGGGGGGGGHH HHHHH#H(H-H2H7HKBKFKJKNKRKVKZK^KbKfKjKnKrKvKzK~KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKLL LLLLLL"L&L*L.L2L6L:L>LBLFLJLNLRLVLZL^LbLfLjLnLrLvLzL~LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLMM MMMMMM"M&M*M.M2M6M:M>MBMFMJMNMRMVMYM]MaMeMiMmMqMuMyM}MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMNN NNNNNN#N'N+N/N3N7N;N?NCNGNKNONSNWN[N_NcNgNkNoNsNwN{NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNOO OOOOOO"O&O*O.O2O6O:O>OBOFOJONOROVOZO^ObOfOjOmOqOuOyO}OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPP PPPPPP#P'P+P/P3P7P;P?PCPGPKPOPSPWP\PaPfPlPrPwP|PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQ QQQQQQ#Q'Q+Q/Q3Q7Q;Q?QCQGQKQOQSQWQ[Q_QcQgQkQoQsQwQ{QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRR RRRRRR#R'R+R/R3R7R;R?RCRGRKRORRRVRZR^RbRfRjRnRrRvRzRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRSS SSSSS!S'S+S/S3S9S?SESMSSSYS_SeSkSqStSwSzS}SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTTT TTTTTT#T'T+T/T3T7T;T?TCTGTKTOTSTWT[T_TcTgTkToTsTwT{TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTUU UUUU U%U)U.U4U8U>UDUHUMUUU]UdUiUnUwU~UUUUUUUUUUUUUUUUUUUUUUUUUUUUUVV VVVVV"V&V*V.V2V5V9V?VDVIVMVQVUVZV^VcVgVlVoVsVwV|VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVWW WWWW W&W,W2W6W:W>WBWFWJWPWTWXW\WaWeWjWnWsWwW|WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWXX XXXXX!X&X*X.X2X6X:X>XDXGXKXOXTXXX]XaXfXlXoXtXxX|XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYY YYYYY Y$Y)Y-Y2Y6Y;Y?YDYHYMYSYVY[Y_YdYjYpYvY|YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYZZ ZZZZZZ$Z(Z-Z1Z6Z:Z?ZCZHZLZQZWZ[ZaZfZlZpZvZ{ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ[[ [[[[[ [$[([,[0[4[8[<[@[F[L[R[X[^[c[i[o[u[y[}[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[\ \\\\\"\&\*\.\2\8\>\D\J\P\V\\\b\h\m\r\w\|\\\\\\\\\\\\\\\\\\\\\\\\]] ]]]]]#](]-]2]7]<]A]F]K]P]U]Z]_]d]i]n]s]x]}]]]]]]]]]]]]]]]]]]]]]]]]]]]^^ ^^^^!^&^*^/^4^9^>^C^G^L^Q^V^[^`^d^i^o^t^y^~^^^^^^^^^^^^^^^^^^^^^^^^^^__ _____$_)_._3_8_=_B_G_L_Q_V_[_`_e_k_p_u_z___________________________`` `````$`)`/`3`7`;`?`C`G`K`O`U`[`a`g`m`s`y```````````````````````````aa aaa"a&a-a1a5a9aAaEaJaOaTaXa]abaeaiamavaza~aaaaaaaaaaaaaaaaaaaaaaab bbbb"b(b,b6beBeGeLeQeUeZe_edehemeqeve{eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeefff f fff f(f0f8f@fHfPfXf`fcfffifnfqfvf}fffffffffffffffffffffffffffffffffggg gggggg"g&g*g-g1g5g9g=gAgEgIgMgTgYg^gcghgngtgzgggggggggggggggggggggggghhhhhh$h*h0h6hlAlDlGlJlOlUl[lalglllrlxl~llllllllllllllllllllllllm mmmm%m,m3m9m@mGmNmUm[mbmimomvm}mmmmmmmmmmmmmmmmmmmmnnnnn$n+n2n9nAnHnOnUn\nbninonvn}nnnnnnnnnnnnnnnnnnnnnoo oooo"o(o.o2o8o>oDoJoPoVo\obohonotozoooooooooooooooooooooooopp ppppp"p'p,p1p6p:p>pCpHpMpQpUpZp_pdpipopspzppppppppppppppppppppppppqq qqqq"q&q+q0q4q9q>qCqHqNqTqZq_qdqhqmqqqvqzqqqqqqqqqqqqqqqqqqqqr rrrr"r(r-r4r:r?rErKrQrXr_rfrkrprwr~rrrrrrrrrrrrrrrrrrrrrrss ssss s%s*s/s7s>sCsHsMsRsWs\sbshslspstsxs~ssssssssssssssssssssssssst tttt t&t)t,t2t6tFNV^fnzÃ΃ك %.7@HPX`hpyƄ̈́Ԅ܄ $,4<DLT]fowDžυׅ'1;DMWalwĆˆԆ݆%/8AIQX_goxɇӇ܇#-7>EMU^gq{Ɉшو '/7AKU_is{ljωى%/7?IS]gq{NJϊ׊ #-7AKU_goyŋϋ׋ߋ#-7AIQ[eoyŌόٌ !)19AIS]jwٍ̍ !.;HUboyĎюێ &3=GTan{Ïˏ֏ޏ #.6AIQYainsxɐѐ֐ې)19AIQW]`ks~ÑǑˑϑӑבۑߑ %+29>CIOQTVZ^beimquy’Œɒ˒͒ϒҒؒڒޒ  %)-26:?DHLPRW\`dhlpv|“Ǔ͓ѓԓדړݓ #&),147:=@CGJMPSV[^adgjoruzƔ˔Ҕהܔ "&*.29=AFJNRTX\`eimux|Õƕ˕Еٕ֕ܕ #(-15:?DHLQUX[]afmt{Ö˖Ӗؖݖ $,39?EKQW]cipw~ǗЗٗ "&+16<AFKQV\bfjoty~ȘҘ٘ !).39>DKRW]beilptx~™ƙə͙Йԙۙ"(049>DJPW[_dgimqx|~ĚȚ̚КԚךۚߚ  $*02468;=ACGJOSWZ^bgkt~›ƛ̛Лӛ՛؛ܛ #')-03;CIOXafks{}ɜӜڜ  %(+.148;>ADFHJLT\adisyǝ͝ѝ՝ٝܝ !&+06<CJOTY^fnv~ɞמڞߞ"(06CQV\cfiknqsuy|ßȟ͟ҟןܟޟ  $(*,.3:AHOV]dkqw~àˠҠڠ%,3:AIPW^fmt{ȡϡסߡ "%-05:=@HKPSZ_gjmpuz}ŢˢӢ٢'/38ERVZ^blpuzƣУڣ #(,29@HOSW[_aeinszĤȤ̤Ѥפܤ $-18<@FLRX\`cgkry|¥ťȥ˥Υѥե٥ݥ  $(,048<@DJPV]dkryƦͦҦئަ  &,16<AGMSY_djpv{çȧΧӧ٧ߧ $*05:?DJPUZ`ekqw}èǨ˨ϨӨרۨߨ!*3<ENU]els{Ʃͩթީ )1:CJQZcks|ǪΪժު '1:CLU\dlt|ǫΫ׫߫'.7?FOW^gpyƬˬӬ۬ !%,29=CIOSVZ^ekqw}ϭҭխܭ "&*-05:@FKPV\afkpv|ȮϮ׮߮ #,5>CHNTZ`cioyɯүۯ !#%(+-/159;=@CGMSU\`ejlu{°ŰɰΰѰհڰ߰ #%(*-/13579;=?ACEGIKMOTY^chmrw|ű˱бձڱ߱ !)/49>AEIMQUY`gow|òŲʲѲز۲߲ #&).0468:<>@EGIKMQSV[`ejpvx{ųͳӳٳ޳#).46<>DFHMOSXZ_dhoy´ƴ˴дԴڴ &*17<BFKNTZaipyĵ˵͵ӵصڵݵ$'+.9CMV_emqy}öͶֶ߶ !(/6=DLRX^djpv|ɷѷڷ߷ $-6;AFKRYair{ƸϸѸոٸ &+06;@FKNRV]fkt}ŹʹϹֹݹ !%)-159=AEIMQUY]aeimquy}źɺͺѺպٺݺ !%)-159=AEIMQUY]aeimquy}Żɻͻѻջٻݻ !%)-159=AEIMQUY]aeimquy}żɼͼѼռټݼ !%)-159=AEIMQUY]aeimquy}Žɽͽѽսٽݽ  (.4;BHNTZ_dintzþƾʾξԾھ )4?JT^jv̿׿޿%,3:?DJR\dlt|",:KYjx #(-38=BGLSX_dimqx  (/3;CFINT\dx !).149<OV\bfiloz %)-5AIMOXagjpv{ $)048ER]flsx} #,5>FJPW^bhoty  (07>EKRX_fmtz$/:DNZfkpx )27<ENSX`flt| %,3<ELS[cksz  (0;?CGLW^elqx  '.5<FPW^fnrw|)4:CIR[agkox $).38=BGLQV[`ejoty~ !&+05:?DINSX]bglqv{&.6;BGMU\ckqw~ "',16;@EJOTX\afkpuz ")07>ELSZahov| $(.4:AHOV[agox  %*/49>CHMRW[`ejox} "',18?DINSX]bglqv} #'+/37;?CGKOSW[_cgkosw{ #(-26;@GLQW^enu~  %*/49=AHOUY]`dlpty~ "&-16;?CINSX]aeimqv{ $).39=CGKQW]ciou{ #'+/59=AEIMQUY]aeimqu{ !%)-159=AEIMTX^bfjnruy} #'+/37;?CGKOSW[_cgosw{ #*5?GPYco{ &+05:?DINSX]bglrw{ #'+/37;?CGKOSW[_cglptx|  $'+/4<DKRV\afjmqtx{ !%)-159=AEIMQTX\`dhkpty} !$(,/258<@DHLPTX\`cfjnrvz~ "%)-159=@CGKOSW[_cgkosw{ $*06<BHLPTX\`dhlptx| "&*.26:?DIMRV[`ejosx}  #&),/26:>BFJNRVZ^bfjnrvz~ !&*/49>CGKOSW[_cgkosw{ "&*.26:>BFJNRVZ^bfjnrvz~ #&),147:=@CGKOSW[_cgkoswz}  #&),/258;>ADGJMPSVY\_behknqtwz} ")08@HPX`hpx "%(+/258;>BEHKPUZ_dinsx  #&),/258=AHOV]dkry (03;CMSW[aglptx| $*.48>FPT\`fnvz~ !%)-159=AEIMQUY]aeimquy}  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX\`dhlosw{ #'+/37;?CGKOSW[_cgkosw{ #'+/37;>BFJNRVZ^bfjnrvz~ "&*.26:>BFJNRVZ^bfjnrvz~ !%)-159=AEIMQUY]aeimquy} !%)-159=AEIMQUY]aeimquy}  $(,048<@DHLPTX\`dhlptx|  $(,048<@DHLPTX[_cgkosw{ #'+/37;?CGKOSW[_cgkosw{ #'+/37;?CGKOSW[_cgkosw{ "&*.26:>BFJNRVZ^bfjnrvz~ "&*.26:>BFJNRVZ^bfjnrvz~ "&*.26:>BFJNRVZ^bfjnrvz~  !%)-159=AEIMQUY]aeimquy}  !%)-159=AEIMQUY]aeimquy}  !%)-159=AEIMQUY]aeimquy}  !%)-159=AEIMQUY]aeimquy}  $)-26;?CGLQV^fnv} #&*.26:>BFJNRVZ^bfjnrvz~ "&*.258<@DGJNRVZ^bfjnrvz~  !%)-159=AEIMQUY]aeimqtx|        " & * . 2 6 : > B F J N R V Z ^ b f j n r v z ~                                         ! $ ' * / 5 : ? D I O U Z _ d i p w ~                      " ) 0 7 = C I O V ] b f m t {                                   " & ) - 0 4 7 ; ? C G K O S V Z ^ b f j n r v z ~                                          # ' + / 3 7 ; ? C H M P U X [ ^ b k t }               &+05>DJQZbjry %,3<EP[agow (16;BIPWbmrw| %,07<AHOV^ekqx~#*18?FMT[bipx  $(-26;@EJOTY]afkptx|  "&+/47;?BFJMQUY]aeimquy} !%),/258;>ADIMQUY]aeimquy}  '.5<CIOV\cjpv} #',16;?DHMQV[`einsx~  $(,048<?EHLOU[cfjmpuz~ $)05<AHMSY_bfjoty~  $(,/36:>BFJMQTW[_cgjosx}   &-39?EKQW]ciotz #)/5;AGMRW]ciou{  !&+05:AHOV[`elsz &-6?HQZclu}  $(,048<@DHLPTX\`dhlptx|         $ ( , 0 4 8 < @ D H L P T X \ ` d h l p t x |                                 !!! !!!!! !$!(!,!0!4!8!*D*J*P*V*\*b*h*n*t*z**********************++++ +(+0+8+@+H+P+X+`+g+n+x++++++++++++++++++++++,,,&,0,;,F,Q,\,f,p,{,,,,,,,,,,,,,- --!-,-6->-F-O-W-`-h-p-x------------------... .(.0.9.A.I.Q.Y.a.i.q.y.................////(/0/9/A/H/O/W/^/f/m/u/}////////////////0 000%0.070A0L0W0a0l0w00000000000000001 111&1.171?1G1P1X1a1i1q1z11111111111111111222%20282@2I2Q2Z2b2j2s2{222222222222222223 333#3+333;3C3K3S3\3d3l3t3|333333333333333334444)40474?4F4N4X4c4k4t4|44444444444444445 555&5.575?5H5P5Y5a5i5p5x55555555555555556666"6*636;6D6L6T6[6c6j6s6{66666666666666667 777%7-767>7F7O7W7_7g7o7t7y77777777777777888#8-878A8K8U8_8i8s8}8888888888888999#9-989C9N9X9b9l9v99999999999999: :::(:3:=:G:R:\:g:p:y:::::::::::::; ;; ;);2;;;D;N;X;b;l;v;;;;;;;;;;;;;;; <<<-<<<B<H<N<T<Z<`<f<l<t<x<{<<<<<<<<<<<<<<<<<<<<<<<<<<===="=)=/=5=:=D=N=X=a=l=u=~============= >>>>&>/>3>7>;>@>E>J>O>R>V>[>^>a>e>i>n>r>v>{>>>>>>>>>>>>>>>>>>>>>>>>>>>>>?? ???'?/?8?A?J?S?[?c?k?s?x?}???????????????????????@ @@@@!@'@-@3@9@?@E@K@Q@W@]@c@i@o@u@{@@@@@@@@@@@@@@@@@@@@@@@A AAAA#A)A/A5A;AAAGAMASAYA_AeAjAoAtAyAAAAAAAAAAAAAAAAAAAABBB#B+B3B7B;B>BBBFBIBLBPBTBWBZB]B`BeBhBlBoBrBuBxB{B~BBBBBBBBBBBBBBBBBBBBBBBBBBBCC CCCC"C(C.C4C8C=CACFCJCOCTCZC`CfCkCqCwC}CCCCCCCCCCCCCCCCCCCCCCCCCDD DDDD D%D*D/D4D9D?DEDKDSDWD[D_DcDgDkDpDuDzDDDDDDDDDDDDDDDDDDDDDDDDDDDDEE EEEEE#E'E.E5E9E>ECEHEMEREWE\EaEfEkEpEuEzEEEEEEEEEEEEEEEEEEEEEEEEEEEEFF FFFFF$F)F.F2F6F:F=F@FDFHFLFRFUFYF\F`FdFhFnFtFzFFFFFFFFFFFFFFFFFFFFFG GGGG%G+G2G9G@GGGMGTG[GbGiGpGwG~GGGGGGGGGGGGGGGGGGGHHHHH$H+H2H9H@HGHNHUH\HcHjHqHxH~HHHHHHHHHHHHHHHHHHHHHHHI IIII&I-I4I;IBIIIQIYI`IgIlItI|IIIIIIIIIIIIIIIIIIIIIIIJJ JJJJ J'J,J1J6J;J@JEJJJOJTJYJ^JeJlJsJzJJJJJJJJJJJJJJJJJJJJJJJKKKKK$K+K2K9K@KGKNKUK\KcKjKqKxKKKKKKKKKKKKKKKKKKKKKKKLL LLLLL#L(L-L2L8L>LDLKLRLYL`LgLnLtLzLLLLLLLLLLLLLLLLLLLM MMM%M-M5M=MEMMMSMZMcMlMuM~MMMMMMMMMMMMMM NNN!N'N-N3N;NCNINPNZNaNhNoNvN}NNNNNNNNNNNNNNNNOO OOOOOO$O*O0O4O:O>OBOFOJONOROXO\OaOfOkOpOwO|OOOOOOOOOOOOOOOOOOOOOP PPP$P+P2P9P@PGPNPUP\PePlPsPzPPPPPPPPPPPPPPPPPPPPQQ QQQQ Q%Q*Q.Q2Q6Q;Q@QDQIQNQRQVQ[Q`QeQjQoQtQxQ}QQQQQQQQQQQQQQQQQQQQQQQQQQQQRR RRRRR#R(R-R2R7R`D`K`R`Z`b`h`n`u`{````````````````````a aaa a'a.a5acBcFcJcNcRcVcZc^cbcfcjcncrcvczc~cccccccccccccccccccccccccccccccccddd dddd%d-d3d9d=dAdHdQdXdadgdpdwd~dddddddddddddddddddeeeeee!e(e,e3e:eHeQeUeYe]edehelepexeeeeeeeeeeeeeeeeeeeeeffff"f&f*f.f2f=fFfOfXfafmfvfffffffffffffffggggg!g%g)g-g4g8gkGkPkWkakgkkkokwk~kkkkkkkkkkkkkkkkkkkkkll lllll&l-l4l;lBlIlPlVlZl^lelllslzllllllllllllllllllllllmm mmmmm"m+m1m7m=mBmHmNmTmZm`mhmnmymmmmmmmmmmmmmmmmmmmmn nnnn"n(n.n4n:n@nFnLnQnWn]nenknqnun}nnnnnnnnnnnnnnnnnnnnnnoo o oooo.o2o6o=oAoEoKoOoSo[o_ocogokoqo|ooooooooooooooooop ppp#p*p1p8pDpKpRpYp`pgpqpxppppppppppppppppq qqq!q'q4q8qGNU\cjqzƒϒؒ%.9>CNV_hq|œГדޓ +6ALWbmt{Ĕ͔֔ߔ "+4=FMV\afmsyÕǕʕЕ֕ܕ  *4:@HMRX^djpv}Ŗ˖іז %.7@IS]emv—ȗΗԗݗ  %*06<BHNTZ_dinsx}ĘȘ̘ИԘܘ $*06<BFJQW]chotzÙəϙՙݙ #/;IWeiqy~ĚʚК֚ܚ $*06<BHNTZ`flrx~ƛ̛қ؛ޛ &,28>CHMQV]dkrw{ƜʜΜҜ֜ڜޜ &*159=AEIMTX\`dhnrx|ĝ̝Нԝ؝ (08@HPX`hlqv{ÞǞ̞ў֞۞  $).26;?DINSX\afkoty~Ɵ˟Пԟٟޟ !&*/49>CHNTZ_ekqv|àɠϠՠڠ#(.49>DIOU[agkpuzšʡϡԡ١ݡ "',28>CIOUZ`fkpuzĢʢТբۢ "(-39?EKOTY]bglquy}ãȣͣң֣ۣ $(-26;@DINRVZ^cglqv{ĤɤͤѤ֤ڤߤ !&,27<AFLRW\bgmsyĥɥΥӥإޥ  %*.38=AFKOSW[`eimrv{æǦ˦ϦӦئݦ #)/5:@FKPUZ`fkpv{ģ̌ҧاݧ %+06<BGMSY^djoty~¨ȨΨԨ٨ߨ !&,17=CIOU\cjpw~ũ˩ҩةߩ#*17>EKQW]dkqw~êȪͪѪ֪۪ߪ #(-26;@EINSW[_chmquz~«ǫ̫ѫ֫۫ "&+05:?DINSX]bglqv{ìȬͬҬ׬ܬ #(-27<AFJOTY^chmrw|íȭέӭحݭ "(.4:@FLRY_ekqw}ĮʮЮ֮ܮ &,28>DJPV\bhntzïɯϯկۯ "(.4:@FLSY_ekqw}İ˰Ұٰ '.5<CJQX^elszDZαձݱ$+29@EJOSW[_cgkosx|Ų˲вղڲ߲  !(/6=DKQX_fnv~ó˳ӳ۳ %*/49>CHMRW[_cgkosw{ôǴ˴ϴӴ״۴ߴ  $(,048<@DHLPTX\`dhlptx|ĵȵ̵еԵصܵ %+16<BHMSY^chmsy~öƶɶ϶Զڶ߶ ",15:=AGMSW]ciou{÷ɷϷշ۷ !,7BMXcnrvz~¸ƸʸθҸָڸ޸ "&*.26:>BFJNRVZ^bfjnrvz~¹ƹʹιҹֹڹ޹ "&*.26:>BFJNRVZ^bfjnrvz~ºƺʺκҺֺں޺ "&*.26:>BFJNRVZ^bfjnrvz~»ƻʻλһֻڻ޻ "&*.26:>BFJNRVZ^bfjnrvz~¼ƼʼμҼּڼ޼ "&*.26:>BFJNRVZ^bfjnrvz~½ƽʽνҽֽڽ޽ "&*.26:>BFJNRVZ^bfjnrvz~¾ƾʾξҾ־ھ޾ "&*.26:>BFJNRVZ^bfjnrvz~¿ƿʿοҿֿڿ޿ "&*.26:>BFJNRVZ^bfjnrvz~ "&),/258;>ADGKOSW\agmsx~  %+17<BHMRW\bhmrx}  "%(+.147:=@CFILORUX[^adgjmpsvy|  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}f6d"'2"")#)$)%)&)')()))*)+),)-).)/)0)1)2)3)4)5)6)7)8)9):);)<)=)>)?)@)A)B)C)D)E)F)G)H)I)J)K)L)M)N)O)P)Q)R)S)T)U)V)W)X)Y)Z)[)])^)_)`)a)b)c)d)e)f)g)h)i)j)k)l)m)n)o)p)q)r)s)t)u)z):*I*!*,*<*K*Y*_*=*L*@*O*P*x)})>*M*?*N*Z*`*[*a*}*v){)\*b*;*J*$*/*#*.*A*Q*B*R*z*y)~)C*S*++*+9*H*D*T*%*0*]*c*'*3*&*2*G*W*(*4*w)|)^*d*E*U*F*V*)*5*+*8***7*)+$+o(p(q(v(w(x(y(z({(|(t(u(E+3+9+:+%+?+n*&+.+1+2+u*(+y*6+<+"+B+,+j*t*k*4+{*e*v*o*/+l*A+s*p*g*|*q*h*'+m*-+5+f*;+x*r*@+i*!+~*#+w*>+=+1*S+T+U+V+"*X*-*6*q+a+b+c+\+Z+_+}+[+W+m+Y+^+]+x+y+~+j+v+w+k+l+r+g+o+z+h+p+s+u+i+{+|+t+n+R+Y&r(s(F+G+P+Q+|#@#k(X+~,l(m(n(},!)]#_#b-d-`#\#x'y'z'5-6-7-8-9-:-;-<-=->-?-W-5,6,7,8,9,:,;,<,=,>,?,@,q"'#%#&#(#)#+#,#*#-#G"F"[#x-T"U"s-l"m"n"k"o"p"B"C"D"E"Q"R"S"y-v'w'H"I"|'B'C'D'E'F'G'H'I'J'K'L'M'N'O'P'~'}'!-"-#-$-%-&-'-(-)-*-+-,---.-/-0-1-2-3-4-A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,+,,,-,.,/,0,1,2,3,4,Z&[&\&]&^&_&`&a&b&c&m&"#!#$###;#g(h(i(j(?#h&i&j&k&g&d&e&~-:&=&;&@&9&>&<&?&l&}"{"|"z"{'}-!,",#,$,%,&,',(,),*,.#/#V"W":#}#~#Z"["X"Y"`-a-f&3"4"5"6"7"<#t$u$v$9"{#r's't'u'8"n&o&p&q&r&s&t&v&w&y&z&{&|&}&~&j-k-l-A(B(C(D(E(F(G(H(I(J(K(L(M(N(O(e-f-g-h-i-P(Q(R(S(T(U(V(W(X(Y(Z([(\(](^([,\,],^,_,`,a,b,c,d,e,f,g,h,i,j,k,l,m,n,q,p,s,r,o,F-J-A-D-B-L-K-E-M-G-O-@-N-C-H-I-_-o-n-m-S-T-P-Q-R-V-U-^#c-#.-23^V~S.+h/[.H]^ag#&/8BJy?CAW#%)(,_O>oOVY\^oqty{;FJ`[_q6|.24Iume(),4~u!vH]:vw;Bq~@Tpw(fw?ABIP4MxFH\gl"-9dtw}37GKHSWmy+6;N]a>BHJLOYzZzlnw524YTmnQ{Ol`{$:CNSk)?IK|\'X}jpux7U&(*1>~?*-K`"#$$.%&.'%.&.()*,/0'.145789:<(.;=>).*.?+.,.@BC../.D0.E1.-.A2.3.GHIJ4.KL5.M6.7.NPQR9.STU:.O!.WX;.<.=.YZ>.[\]?.@.B.A.C._`abcdefgijkD.lmnhoqrstuE.xG.z{|H.}F.vK.J.!L.#$M.N.O.Q.R.&(t)*,T.-.0U.V.W.X.Y.34Z.56\.].7^.9_.:~/`.;<>=a.@BCDEFb.Gd.e.If.g.i.Kj.k.l.LMm.NOPQo.p.TUVq.r.s.Wt.XZ[_`bcu.~Oev.fhw.dijy.kz.{.|.lmn}.x.o~.p!/qrstuv"/xyz{#/|}~$/%/&/!"$%'/(/'()+)/,*/-+/.-/345./6079;>0/1/?<@A2/CDEF3/'tGH5/I7/8/9/4/KLM:/NO;/P/S?/@/TUVWXA/ZC/[]D/E/F/_`abdeG/fghH/iI/mJ/noplM/N/O/sP/qvQ/wR/xS/T/z{|U/}V/~!"#$&'X/Y/([/\/)*+,-./]/_/0134b/a/c/d/e/5f/6789:g/;<=@BEi/Fj/HIJk/l/Km/LMn/NOo/p/PQRSTz~XYq/Zr/[\]^s/t/u/_v/w/`ax/bcdy/efghiz/jklmonpqrs|/}/utUOvwVOxyzWO{|}XO!"$&'YOZO*+-[O\O]O.^O/{~1`O23456dO9<=eOfOABgOCDhOFGiOIjOkOlOmOLpOMOPQRqONSTUsOtOvOuOWXwOZxO]_`abyOzO{Ocde|Og}Ohijk(tmnpr)ts*tuvwxz+t,t|}~!|~#$%&-t'(/t)*0t,1t2t3t-./4t15t6t7t8t9t:t2;tt4?t5@t6At78BtCtDtEt9:?@GtHtAItBCDEJtKtGLtHIMtNtOtKLMNQtRtOQRSTStTtUtUVVtWXYWtZ[\]Xt^YtZt[t_abcd]tfghijkl`t_tnopqsbttuctdtvwxyetftz{}gt~|ht!"it#jtkt%<'(mt+,nt-./ot013pt6qt7:8;=>?@rtABstCttu%&'(?u@uAu)*Bu+,-Du/0Eu1Fu3GuHuJuKu5Lu7u789Mu;OuQuRu>?@APuEFSuTuHUuVuWuLMXuZuNOP[uQRSTYu\u]uKX_uY`uZau\]^_`ab^ucdbufgcuduhijklnopqfugurshutuz{iu|}ju~!"#ku$lumunu%vou&'pusu+tu-quuuvuwuxu./012yu356{u7|u89:;<}u=>"vD#v$vEFGI%v&vJ'vK(vLMAOPQ*v+vR,vSTV-vW.v/vX0v1vUZ[3v\^4v5v6v_`7vbcdfegh8v9vklmnoqrstvvx?v@vyAvzBvCvDv{|Ev}~Fv!GvHv"$%&'(JvKvLv)*+,-Mv.Nv/0OvPv12356Qv7RvO8TvUv9VvWv:<=>XvYvSv?@[vA\vCDE]vF^vGH_vZvJavKbvLMNcvPdveevQfvgvRSThvUVWjvkvlvXYZmv[nvaovbcpvdqvfghirvsvtvuvjklvv]noprxvmsyvtuvwxyz{|zv{v}!"|v}v#$~v%!w&"w')*+,-#w.$w/&w'w(w(01)w34*w5+w6,w-w79.w/w0w1w:2w;8=3w>4w?A5w6w<7wBC8wDEF:w;w9wHIwNOPQR?wSBwU@wAwCwVWXYDwZ[\Ew]^_bFwGwcHw`fghIwJwiKwejklmnoLwNwOwMwPwqQwrRwSwtsTwVwuWwvXwYwy[w\w]wxz{|}~!_w^w`w#$%&awbw'cw*+,-/0dwew124567gw8hw:;<=iwjw>@CDkwEFGHmwnwKLMJNpwOqwQRTUVWrwXYZ[sw\]^twuwvw_ww`xwabcdefywgzw{w|wh}wi~wjlm!x"xk#x$xn&x'x(x)x*x+x,x-xoprs.x/x0x1xtuq2xv3x4x5xwxy6x7xz8x=x|}9x~:x;x!"x?x@x$%Ax&('BxCxDx)*Ex+-,/FxGxHx123Ix6789:;<=Jx?>Kx@ABCELxGIJKLMNxNOPQROxSTUVWPxQxXZRx[^SxTxYUx_`Vxb}~cWxeXxdhYxjZxk[x\x]xm^x_x`xnaxobxcxqpdxrsextfxgxvhxixjxkxxylxmxnx{ox|}px~qxrxsxtx%uxvx&wx')xx*+yxzx./012{x34|x5678:;<>?@ABCD}x!yE"y#y$yF%yG&yIJLMNK*y(yOPQRSTU+yV,y.yWXYZ-y\]/y_0y^1y2y`5y6yabc:yef>yghiByjklCymDynopEyFyqrHysIyJyKyLyxyz{|~!Ny"#$%&Oy'()*Py+,-Ry./Sy01Uy4Vy568Wy9:;Xy?'z@AC(z)zDEFGH*z+z,zIJ-zKLM0zQ1z2zRSTU/zVW4z5z6z~~XYZ[\7z8z^_`cbdef9zgjlmnopqs;zvz{?z@z|}AzBz~!Cz"$#%&Ez'(Fz)*GzHzIz+,-./012346Jz7Kz8Lz9Mz<=;@NzACDE?GOzPzQzRzISzKMNPQTzRSUzVzTWzUWY[\^`abdefighkmoq[zr\zvxyz{^z|_z`zaz}~bzcz!"dz#$ezfzgzhz%&'izjzkzlz()*,-nzoz.pz/qz0rzsz+tz1mzJuz3vz6wz78xz9:yzzz{z|z}z;~z"{?#{@${%{&{ABCEF({GHIJKLM){O*{+{PQRS,{V-{W.{/{0{X1{2{Z[\U^_`abcdef5{6{ghi7{4{jokpq8{rst9{l<{vwxyz={>{{|}?{;{@{#$%&A{B{'()*+C{,E{-F{G{H{.D{J{/012K{L{457h/9:M{N{P{R{;S{<=>?@AT{BCDFGU{HIJKLMNV{W{X{PQY{RSTUVWXYZ[\]^_`aZ{bc[{\{ghijf]{^{_{mopa{rtuvwxb{yqz{c{d{|e{}f{g{~!"#%&'(+-h{.i{/012j{k{536789m{;p{q{r{n{s{t{u{=v{w{?@ADEFGx{HIJz{KL{{MOP|{QRT}{U~{W!|X"|YZ#|[$|\%|&|'|(|^)|]_`*|a+|,|-|bedfghij1|l2|3|m4|nopqrst5|uvx{|6|}~!7|"#$'&(*+-,.9|01:|;|<|34>|?|5678@|:;A|B|C|<=@A>CDD|EFE|GJKF|LMNOPQG|H|RSTUVWXJ|Z[]L|_`aM|bN|O|cdP|egR|hS|jlmopqrsT|U|V|tuvwW|xX|y{|}"Z|#$[|\|]|^|&_|(`|)a|*b|c|d|+e|-f|g|.3h|1i|045267k|l|m|89:n|o|p|q|r|s|;<=t|>?u|@Av|BCDEw|FGx|Hy|Iz|JK{|LM||N~|!}Q"}R#}}|S$}T%}UVX&}'}(})}*}Y+}Z[\,}]^_`abcd-}ghi.}jklmnopstu/}v0}1}wx2}yz3}{|"#$4}%5}&}'()6}7}8}*+.9}:};}/01<}=}>}2?}3489:@};5A}B}@C}ABD}E}CD?&~?@ACD'~EFGHI(~JKMNO)~PQRSTWXZ[\^_`abcdefgh*~ijk+~lmnopqrstuwxy,~-~z{|}~.~/~0~!"1~#2~$3~4~%'5~)+6~7~-8~./09~2345:~;~6<~789:;=~@@~ABB~CDC~ED~FGA~E~F~G~H~HI~IJMNOJ~PK~RSL~TUVXWQ\M~ZN~O~^_`abcP~defhijQ~knoR~S~T~qrsltuU~V~vwxyz{|}W~~!"$#&'(X~Y~,.Z~[~/\~01]~34^~678_~9:`~;a~<=c~?@d~A>b~BCDEe~FGHIg~JMh~LNi~OPQRj~TUVk~l~Wm~n~o~p~Yq~r~[\]^_as~bcdet~fghijklu~moqstuv~w~x~y~;v.tNuO{Iv$~]}K/W/rOyzuZwow#=#0"/"1"groupdict([default=None]) -> dict. Return a dictionary containing all the named subgroups of the match, keyed by the subgroup name. The default argument is used for groups that did not participate in the matchdecompress(data, max_length) -- Return a string containing the decompressed version of the data. After calling this function, some of the input data may still be stored in internal buffers for later processing. Call the flush() method to clear these buffers. If the max_length parameter is specified then the return value will be no longer than max_length. Unconsumed input data will be stored in the unconsumed_tail attribute.#09 #( A\"9 $; !& & shutdown(flag) Shut down the reading side of the socket (flag == SHUT_RD), the writing side of the socket (flag == SHUT_WR), or both ends (flag == SHUT_RDWR).)%,e E`"#  X<(<-!MQn-!R?+:+u:+:+;+<-8--;8'-1B1$؇#L +43stat_float_times([newval]) -> oldval Determine whether os.[lf]stat represents time stamps as float objects. If newval is True, future calls to stat() return floats, if it is False, future calls return ints. If newval is omitted, return the current setting. write(s) -> len Writes the string s into the SSL object. Returns the number of bytes written.B.reverse() -> None Reverse the order of the values in B in place.@@htonl(integer) -> integer Convert a 32-bit integer from host to network byte order.< E $v-w8x~)$9arguments 1-3 must be sequencesfiledescriptor out of range in select()too many file descriptors in select()selecttimeout must be a float or Nonetimeout period too longn = %d selectselectselect.errorerrorget_data(pathname) -> string with file data. Return the data associated with 'pathname'. Raise IOError if the file wasn't found.read1(size) -> read at most size bytes, returned as a string. If the size argument is negative or omitted, read until EOF is reached. Return an empty string at EOF.xM9 $ G2 JI~M9 , 0 $   !"#T%&'()*+,-./1M9#M9FM9M9M9M9M9M9M9M9M9M96M9M9%&'()M9M9M9M9M9M9+M9M9*M9-.1/N9A2N93 N9N945N978!9:";<0 =>B@ ? HRMPCDEN9KLNOQSN9#c/pidgetvalue([use_pos]) -- Get the string value. If use_pos is specified and is a true value, then the string returned will include only the text up to the current file position.  12345679:;<=>?@ABDEFGHJKLMNFlush write buffers, if applicable. This is not implemented for read-only and non-blocking streams. d+%4 'k+%m |/r+% @7+% '+% d7+%Q 4+%d <#module(name[, doc]) Create a module object. The name must be a string; the optional doc argument can have any type.any(iterable) -> bool Return True if bool(x) is True for any x in the iterable. If the iterable is empty, return False.disable() Stop collecting profiling information. allocate_lock() -> lock object (allocate() is an obsolete synonym) Create a new lock object. See help(LockType) for information about locks.@@ENTITIES?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDD.count(value) -> integer -- return number of occurrences of valueget_code(fullname) -> code object. Return the code object for the specified module. Raise ZipImportError if the module couldn't be found.{PCDATASS:bdiffiiiis#s#:bdiffbdiff inputs too largeSb:fixwsbdiffcalculate a binary diff blocksfind a list of matching lines fixwsnormalize diff whitespaces bdiffy7y7z7 z7Az7Jz7*% /dev/cputimesetsid() Call the system call setsid().geteuid() -> euid Return the current process's effective user id.?42j?4?4>v?4 cs dGHdS(sHello world...N((((shello.pys?sisatty() -> False. Always returns False since BytesIO objects are not connected to a tty-like device.F)/standaloneV   ../Objects/iterobject.cGC object already tracked__length_hint__iteratorGC object already trackedcallable-iteratordisplayhook(object) -> None Print an object to sys.stdout and also save it in __builtin__._ "g""g""^j "log1p(x) Return the natural logarithm of 1+x (base e). The result is computed in a way which is accurate for x near zero.&ELEMENTgetnameinfo(sockaddr, flags) --> (host, port) Get host and port for a sockaddr.6,L"EȚ6"!TW8 LCreate a mapping from a string name to a dialect class. dialect = csv.register_dialect(name, dialect) tell() -- get the current position.tmpnam() -> string Return a unique name for a temporary file.e6e6 e6e6e6,e6/e6 str Return n random bytes suitable for cryptographic use.plan9get_objects() -> [...] Return a list of objects tracked by the collector (excluding the list returned). This module provides primitive operations to write multi-threaded programs. The 'threading' module provides a more convenient interface.r$1{$1$10S6S6split(s [,sep [,maxsplit]]) -> list of strings splitfields(s [,sep [,maxsplit]]) -> list of strings Return a list of the words in the string s, using sep as the delimiter string. If maxsplit is nonzero, splits into at most maxsplit words. If sep is not specified, any whitespace string is a separator. Maxsplit defaults to 0. (split and splitfields are synonymous)S6S6ftruncate(fd, length) Truncate a file to a specified length.register(search_function) Register a codec search function. Search functions are expected to take one argument, the encoding name in all lower case letters, and return a tuple of functions (encoder, decoder, stream_reader, stream_writer) (or a CodecInfo object). x in the interval [0, 1).seedseed([n]) -> None. Defaults to current time.getstategetstate() -> tuple containing the current state.setstatesetstate(state) -> None. Restores generator state.jumpaheadjumpahead(int) -> None. Create new state from existing state and integer.getrandbitsgetrandbits(k) -> x. Generates a long int with k random bits._random.Random_randomRandomO]6V]6_]6xb4bWeBJbecb fsph`bfHbgibgIbgl (sysname, nodename, release, version, machine) Return a tuple identifying the current operating system.0123456789abcdef0123456789ABCDEFgetprotobyname(name) -> integer Return the protocol number for the named protocol. (Rarely used.)combinations(iterable, r) --> combinations object Return successive r-length combinations of elements in the iterable. combinations(range(4), 3) --> (0,1,2), (0,1,3), (0,2,3), (1,2,3) bool. Returns True if the IO object can be seeked.WRKiAǞ)˞)_multibytecodec__create_codecencoding name must be a string.no such codec is supported.multibytecodec.__map_*getcodecmultibytecodec.__map_*multibytecodec.__map_*map data must be a Capsule.multibytecodec.__map_*_codecs_kr__map_cp949_codecs_kr__map_ksx1001_codecs_jp__map_jisxcommon_codecs_jp__map_jisx0208_codecs_jp__map_jisxcommon_codecs_jp__map_jisx0212_codecs_jp__map_jisx0213_bmp_codecs_jp__map_jisx0213_1_bmp_codecs_jp__map_jisx0213_2_bmp_codecs_jp__map_jisx0213_emp_codecs_jp__map_jisx0213_1_emp_codecs_jp__map_jisx0213_2_emp_codecs_jp__map_jisx0213_pair_codecs_cn__map_gbcommon_codecs_cn__map_gb2312iso2022_kriso2022_jpiso2022_jp_1iso2022_jp_2iso2022_jp_2004iso2022_jp_3iso2022_jp_ext_codecs_iso2022 csv_reader = reader(iterable [, dialect='excel'] [optional keyword args]) for row in csv_reader: process(row) The "iterable" argument can be any object that returns a line of input for each iteration, such as a file object or a list. The optional "dialect" parameter is discussed below. The function also accepts optional keyword arguments which override settings provided by the dialect. The returned object is an iterator. Each iteration returns a row of the CSV file (which can span multiple input lines): s!z!!;SG.^\N]eg^ggXa dAegj`shh    !"# $_##\##@$\#$$%erfc(x) Complementary error function at x.DOCTYPE~"l;~"~"43~"l"~"޲H#000 000@>?00000N0000  \0 \& %      00;=[]0 0 0 0 0 00000 "`"f"g""4"B&@&2 3 ! &&%%%%%%%%%%%; 0!!!!0" """""*")"'"("!!"" ""#""a"R"j"k""=""5"+","+!0 o&m&j& ! %!"#$%&'()*+,-./0123456789:ABCDEFGHIJKLMNOPQRSTUVWXYZA0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 !"#$%&'()*+,-./012345Q6789:;<=>?@ABCDEFGHIJKLMNO%% %%%%%,%$%4%<%%%%%%%#%3%+%;%K% %/%(%7%?%%0%%%8%B%NUZ?Ta(cY"uPz`c%nefh'Weqb[Y{b}}b|[^ cfHhǕOgN OMOOIPV7YYZ \`apafipOupuy}}ÀcUz;SNNWxNXn82z(/AQpSTTVY_m-bp TS[poS\zNx&nVUk;YSfmtBVNKO SU0[q_ ffh8ll)m[tvNz4[`풲muvř`iSQW0XDY[^(`cclopqYqq?s~vт`[iXeZl%uQ.YeY__be*j'kksV,Ğ\l{QK\aƁvharYNOxSi`)nOz NSNUO=OOsORS VYZ[[yfggLklkpsyykSkWl"ooEotuv wz{!|}6f̊Qeӗ(8N+T\]sLvT/Z__`hjZtxw^NɛN|OOPPIQlQRRRSSTTUQWW}YT[][[]]]x^^^^_R`Labbc;efCffmg!hhi_l*mim/nn2uvlx?z|}}^}}T*RLaʐuq?xMؚ;[RRSTXboj_KQ;RJTV@zw`ҞDs opu_`rdkNVdWXZZh`aff9hhmu:}nBNPOSUo]]]glstxP߈PW^+cPPQgT^XY[i_Mbc=hskn}pǑrx&xmye0}܃ dR(WPgjQBW*:XiT]Wx\OJRT>d(fggzV{"}/\h9{SQ7R[bdd-gkіv֛LcvRf NPSq\`dce_hqs#u{~یxefkNN:OO:RSSUVXYYYP[M\^+^_`c/e\[eeegbk{klEsIyy|}+}󁖉^ifnj܌̖okNrtux:y 3ꁔPl_X+z[NSW1YZ[`nouꌟ[{rPga\J~Q\hcfenq>y}ʎndžPR:\Sg|p5rLȑ+[1_`;NS[Kb1gkrs.zkRQSjT[c9j}VShT[1\]Oab2myyB}M~Frt/1KlƖNOOEQAS_bgAl ncs&~͑SY[m]y.~|~XqQSO\%fwzQ_eoikmndov}]uQR@bffn^}rfRSsY^_U`dPQR SGSSTFU1UVhYY~ d_xRbcBdb-z{v} INHQCS`S[\\]&bGbdh4hlEmmg\oNq}qez{}J~z9nΌxwMRU8o6qhQyU~|LVQX\cffZiruuyVyy| }D}4;a PuRSS PUXOY=r[d\S``\cc?ccdef]iioqNuvz|}}aIXlňpmPXaӁ5 OtPGRsSo`Ic_g,nO^\ʌe}RSvQcX[k[ \ dQg\NY*YplQ>UXY`Sbg5Ui@ę(SOX[\/^_ `Ka4bfln΀Ԃ.۞ۛNS'Y,{Ln'pSSDU[Xbbblo"t8o8QSSFOTjY1]zh7rH=j9NXSVfWbceNkm[npwz{}=ƀˆ[VX>_efjk7uNJ$Pw0W_e`zf`luznE{\uzQ{Ąyz6Z@w-NN[_bm6t4xFZuO^bcWeogvLr̀)M PWZhsidqrXjyw)/OeRZSbgl}v{|6f or~Q{rx{H{ja^Qu`ukQbnzvOpbO{zVYX䆼4O$RJSSS^,deg>lNlHrrsTuA~,酩{Ƒiq=cifjuvxC*SQS&TY^|_`Ibybbekluvxy}w^ۘ j8|P>\_gk5t w;gz9Suf_񃘀<__buF{ee gllp2x+~ހ *JҒlONNPVRJWY=^__?bfgghQ!}~2 T,SP\SXd4ggrfwFzRlkXL^TY,gQvidxTWY'fgkTiU^ggR]hNOSb+glďOm~Nban+osT*gE]{\[JnфzY|l wR"Y!q_rw'a iZZQ T}TfvY]rnMQh}}bxd!jY_[ksv}2Q(gٞvbgR$\;b~|OU` }S_NQY:r6Α%_wSy_}3VgS aalRv8/UQO*QRS[}^`ac gggnm6s7s1uPyՈJĖYNYON?P|^Y[^ccdfJii mnq(uzIɄ! e} ~ab2kltmmeg<ma}=jqNuSP]koͅ-)RTe\Nghttuψ̑x_szNceuRAmn tYukx|zOnae\NNP!NQ[ehmsBvwz|oҊ|ϑuR}+PSgmq3t*W`tAXm/}^N6OOQR]`s|}o#,BTojpŒ2RAZ^_g|iijmobrr{~KΐmQy2֊-PTqjkČ`gNNkhi~nxU _NN*N1N6NYzUYPYNYZYXYbY`YgYlYiYxYYY^OOYYYYYYYY%ZZZZ ZZ@ZlZIZ5Z6ZbZjZZZZZZZZZZZZZZ [ [[2[Z*[6[>[C[E[@[Q[U[Z[[[e[i[p[s[u[x[ez[[[[[[[[[[[[[[[[[[[\\\ \\ \"\(\8\9\A\F\N\S\P\O\q[l\n\bNv\y\\\\Y\\\\\\\\\\\\\]\ ]]]\]]]]]"]]]]L]R]N]K]l]s]v]]]]]]]]]]]]]]]]]]]]] ^^^^^6^7^D^C^@^N^W^T^_^b^d^G^u^v^z^^^^^^^^^^^^^^^^^^^^^^^^_ _]_\_ ___)_-_8_A_H_L_N_/_Q_V_W_Y_a_m_s_w_____________________`_!`````)``1```+`&``:`Z`A`j`w`_`J`F`M`c`C`d`B`l`k`Y``````````````````_````Maaa``a``a!a`` aaGa>a(a'aJa?acMcdOcccccvcccccckciccccccccccd4ddd&d6ded(ddgdodvdNd*eddddddddddddddd ddbdd,eddddedeee$e#e+e4e5e7e6e8eKuHeVeUeMeXe^e]erexeeeeeeeeeeeeeeeeeerg ffesg5f6f4ffOfDfIfAf^f]fdfgfhf_fbfpffffffffffffffffff?ffffffggg&g'g8.g?g6gAg8g7gFg^g`gYgcgdggpgg|gjggggggggggggggggggggggjhFh)h@hMh2hNhh+hYhchwhhhhhhhhhjhthhhhih~hihih"i&ih ihhhh6iiihh%ihhh(i*ii#i!ihyiwi\ixikiTi~ini9iti=iYi0iai^i]iijiiiiiiiii[iiiii.jiiiiiiijji kiiijijiji jjj#jjDj jrj6jxjGjbjYjfjHj8j"jjjjjjjjjjjjjjjjjjjjjkjkk1k8k7kv9kGkCkIkPkYkTk[k_kakxkykkkkkkkkkkkkkkkkkkkkkkkkkkllll$l#l^lUlbljllllll~lhlsllllllllllllllllllmM6m+m=m8mm5m3mm mcmmdmZmymYmmmommn nmmmmmmmmmmmmmmmmm-nnn.nnrn_n>n#nkn+nvnMnnCn:nNn$nnn8nnnnnnnnnnnnnnnnnAooLpnnn?on1on2on>oonozoxooooo[oomoo|oXoooofoooooooooooooooo p popppopptoppp0p>p2pQpcppppppppppppp qpqqeqUqqfqbqLqVqlqqqqqqqqqqqqqqqqqqqqq rrr(r-r,r0r2r;rsNsOs؞Wsjshspsxsus{szsssssssssttot%ts2t:tUt?t_tYtAt\titptctjtvt~tttttttsttttttttttuuu uu uuuu&u,uz7zCzWzIzazbzizpzyz}zzzzzzzzzzzzzzzzzzzzzzzzzzz{{ {{3{{{{5{({6{P{z{{M{ {L{E{u{e{t{g{p{q{l{n{{{{{{{{{{]{{{{{{{{{{||{{`||||{{| |{#|'|*||7|+|=|L|C|T|O|@|P|X|_|d|V|e|l|u||||||||||||||||||||||;|||||}}}} }E}K}.}2}?}5}F}s}V}N}r}h}n}O}c}}}[}}}}}}}}}}}}=~}}}}}}}}}}}}}~ ~#~!~~1~~ ~ ~"~F~f~;~5~9~C~7~2~:~g~]~V~^~Y~Z~y~j~i~|~{~~}}~~~~~~~~~~~~~8:ELMNPQUTX_`higxqܘ !(?;JFRXZ_bhsrpvy}Qۀـ݀Āڀր )#/KF>SQqneft_Ɂ́сف؁ȁځ߁ )+83@YX]Z_dbhjk.qwx~߂҂ނ܂ ق5421@9PE/+#|su΃؃  " 8m*(ALONIV[Zk_lot}:A?HLNPUblxz|bȌڌ  N͌gmqsύڍ֍̍ۍˍߍ B504JGILPHYd`*cUvr|ƎŎȎˎێ  &3;9EB>LIFNW\bcdڏ!  '659OPQRI>VX^hovr}Hbې20JVXceisrɑˑБ֑ߑۑ,^WEIdH?KPZϒD."#:5;\`|nV֓דؓÓݓГȓ6+5!:ARD[`b^j)puw}Z|~ʕoÕ͕̕Օԕ֕ܕ!(./BLOKw\^]_frlΖ˖ɖ͖Mܖ Ֆ$*09=>DFHBI\`dfhRkqy|z×Ɨȗ˗ܗOz 8$!7=FOKkopqtsĘØƘ !$ ,.=>BIEPKQRLUߙۙݙؙљ+7EB@C>UM[W_bedikjϚњӚԚޚߚ"#%'()*./2DCOMNQXtʛƛϛћқԛ:   .%$!0G2F>Z`gvx *&#DA?>FH]^dQPYrozĝƝϝٝӝuy}a̞ΞϞОԞܞޞݞv!,>JRTc_`afgljwrv/XiYdtQq!rconnect %s!%d%s %dconnect %s!%d%sUD.%d.%dget_referrers(*objs) -> list Return the list of objects that directly refer to any of objs.cܥL@N11KOV11O  & .>globals() -> dictionary Return the dictionary containing the current scope's global variables.close() Close the socket. It cannot be used after this call.9B.?of/:47(tf/ND3yf/0f/'f/@48f/`#f/i<f/8f/cf/f/uf/f/ x/f/!$;f/f/g/S,; g/sX9g/@ oAThe bz2 python module was written by: Gustavo Niemeyer )) ))crc32(string[, start]) -- Compute a CRC-32 checksum of string. An optional starting value can be specified. The returned checksum is a signed integer.s_push: parser stack overflow printfrom__future__with_statementprint_functionunicode_literalsimport_stmtimport_stmtrrATTLISTdecimal(unichr[, default]) Returns the decimal value assigned to the Unicode character unichr as integer. If no such value is defined, default is returned, or, if not given, ValueError is raised.)))S.rsplit([sep [,maxsplit]]) -> list of strings Return a list of the words in S, using sep as the delimiter string, starting at the end of the string and working to the front. If maxsplit is given, at most maxsplit splits are done. If sep is not specified, any whitespace string is a separator.chown(path, uid, gid) Change the owner and group id of path to the numeric uid and gid.Objects that know how to unpickle0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-dir([object]) -> list of strings If called without an argument, return the names in the current scope. Else, return an alphabetized list of names comprising (some of) the attributes of the given object, and of attributes reachable from it. If the object supplies a method named __dir__, it will be used; otherwise the default dir() logic is used and returns: for a module object: the module's attributes. for a class object: its attributes, and recursively the attributes of its bases. for any other object: its attributes, its class's attributes, and recursively the attributes of its class's base classes.Change stream position. Change the stream position to the given byte offset. The offset is interpreted relative to the position indicated by whence. Values for whence are: * 0 -- start of stream (the default); offset should be zero or positive * 1 -- current stream position; offset may be negative * 2 -- end of stream; offset is usually negative Return the new absolute position./-Implementation module for socket operations. See the socket module for documentation.  a 23  '1o1D 41D 23D 4AAAAAA C'EEEEIIIINOOOOOUUUUYaaaaaa c'eeeeiiiinooooouuuuyyAaAaA(a(CcCcCcC c D d EeEeEeE(e(E e GgGgGgG'g'HhIiIiIiI(i(IIJijJjK'k'LlL'l'L l LlNnN'n'N n nOoOoO o RrR'r'R r SsSsS's'S s T't'T t UuUuUuU u U u U(u(WwYyYZzZzZ z sOoUuD}D~d~LJLjljNJNjnjA a I i O o U u   &'G g K k O(o(  j DZDzdzGgNnAaAaEeEeIiIiOoOoRrRrUuUuS&s&T&t&H h AaE'e'Oo./Yyhfjry{wy    (  clsx E; #8553V:8Ctu60056788>-M#C#C# C 'G+Ke'S'THT'UJT'tHttJtTTT( < 0 < 3 <  <  <  <  < ! < " < + < / <      2 < 8 <  <  <  < + < G V G > G W ! < " <     F V      F > G > F W     M2 BLQV[@qrqtq%.55 5 5 55:5<5>5?5B5ABDEGHIJKLMNO"PRTUWaPQbdeY[\gkmKoTptuov%iruv=RcU\f_aehij{mqprstuxzA%a%BbB#b#B1b1DdD#d#D1d1D'd'D-d-E-e-E0e0()FfGgHhH#h#HhH'h'H.h.I0i0KkK#k#K1k1L#l#67L1l1L-l-MmMmM#m#NnN#n#N1n1N-n-LMLMPpPpRrR#r#Z[R1r1SsS#s#Z[`abcTtT#t#T1t1T-t-U$u$U0u0U-u-hijkVvV#v#WwWwWwWwW#w#XxXxYyZzZ#z#Z1z1h1tw y aA#a#A a     E#e#E e Ee  I i I#i#O#o#O o     ##U#u#U u   ##YyY#y#Y y YyBB  B B ! ! B!B()()(B)B01010B1B89898B9B@A@AHIHIPQPQPBQBYYYB`a`a`BaBhihihBiBEEEEEEEEE E E E E EEE E!E"E#E$E%E&E'E(E)E*E+E,E-E.E/E`EaEbEcEdEeEfEgEhEiEjEkElEmEnEoEpEEEBEE   BBtEEEBEEBBBBBB`|EEEBEE              3...... 2 2 2 2 2 5 5 5 5 5 !! ???!!?2 2 2 2  0i456789+"=()n0123456789+"=()aeoxYRsa/ca/sCCc/oc/uFgHHHh'IILlNNoPQRRRSMTELTMZZKBCeEFMoiFAX"Ddeij1D 71D 91D 101D 32D 31D 52D 53D 54D 51D 65D 61D 83D 85D 87D 81D IIIIIIIVVVIVIIVIIIIXXXIXIILCDMiiiiiiivvviviiviiiixxxixiilcdm0D 3!8!8!8!8!8!8"8"8 "8#"8%"8+"+"+"+"+"."."."."."<"8C"8E"8H"8=8a"8M"8<8>8d"8e"8r"8s"8v"8w"8z"8{"8"8"8"8"8"8"8"8"8|"8}"8"8"8"8"8"8"80 01234567891011121314151617181920(1)(2)(3)(4)(5)(6)(7)(8)(9)(10)(11)(12)(13)(14)(15)(16)(17)(18)(19)(20)1.2.3.4.5.6.7.8.9.10.11.12.13.14.15.16.17.18.19.20.(a)(b)(c)(d)(e)(f)(g)(h)(i)(j)(k)(l)(m)(n)(o)(p)(q)(r)(s)(t)(u)(v)(w)(x)(y)(z)ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0+"+"+"+"::======*8jVa-kN(N6N?NYNNNNN?QeQkQQQQQQRRRSS8SAS\SiSSSSSVWXY YY'YsYP[[[\"\8\n\q\]]]]r^z^^^^ __P_a_s__b6bKb/e4eeeeeeefg(g kbkykkkkkll4lkp*r6r;r?rGrYr[rrssttuu(u0uuuvv}vvvvwww:yyytzzzs||6Q 3 nrxMk@Lc~҉7FUxdpʎIƑ̑ёwQ^bi˗ۘߘؚߚ%/2<ZuÞ͞ў ;JR 0ASDSESK00M00O00Q00S00U00W00Y00[00]00_00a00d00f00h00o00o00r00r00u00u00x00x00{00{00F00 0 000 0000000000000000000000000000000000000000000000000000000000000000 00!     abcdefghijklmnopqrstu` "#')+,-./26@GLWXYNN NV N-N N2uYNNN)Y0WN()()()()()()( )( )( )()()()()()(a)(a)(a)(a)(a)(a)( a)( a)( a)(a)(a)(a)(a)(a)( n)( i e)( in)(N)(N)( N)(V)(N)(mQ)(N)(kQ)(]N)(AS)(g)(kp)(4l)((g)(ё)(W)(e)(*h)( g)(>y)( T)(yr)()(]y)(R)(N)(|T)(f[)(v)(O)(nj)(TS)(my)(O)()()OU|^e{ PTE212223242526272829303132333435   aaaaaa a a aaaaaaai n t nNN NVNmQNkQ]NASgkp4l(gёWe*h g>y Tyr]yRy7usYi*QpSlOQck N-N N]S;S[f[vOnjTSY3637383940414243444546474849501g2g3g4g5g6g7g8g9g10g11g12g Hg erg eV LTD00000000000000000000000000000000000000000000000 0000 0000 0000 000 0000 000 000 00000 0000 000 000 000 0000 0000 000 000 00 000 0000 0000 00 00000 000000 00000 000 00000 00000 0000 000 000 000 0000 00000 0000 000 000 000 00 00 00 00 000 000 00000 000 0000 00000 000 00 00 00000 0000 00000 000 00000 00 000 000 000 000 000 0000 000 00 000 000 000 0000 000 000 000 00000 0000 00 00000 00 0000 0000 000 000 000 0000 00 000 0000 00 00000 0000p1p2p3p4p5p6p7p8p9p10p11p12p13p14p15p16p17p18p19p20p21p22p23p24p hPa da AU bar oV pc dm dm dm IU s^b -fT 'Yck fl *h_O>y pA nA A mA kA KB MB GB cal kcal pF nF F g mg kg Hz kHz MHz GHz THz ! m! d! k! fm nm m mm cm km mm cm m km mm cm m km m"s m"s Pa kPa MPa GPa rad rad"s rad"s ps ns s ms pV nV V mV kV MV pW nW W mW kW MW k M a.m. Bq cc cd C"kg Co. dB Gy ha HP in KK KM kt lm ln log lx mb mil mol PH p.m. PPM PR sr Sv Wb V"m A"m1e2e3e4e5e6e7e8e9e10e11e12e13e14e15e16e17e18e19e20e21e22e23e24e25e26e27e28e29e30e31e galoHfʎȌn2NSQYёUHYaiv?jmps=jNuSkr-P]oͅdb؁^gjmrΐOQRdjrv\2oxy}Ƀ֊X_`|~brxŒXb\jmo/}7~KRQQz}ubj9N[`spuSxO_ Nlxe"}S^XwIklbceuNiQQh|oҊϑRBTsY^eo*yjΞRfwkbt^abd#oIqty}o&#JRRTpˆ^_{ck>|usNV[]`sitF4HOy`NP[?\ejqBv|f.R{ggAmn tYukx}^mQ.bx+P]m*_Dahs)RTe\fNghltuyψ̑?SnTqtWgmz {|rpXN6:RR^b|[mf;LM^@QUZXtfQ*svyIyHyPyVy]yyy@zz{} ~A~ryyW9ӌ8;u`B&NQhQOEQQRRUUUUUZXXDYTYbZ([^^i__`Naaa`aa4bcdRdVetfggVgykkAmnn"opnqw5rr*sqtu;uvvvvvJw@wxz{{|[}}>RyAˊ98rv|Vۗ ;J(D(3;@9@IR\~Cfffiflffiffltsttvtetk~vtm+II q q { { {{ ~ ~ ~~    z z zz    y y yy                                                                     w          II &' &' & & &H &H & & & & & & & & & &I &I &I    &, &- &E &I &J (, (- (. (E (I (J *, *- *. *E *I *J +, +E +I +J ,- ,E -, -E ., .- .E 3, 3- 3. 3E 5- 5E 6, 6- 6. 6E 7- 7E 8E 9, 9E :, :E A, A- A. AE AI AJ B- BE BI BJ C' C, C- C. CD CE CI CJ D, D- D. DE DI DJ E, E- E. EE EI EJ F, F- F. FE FI FJ G, GE GI GJ J, J- J. JE JI JJ 0p 1p Ip  LQ  MQ  NQ  OQ  PQ  Qp &1 &2 &E &F &I &J (1 (2 (E (F (I (J *1 *2 *E *F *I *J +1 +2 +E +F +I +J AI AJ BI BJ C' CD CE CI CJ DE DI DJ E' EE F1 F2 FE FF FI FJ Ip J1 J2 JE JF JI JJ &, &- &. &E &G (, (- (. (E (G *, *- *. *E *G +E ,- ,E -, -E ., .E 3, 3- 3. 3E 5- 5. 5E 6, 6- 6. 6E 7- 8E 9, 9E :, :E A, A- A. AE B- BE C, C- C. CD CE D, D- D. DE DG E, E- E. EE F, F- F. FE FG G, GE Gp J, J- J. JE JG&E&G(E(G*E*G+E+G3E3G4E4GCDCEDEFEFGJEJG@NQ@OQ@PQ 7I 7J 9I 9J :I :J 3I 3J 4I 4J -I -J ,I ,J .I .J 5I 5J 6I 6J 4, 4- 4. 4E 41 31 51 61 7I 7J 9I 9J :I :J 3I 3J 4I 4J -I -J ,I ,J .I .J 5I 5J 6I 6J 4, 4- 4. 4E 41 31 51 61 4, 4- 4. 4E 3G 4G 7E3,3-3.4,4-4.7E8E 'K 'K *,E *-, *-, *-E *.E *E, *E- *E. ,E- ,E- -EJ -EI 3-, 3,- 3,I 3E- 3E- 3E, 3EE 3EE 5-- 5-- 5EE 4-E 4-E 4,J 4E. 4E. 4EE 4EE 6-I 6.E 6.E 7E- 7E- 7EE 7EJ 9,E 9EE 9EE 9EI :EE :EJ :EI A.E A.E BE- BEE D-E D-J D-I D,, D,, D.E D.E DE- DE- E-, E-E E-J E,- E,E E., E.E E,. GE, GEE F-E F-I F,E F,E F,I FEJ FEI JEE JEE (.J *,J *,I *.J *.I *EJ *EI ,EJ ,-I ,EI 3.I 5-J 4-J 6-J D,J DEJ J-J J,J JEJ EEJ BEJ F-J BE- D-E 9EJ CEJ F,- E.J D,E CEE D,E F,- ,-J -,J E,J AEJ (-J CEE 9,E 5EE 3.J F,J 5D BD 'DDG 'C(1 E-E/ 5D9E 13HD 9DJG H3DE 5DI 5DI 'DDG 9DJG H3DE ,D ,D'DG 1'D , 0 0 : ; ! ? 0 0 & %   _ _ ( ) { } 0 0 0 0  0  0 0  0  0  0 0 0 [ ]> > > > ___,0.;:?! (){}00#&*+-<>=\$%@  K@K  L  M  N@N  O@O  P@P  Q@Q  R@R ! " " # # $ $ % % & & && ' ' ( ( (( ) ) * * ** + + ++ , , ,, - - -- . . .. / / 0 0 1 1 2 2 3 3 33 4 4 44 5 5 55 6 6 66 7 7 77 8 8 88 9 9 99 : : :: A A AA B B BB C C CC D D DD E E EE F F FF G G GG H H I I J J JJ D" D" D# D# D% D% D' D'!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~))0 0 0000000000000000000000000000000000000000000000000000000000000d1112131415161718191:1;1<1=1>1?1@1A1B1C1D1E1F1G1H1I1J1K1L1M1N1O1P1Q1R1S1T1U1V1W1X1Y1Z1[1\1]1^1_1`1a1b1c1 %!!!!%%WeXe_n_o_p_q_reennooABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefgijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzACDGJKNOPQSTUVWXYZabcdfhijklmnpqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABDEFGJKLMNOPQSTUVWXYabcdefghijklmnopqrstuvwxyzABDEFGIJKLMOSTUVWXYabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz17""""""""""012345678901234567890123456789012345678901234567890.0,1,2,3,4,5,6,7,8,9,(A)(B)(C)(D)(E)(F)(G)(H)(I)(J)(K)(L)(M)(N)(O)(P)(Q)(R)(S)(T)(U)(V)(W)(X)(Y)(Z)0S0CRCDWZ B N P S W HV MV SD SS PPV DJ {0K0 Kb W[ S 0 N Y  )Y N  f !q e MR _ Q e R B} u  X 9T o b Uc N  N J ] -N S c p Sb0,g00 N00N00[00p00Sb00v00R00We0=N8NAN"`OOOPzPPPP4:MQTQdQwQ4gQQKQQNQQߑQR4;RFRrRwR5RRRRSSSISQSZSsS}SSSS, ppSSc SSTT8THThTTTUSUcUUUUUUUWVWQVtVRXWW XW2X1XXXXYY"YbYYZ'ZYfZ66[>[>[[[[[[\S_"\7`\n\\\C]n]k]|]]]/8](^=^i^b8!|8^^^^^1#1#"_"_82ab_k_8____`:99`&`HaLaNaLazaaaaaaaabb]bbbPc +=cbhccc+"dcc.:id~ddwdl:Oele 0efIf;f;:QQgfCgg!g^gSg3I;ggRhhm4hhi;Biiij6j<!k8TkN<rkkkk: :Nl<llglm>mwmAmimxmm=4m/nnn3=nn>mno^??o9ppp=Jp}pwpp%EqcBqC(r5rPrFrr5GHzss>s>>Gt\tqttt?$u6L>uLpu!vOODP?@vPPQ3QwwwJw9@wF@@TNxxx@&VVyVVyy/A@zJzOz|YZZzB[{{'B\|B||}_c}C}~E~4C(bGbYCbz>cd#e`ep_3C D>Zgg33kDR address info Return the address of the remote endpoint. For IP sockets, the address info is a pair (hostaddr, port).*K#2K#;K#DK#KK#RK#[K#A@!  @a`10  @J^" @, %s(...)%s([])%s(...)%s(%s)pop from an empty set__length_hint__Set changed size during iterationsetiteratorGC object already trackedfrozenset()set()can only compare to a setcannot compare sets using cmp()__dict__set()addclear__contains__copydiscarddifferencedifference_updateintersectionintersection_updateisdisjointissubsetissupersetpop__reduce__remove__sizeof__symmetric_differencesymmetric_difference_updateunionupdateset__contains__copydifferenceintersectionisdisjointissubsetissuperset__reduce____sizeof__symmetric_differenceunionfrozenset../Objects/setobject.c../Objects/setobject.c../Objects/setobject.c../Objects/setobject.c../Objects/setobject.c../Objects/setobject.c../Objects/setobject.c../Objects/setobject.c../Objects/setobject.cfabs(x) Return the absolute value of the float x.` +!y!+"w!+*uV"+%~ #+0l#+"r&$+$}$+#x%+*u&+#`&+2d'+"{'+.zN(+!v(+2})+"yB*+5s*+D~6++!s++)z,+%~4-+!~-+!q.+"v integer Return a hash value for the object. Two objects with the same value have the same hash value. The reverse is not necessarily true, but likely.<__missing__(key) # Called by __getitem__ for missing key; pseudo-code: if self.default_factory is None: raise KeyError((key,)) self[key] = value = self.default_factory() return value asctime([tuple]) -> string Convert a time tuple to a string, e.g. 'Sat Jun 06 16:26:11 1998'. When the time tuple is not present, current time as returned by localtime() is used.byteswap() Byteswap all items of the array. If the items in the array are not 1, 2, 4, or 8 bytes in size, RuntimeError is raised. cmp(x, y) -> integer Return negative if xy.getdefaultencoding() -> string Return the current default string encoding used by the Unicode implementation.Binhex RLE-code binary data(3*3'63@3Q333RR33333Qh3ư>XML parser`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O okdoneerrorneedkeybadkeyphasetoosmallerrormalformed rpc response: %srpc too bigauth_rpc short writeunknown rpc type %d (bug in auth_rpc.c)unspecified rpc error%sneedkey %s badkey %sbadkey %sphase error %stoo small %dFunctions to convert between Python values and C structs represented as Python strings. It uses format strings (explained below) as compact descriptions of the lay-out of the C structs and the intended conversion to/from Python values. The optional first format char indicates byte order, size and alignment: @: native order, size & alignment (default) =: native order, std. size & alignment <: little-endian, std. size & alignment >: big-endian, std. size & alignment !: same as > The remaining chars indicate types of args and must match exactly; these can be preceded by a decimal repeat count: x: pad byte (no data); c:char; b:signed byte; B:unsigned byte; ?: _Bool (requires C99; if not available, char is used instead) h:short; H:unsigned short; i:int; I:unsigned int; l:long; L:unsigned long; f:float; d:double. Special cases (preceding decimal count indicates length): s:string (array of char); p: pascal string (with count byte). Special case (only available in native format): P:an integer type that is wide enough to hold a pointer. Special case (not in native mode unless 'long long' in platform C): q:long long; Q:unsigned long long Whitespace between formats is ignored. The variable struct.error is an exception raised on errors. This module provides access to operating system functionality that is standardized by the C Standard and the POSIX standard (a thinly disguised Unix interface). Refer to the library manual and corresponding Unix manual entries for more information on calls. close(fd) Close a file descriptor (for low level IO).htons(integer) -> integer Convert a 16-bit integer from host to network byte order.*p@fwstat(fd, (dir-tuples)) -> None Perform a fwstat system call on the given fd.atanh(x) Return the hyperbolic arc tangent of x.))!tC+D|Dcomplex functionmath domain errormath range errorDcomplex functionmath domain errormath range errorD:phasearg functionD:polarpolar functiondddd:rectrect functionD:isnanD:isnanacosacoshasinasinhatanatanhcoscoshexpisinfisnanloglog10phasepolarrectsinsinhsqrttantanhcmathpieH)% j04q$A<out of memoryout of memory, version %d expected 1expected 0signature parse errordigests did not matchcannot decode cert%.2d%.2d%.2d%.2d%.2d%.2dZclass%d,num%dBOOLEANINTEGERBIT STRINGOCTET STRINGNULLTAGOIDOBJECT_DESEXTERNALREALENUMERATEDEMBEDDED PDVRELATIVE-OIDSEQUENCESETOFUTF8StringNumericStringPrintableStringTeletexStringVideotexStringIA5StringUTCTimeGeneralizedTimeGraphicStringVisibleStringGeneralStringUniversalStringBMPStringUniversal,num%d%s{Bool %dInt %dOctets[%d] %.2x%.2x...BigInt[%d] %.2x%.2x...Real...Other...BitString...NullEOC...ObjId %dString "%s"Seq Set } didn't parse didn't parsedidn't parsebegin X509dump cannot decode certversion %d (0x%x) serial %B issuer %s validity %s %s subject %s pubkey e=%B n(%d)=%B sigalg=%d digest=%.*H nil (meaning ok)sigalg= self-signed verify_signature returns: %s end X509dump close() -> raise GeneratorExit inside generator. $ $ $ $locals() -> dictionary Update and return a dictionary containing the current scope's local variables.tell() -> int. Current file position6,E6r$Lflush(): does nothing.wstat(path, (dir-tuples)) -> None Perform a wstat system call on the given path.Return the digest value as a string of hexadecimal digits.76,EP6r?9Le2pe2 set_wakeup_fd(fd) -> fd Sets the fd to be written to (with '\0') when a signal comes in. A library can use this to wakeup select or poll. The previous fd is returned. The fd must be non-blocking.D.viewkeys() -> a set-like object providing a view on D's keysOO|n:BlockingIOErrorcharacters_writtenBlockingIOErrorException raised when I/O would block on a non-blocking I/O streamfilemodebufferingencodingerrorsnewlineclosefdrO|sizzzi:openinvalid file: %sinvalid mode: '%s'can't use U and writing mode at oncecan't have text and binary mode at oncemust have exactly one of read/write/append modebinary mode doesn't take an encoding argumentbinary mode doesn't take an errors argumentbinary mode doesn't take a newline argumentOsiisattyinvalid buffering sizecan't have unbuffered text I/Ounknown mode: '%s'OiOsssimodecannot fit '%.200s' into an offset-sized integerinteger argument expected, got '%.200s'open_ioosDEFAULT_BUFFER_SIZEs(OO){}UnsupportedOperationUnsupportedOperationBlockingIOError_IOBase_RawIOBase_BufferedIOBase_TextIOBaseFileIOBytesIOStringIOBufferedReaderBufferedWriterBufferedRWPairBufferedRandomTextIOWrapperIncrementalNewlineDecoderclosecloseddecodeencodefilenoflushgetstateisattynewlines readread1readablereadintoreadlineresetseekseekablesetstatetelltruncatewritewritable1s-yUdL#8s-W3__enter__() -> self.H)$:t 8g:E$=>7(4l-'(O?H)yX6=sinh(x) Return the hyperbolic sine of x.This module provides access to the Unicode Character Database which defines character properties for all Unicode characters. The data in this database is based on the UnicodeData.txt file version 5.2.0 which is publically available from ftp://ftp.unicode.org/. The module uses the same names and symbols as defined by the UnicodeData File Format 5.2.0 (see http://www.unicode.org/reports/tr44/tr44-4.html).F<<M<<V<</dev/bintimeS.ljust(width[, fillchar]) -> string Return S left-justified in a string of length width. Padding is done using the specified fill character (default is a space).L);L H)"?->@@@A<A? A3&-<Z<Н)ݝ))<0M0|`8 A simple fast partial StringIO replacement. This module provides a simple useful replacement for the StringIO module that is written in C. It does not provide the full generality of StringIO, but it provides enough for most applications and is especially useful in conjunction with the pickle module. Usage: from cStringIO import StringIO an_output_stream=StringIO() an_output_stream.write(some_stuff) ... value=an_output_stream.getvalue() an_input_stream=StringIO(a_string) spam=an_input_stream.readline() spam=an_input_stream.read(5) an_input_stream.seek(0) # OK, start over spam=an_input_stream.read() # and read it all If someone else wants to provide a more complete implementation, go for it. :-) cStringIO.c,v 1.29 1999/06/15 14:10:27 jim Exp H)G/: .)))@<@<z6,E6r?9LU!_En-`{a^cmp() wrapper for sort with custom keys.B.append(int) -> None Append a single item to the end of B.Returns an independent iterator.{888!!!  !!! &!$-!2!,__doc____module____name__PyClass_New: name must be a stringPyClass_New: dict must be a dictionaryPyClass_New: bases must be a tuplePyClass_New: base must be a class__getattr____setattr____delattr__GC object already tracked../Objects/classobject.c../Objects/classobject.c../Objects/classobject.cnamebasesdictSOOattribute name must be a string__dict__class.__dict__ not accessible in restricted mode__bases____name__class %.50s has no attribute '%.400s'__dict__ must be a dictionary object__bases__ must be a tuple object__bases__ items must be classesa __bases__ item causes an inheritance cycle__name__ must be a string object__name__ must not contain null bytesclasses are read-only in restricted modeattribute name must be a string__dict____bases____name____getattr____setattr____delattr__class %.50s has no attribute '%.400s'__module__?__module__classobj../Objects/classobject.c../Objects/classobject.cGC object already tracked__init__this constructor takes no arguments__init__() should return NoneO!|O:instanceinstance() second arg must be dictionary or None__del__GC object already trackedattribute name must be a string__dict__instance.__dict__ not accessible in restricted mode__class__%.50s instance has no attribute '%.400s'%.50s instance has no attribute '%.400s'attribute name must be a string__dict____dict__ not accessible in restricted mode__dict__ must be set to a dictionary__class____class__ not accessible in restricted mode__class__ must be set to a class__repr____module__?<%s.%s instance at %p>__str____hash____eq____cmp__unhashable instance__hash__() should return an int__len____len__() should return >= 0__len__() should return an int__getitem____delitem____setitem____getitem__n__getslice____getitem__(N)in 3.x, __getslice__ has been removed; use __getitem__(nn)__delitem____setitem__(n)(nO)__delslice____delitem__(N)in 3.x, __delslice__ has been removed; use __delitem__(nn)__setslice____setitem__(NO)in 3.x, __setslice__ has been removed; use __setitem__(nnO)__contains____coerce__coercion should return None or 2-tuple after coercion__coerce__coercion should return None or 2-tuple__neg____pos____abs____or____ror____and____rand____xor____rxor____lshift____rlshift____rshift____rrshift____add____radd____sub____rsub____mul____rmul____div____rdiv____mod____rmod____divmod____rdivmod____floordiv____rfloordiv____truediv____rtruediv____ior____or____ror____ixor____xor____rxor____iand____and____rand____ilshift____lshift____rlshift____irshift____rshift____rrshift____iadd____add____radd____isub____sub____rsub____imul____mul____rmul____idiv____div____rdiv____imod____mod____rmod____ifloordiv____floordiv____rfloordiv____itruediv____truediv____rtruediv____cmp__comparison did not return an int__nonzero____len____nonzero__ should return an int__nonzero__ should return >= 0__index__object cannot be interpreted as an index__invert____trunc____int____trunc__ returned non-Integral (type %.200s)__long____float____oct____hex____pow____rpow____pow____ipow____pow____rpow____ipow____lt____le____eq____ne____gt____ge____iter____getitem____iter__ returned non-iterator of type '%.100s'iteration over non-sequencenextinstance has no next() method__call__%.200s instance has no __call__ method in __call__instanceGC object already trackedim_classthe class associated with a methodim_functhe function (or other callable) implementing a method__func__the function (or other callable) implementing a methodim_selfthe instance to which a method is bound; None for unbound methods__self__the instance to which a method is bound; None for unbound methods__doc____doc__instancemethodinstancemethodfirst argument must be callableunbound methods must have non-NULL im_class??__name____name__?__name__nothing__class__unbound method %s%s must be called with %s instance as first argument (got %s%s instead) instanceinstancemethodS.__format__(format_spec) -> unicode Return a formatted version of S as described by format_spec.!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>strerror(code) -> string Translate an error code to a message string.!.getdefaulttimeout() -> timeout Returns the default timeout in seconds (float) for new socket objects. A value of None indicates that new socket objects have no timeout. When the socket module is first imported, the default is None.H)$ME{#Q,1j  f2 Qv+xwEf2sttrL@ H)~;,Y;[\!A'9r[$43H^ V radians(x) Convert angle x from degrees to radians.T'%o _'%Y n'% x'% 9$@$G$N$U$\$bodybodybodybodylinenocol_offsetnameargsbodydecorator_listnamebasesbodydecorator_listvaluetargetstargetsvaluetargetopvaluedestvaluesnltargetiterbodyorelsetestbodyorelsetestbodyorelsecontext_exproptional_varsbodytypeinsttbackbodyhandlersorelsebodyfinalbodytestmsgnamesmodulenameslevelbodyglobalslocalsnamesvaluelinenocol_offsetopvaluesleftoprightopoperandargsbodytestbodyorelsekeysvalueseltseltgeneratorseltgeneratorskeyvaluegeneratorseltgeneratorsvalueleftopscomparatorsfuncargskeywordsstarargskwargsvaluensvalueattrctxvalueslicectxidctxeltsctxeltsctxlowerupperstepdimsvaluetargetiterifslinenocol_offsettypenamebodyargsvarargkwargdefaultsargvaluenameasname_fields%.400s constructor takes %s%zd positional argument%seither 0 or s__dict__O()OO()__reduce___ast.ASTs(O){sOss}_fields__module___ast_attributesAST identifier must be of type strAST string must be of type str or unicodeinvalid integer value: %.400sinvalid boolean value: %.400s_fields_attributesmodModuleInteractiveExpressionSuitestmtFunctionDefClassDefReturnDeleteAssignAugAssignPrintForWhileIfWithRaiseTryExceptTryFinallyAssertImportImportFromExecGlobalExprPassBreakContinueexprBoolOpBinOpUnaryOpLambdaIfExpDictSetListCompSetCompDictCompGeneratorExpYieldCompareCallReprNumStrAttributeSubscriptNameListTupleexpr_contextLoadStoreDelAugLoadAugStoreParamsliceEllipsisSliceExtSliceIndexboolopAndOroperatorAddSubMultDivModPowLShiftRShiftBitOrBitXorBitAndFloorDivunaryopInvertNotUAddUSubcmpopEqNotEqLtLtEGtGtEIsIsNotInNotIncomprehensionexcepthandlerExceptHandlerargumentskeywordaliasfield body is required for Expressionfield name is required for FunctionDeffield args is required for FunctionDeffield name is required for ClassDeffield value is required for Assignfield target is required for AugAssignfield op is required for AugAssignfield value is required for AugAssignfield target is required for Forfield iter is required for Forfield test is required for Whilefield test is required for Iffield context_expr is required for Withfield test is required for Assertfield body is required for Execfield value is required for Exprfield op is required for BoolOpfield left is required for BinOpfield op is required for BinOpfield right is required for BinOpfield op is required for UnaryOpfield operand is required for UnaryOpfield args is required for Lambdafield body is required for Lambdafield test is required for IfExpfield body is required for IfExpfield orelse is required for IfExpfield elt is required for ListCompfield elt is required for SetCompfield key is required for DictCompfield value is required for DictCompfield elt is required for GeneratorExpfield left is required for Comparefield func is required for Callfield value is required for Reprfield n is required for Numfield s is required for Strfield value is required for Attributefield attr is required for Attributefield ctx is required for Attributefield value is required for Subscriptfield slice is required for Subscriptfield ctx is required for Subscriptfield id is required for Namefield ctx is required for Namefield ctx is required for Listfield ctx is required for Tuplefield value is required for Indexfield target is required for comprehensionfield iter is required for comprehensionfield arg is required for keywordfield value is required for keywordfield name is required for aliasbodybodybodybodynameargsbodydecorator_listnamebasesbodydecorator_listvaluetargetstargetsvaluetargetopvaluedestvaluesnltargetiterbodyorelsetestbodyorelsetestbodyorelsecontext_exproptional_varsbodytypeinsttbackbodyhandlersorelsebodyfinalbodytestmsgnamesmodulenameslevelbodyglobalslocalsnamesvaluelinenocol_offsetopvaluesleftoprightopoperandargsbodytestbodyorelsekeysvalueseltseltgeneratorseltgeneratorskeyvaluegeneratorseltgeneratorsvalueleftopscomparatorsfuncargskeywordsstarargskwargsvaluensvalueattrctxvalueslicectxidctxeltsctxeltsctxlinenocol_offsetunknown expr_context foundlowerupperstepdimsvalueunknown boolop foundunknown operator foundunknown unaryop foundunknown cmpop foundtargetiterifstypenamebodylinenocol_offsetargsvarargkwargdefaultsargvaluenameasnamebodybodyModule field "body" must be a list, not a %.200srequired field "body" missing from ModulebodybodyInteractive field "body" must be a list, not a %.200srequired field "body" missing from Interactivebodybodyrequired field "body" missing from ExpressionbodybodySuite field "body" must be a list, not a %.200srequired field "body" missing from Suiteexpected some sort of mod, but got %.400slinenolinenorequired field "lineno" missing from stmtcol_offsetcol_offsetrequired field "col_offset" missing from stmtnamenamerequired field "name" missing from FunctionDefargsargsrequired field "args" missing from FunctionDefbodybodyFunctionDef field "body" must be a list, not a %.200srequired field "body" missing from FunctionDefdecorator_listdecorator_listFunctionDef field "decorator_list" must be a list, not a %.200srequired field "decorator_list" missing from FunctionDefnamenamerequired field "name" missing from ClassDefbasesbasesClassDef field "bases" must be a list, not a %.200srequired field "bases" missing from ClassDefbodybodyClassDef field "body" must be a list, not a %.200srequired field "body" missing from ClassDefdecorator_listdecorator_listClassDef field "decorator_list" must be a list, not a %.200srequired field "decorator_list" missing from ClassDefvaluevaluetargetstargetsDelete field "targets" must be a list, not a %.200srequired field "targets" missing from DeletetargetstargetsAssign field "targets" must be a list, not a %.200srequired field "targets" missing from Assignvaluevaluerequired field "value" missing from Assigntargettargetrequired field "target" missing from AugAssignopoprequired field "op" missing from AugAssignvaluevaluerequired field "value" missing from AugAssigndestdestvaluesvaluesPrint field "values" must be a list, not a %.200srequired field "values" missing from Printnlnlrequired field "nl" missing from Printtargettargetrequired field "target" missing from Foriteriterrequired field "iter" missing from ForbodybodyFor field "body" must be a list, not a %.200srequired field "body" missing from FororelseorelseFor field "orelse" must be a list, not a %.200srequired field "orelse" missing from Fortesttestrequired field "test" missing from WhilebodybodyWhile field "body" must be a list, not a %.200srequired field "body" missing from WhileorelseorelseWhile field "orelse" must be a list, not a %.200srequired field "orelse" missing from Whiletesttestrequired field "test" missing from IfbodybodyIf field "body" must be a list, not a %.200srequired field "body" missing from IforelseorelseIf field "orelse" must be a list, not a %.200srequired field "orelse" missing from Ifcontext_exprcontext_exprrequired field "context_expr" missing from Withoptional_varsoptional_varsbodybodyWith field "body" must be a list, not a %.200srequired field "body" missing from WithtypetypeinstinsttbacktbackbodybodyTryExcept field "body" must be a list, not a %.200srequired field "body" missing from TryExcepthandlershandlersTryExcept field "handlers" must be a list, not a %.200srequired field "handlers" missing from TryExceptorelseorelseTryExcept field "orelse" must be a list, not a %.200srequired field "orelse" missing from TryExceptbodybodyTryFinally field "body" must be a list, not a %.200srequired field "body" missing from TryFinallyfinalbodyfinalbodyTryFinally field "finalbody" must be a list, not a %.200srequired field "finalbody" missing from TryFinallytesttestrequired field "test" missing from AssertmsgmsgnamesnamesImport field "names" must be a list, not a %.200srequired field "names" missing from ImportmodulemodulenamesnamesImportFrom field "names" must be a list, not a %.200srequired field "names" missing from ImportFromlevellevelbodybodyrequired field "body" missing from ExecglobalsglobalslocalslocalsnamesnamesGlobal field "names" must be a list, not a %.200srequired field "names" missing from Globalvaluevaluerequired field "value" missing from Exprexpected some sort of stmt, but got %.400slinenolinenorequired field "lineno" missing from exprcol_offsetcol_offsetrequired field "col_offset" missing from expropoprequired field "op" missing from BoolOpvaluesvaluesBoolOp field "values" must be a list, not a %.200srequired field "values" missing from BoolOpleftleftrequired field "left" missing from BinOpopoprequired field "op" missing from BinOprightrightrequired field "right" missing from BinOpopoprequired field "op" missing from UnaryOpoperandoperandrequired field "operand" missing from UnaryOpargsargsrequired field "args" missing from Lambdabodybodyrequired field "body" missing from Lambdatesttestrequired field "test" missing from IfExpbodybodyrequired field "body" missing from IfExporelseorelserequired field "orelse" missing from IfExpkeyskeysDict field "keys" must be a list, not a %.200srequired field "keys" missing from DictvaluesvaluesDict field "values" must be a list, not a %.200srequired field "values" missing from DicteltseltsSet field "elts" must be a list, not a %.200srequired field "elts" missing from Setelteltrequired field "elt" missing from ListCompgeneratorsgeneratorsListComp field "generators" must be a list, not a %.200srequired field "generators" missing from ListCompelteltrequired field "elt" missing from SetCompgeneratorsgeneratorsSetComp field "generators" must be a list, not a %.200srequired field "generators" missing from SetCompkeykeyrequired field "key" missing from DictCompvaluevaluerequired field "value" missing from DictCompgeneratorsgeneratorsDictComp field "generators" must be a list, not a %.200srequired field "generators" missing from DictCompelteltrequired field "elt" missing from GeneratorExpgeneratorsgeneratorsGeneratorExp field "generators" must be a list, not a %.200srequired field "generators" missing from GeneratorExpvaluevalueleftleftrequired field "left" missing from CompareopsopsCompare field "ops" must be a list, not a %.200srequired field "ops" missing from ComparecomparatorscomparatorsCompare field "comparators" must be a list, not a %.200srequired field "comparators" missing from Comparefuncfuncrequired field "func" missing from CallargsargsCall field "args" must be a list, not a %.200srequired field "args" missing from CallkeywordskeywordsCall field "keywords" must be a list, not a %.200srequired field "keywords" missing from Callstarargsstarargskwargskwargsvaluevaluerequired field "value" missing from Reprnnrequired field "n" missing from Numssrequired field "s" missing from Strvaluevaluerequired field "value" missing from Attributeattrattrrequired field "attr" missing from Attributectxctxrequired field "ctx" missing from Attributevaluevaluerequired field "value" missing from Subscriptsliceslicerequired field "slice" missing from Subscriptctxctxrequired field "ctx" missing from Subscriptididrequired field "id" missing from Namectxctxrequired field "ctx" missing from NameeltseltsList field "elts" must be a list, not a %.200srequired field "elts" missing from Listctxctxrequired field "ctx" missing from ListeltseltsTuple field "elts" must be a list, not a %.200srequired field "elts" missing from Tuplectxctxrequired field "ctx" missing from Tupleexpected some sort of expr, but got %.400sexpected some sort of expr_context, but got %.400slowerlowerupperupperstepstepdimsdimsExtSlice field "dims" must be a list, not a %.200srequired field "dims" missing from ExtSlicevaluevaluerequired field "value" missing from Indexexpected some sort of slice, but got %.400sexpected some sort of boolop, but got %.400sexpected some sort of operator, but got %.400sexpected some sort of unaryop, but got %.400sexpected some sort of cmpop, but got %.400stargettargetrequired field "target" missing from comprehensioniteriterrequired field "iter" missing from comprehensionifsifscomprehension field "ifs" must be a list, not a %.200srequired field "ifs" missing from comprehensionlinenolinenorequired field "lineno" missing from excepthandlercol_offsetcol_offsetrequired field "col_offset" missing from excepthandlertypetypenamenamebodybodyExceptHandler field "body" must be a list, not a %.200srequired field "body" missing from ExceptHandlerexpected some sort of excepthandler, but got %.400sargsargsarguments field "args" must be a list, not a %.200srequired field "args" missing from argumentsvarargvarargkwargkwargdefaultsdefaultsarguments field "defaults" must be a list, not a %.200srequired field "defaults" missing from argumentsargargrequired field "arg" missing from keywordvaluevaluerequired field "value" missing from keywordnamenamerequired field "name" missing from aliasasnameasname_astASTPyCF_ONLY_AST__version__82160modModuleInteractiveExpressionSuitestmtFunctionDefClassDefReturnDeleteAssignAugAssignPrintForWhileIfWithRaiseTryExceptTryFinallyAssertImportImportFromExecGlobalExprPassBreakContinueexprBoolOpBinOpUnaryOpLambdaIfExpDictSetListCompSetCompDictCompGeneratorExpYieldCompareCallReprNumStrAttributeSubscriptNameListTupleexpr_contextLoadStoreDelAugLoadAugStoreParamsliceEllipsisSliceExtSliceIndexboolopAndOroperatorAddSubMultDivModPowLShiftRShiftBitOrBitXorBitAndFloorDivunaryopInvertNotUAddUSubcmpopEqNotEqLtLtEGtGtEIsIsNotInNotIncomprehensionexcepthandlerExceptHandlerargumentskeywordaliasModuleExpressionInteractiveexpected %s node, got %.400sputenv(key, value) -> None Change or add an environment variable.S.isalnum() -> bool Return True if all characters in S are alphanumeric and there is at least one character in S, False otherwise.getservbyport(port[, protocolname]) -> string Return the service name from a port number and protocol name. The optional protocol name, if given, should be 'tcp' or 'udp', otherwise any protocol will match.getppid() -> ppid Return the parent's process id.  d'@Bʚ;$>Wk xreadlines() -> self For backward compatibility. BZ2File objects now include the performance optimizations previously implemented in the xreadlines module. i)q)H))' A( ) ,(S.center(width[, fillchar]) -> string Return S centered in a string of length width. Padding is done using the specified fill character (default is a space)memoryview(object) Create a new memoryview object which references the given object.readlines() -- Read all linesstat_result: Result from stat or lstat. This object may be accessed either as a tuple of (mode, ino, dev, nlink, uid, gid, size, atime, mtime, ctime) or via the attributes st_mode, st_ino, st_dev, st_nlink, st_uid, and so on. Posix/windows: If your platform supports st_blksize, st_blocks, st_rdev, or st_flags, they are available as attributes only. See os.stat for more information.$4"H.($A#X8$#1$%X3$%%$[&<$&N1$'@{7$*(3 $A=X6%$%>X.,$03@ "raw_input([prompt]) -> string Read a string from standard input. The trailing newline is stripped. If the user hits EOF (Unix: Ctl-D, Windows: Ctl-Z+Return), raise EOFError. On Unix, GNU readline is used if enabled. The prompt string, if given, is printed without a trailing newline before reading.tb_nexttb_frametb_lastitb_linenotraceback../Python/traceback.crbpathrb File "%.500s:%d", in %.500s ../Python/traceback.ctracebacklimitTraceback (most recent call last): `hC`&{?gethostbyaddr(host) -> (name, aliaslist, addresslist) Return the true host name, a list of aliases, and a list of IP addresses, for a host. The host argument is a string giving a host name or IP number.#c/pid#p//fd/dev/consFAILED Hawait() -> string Wait for process to exit, return process statistics.LETTEWITSMALSYLLABLSIGCAPITALATIYCJEGYPTIAHIEROGLYPARABICOMPATIBILITMATHEMATICACUNEIFORSYMBOFORMCANADIASYLLABICDIGIBOLHANGUGREELIGATURANMUSICATIMEETHIOPIVOWEITALICYRILLIRADICASANS-SERICIRCLEFOCOMBININTAVAFINASQUARVARIATIOLEFBRAILLPATTERRIGHBYZANTINISOLATEABOVEDOUBLKATAKANKANGXNUMBESIGNBELOWLINEAMODIFIETIBETAADOMEEMYANMACARRIEARROWINITIAWHITUVERTICAYEABOVIOCOPTIARROMONGOLIAMARKKHMEDEVANAGARTILPARENTHESIZETHABLACJONGSEONBOHEBREPLUDRAWINGRIGHTWARDCHOSEONSTROKEHALFWIDTBALINESGEORGIAHOOKIDEOGRAIDEOGRAPHIALESYMBOLTOSCRIPTWOOVEHEAVONEULOFULLWIDTHADOWEQUABRACKETHIGOTADOMINNUMERIFRAKTUJUNGSEONMALAYALATWGLAGOLITICHARACTELEFTWARDMEDIATELUGBENGALONARMENIAJAVANESJEEBARHIRAGANWEST-CREIDEOGRAPBAMUTHAKANNADCHEROKEHALTONNEORIYTHRECHAGUJARATLUFOURHARUNISAURASHTRTETRAGRATHREEDESERESINHALGURMUKHMARNOTATIOSYRIAVOCALIACUTELEPCHLIGHLONTURKIDOUBLE-STRUCFIVEKATAMIVIEAPFUNCTIONAHAMZSIXTELEGRAPYAEIGHTHORIZONTAPADOTNINESEVENBARDASIKAITHLIMBMAMAKSURSTBOPOMOFKHAROSHTHLARASQUAREHEXAGRAKNAPSILREVERSEMONOSPACNOSAMARITASTROKTURNEVZZYXZZYTZZYRXZZYRZZYPZZYZZUXZZURXZZURZZUPZZUZZOXZZOPZZOZZIXZZITZZIPZZIEXZZIETZZIEPZZIEZZIZZEXZZEPZZEEZZEZZAXZZATZZAPZZAAZZAZYGOSZWARAKAYZWAZUTZUOXZUOPZUOZUMZUBURZU5ZUZRAZQAPHZOTZOOZOAZLAMZLAZLZJEZIZ2ZIQAAZINORZILDEZIGZAZIGZIDZIBZIZI3ZZHYXZHYTZHYRXZHYRZHYPZHYZHWEZHWAZHUXZHUTZHURXZHURZHUPZHUOXZHUOPZHUOZHUZHOXZHOTZHOPZHOOZHOZHIVETEZHIZHEXZHETZHEPZHEEZHEZHZHAXZHATZHARZHAPZHAINZHAAZHAZHZETAZEROZERZENZEMLYAZEMLJAZE2ZZAYNZAYINZAYIZAVIYANIZATAZARQAZAQEZAMXZAZAINZAIZAIZAHZAZAGZAEFZ016HZ016GZ016FZ016EZ016DZ016CZ016BZ016AZ016Z015IZ015HZ015GZ015FZ015EZ015DZ015CZ015BZ015AZ015Z014Z013Z012Z011Z010Z009Z008Z007Z006Z005AZ005Z004AZ004Z003BZ003AZ003Z002DZ002CZ002BZ002AZ002Z001ZYYXYYTYYRXYYRYYPYYEYYAYYYWOOYWOYWIIYWIYWEYWAAYWAYVYUXYUUKALEAPINTUYUTYUSYUYURXYURYUQYUPYUOXYUOTYUOPYUOYUDHYUDYUANYU-YEOYU-YEYU-UYU-OYU-IYU-EOYU-EYU-AEYU-AYUYYPSILIYPORROIYPOKRISISYPOKRISIYPOGEGRAMMENIYOYYOXYOUTHFULNESSYOUTHFUYOTYORIYOQYOPYOOYOMOYOGHYODHYODYOYOAYO-YEOYO-YAEYO-YAYO-OYO-IYO-EOYO-AEYO-AYOYYIZETYIXYIWNYITYIPYINGYIIYIYIEXYIETYIEPYIEYIDDISYI-UYIYFESISYFESIYFEYEYYEWYETIVYESTUYESIEUNG-SIOSYESIEUNG-PANSIOSYESIEUNG-MIEUMYESIEUNG-HIEUHYESIEUNGYERUYERYERIYERAYERYEORINHIEUHYEO-YAYEO-UYEO-OYENISEYENAPYEYELLOWYEHYEEYEAYEAYAZZYAZHYAZYAYANNAYAYYAWYAVYATTYATIYATHYATYASSYASHYASYARRYARYAYAQYAPYANGYANYANYAMOKYAMAKKANYAMYALYAKHHYAKHYAKASHYAKYAJURVEDIYAJYAHHYAHYAGNYAGHHYAGHYAGYAFYADHYADDHYADDYADYACHYABHYABYAARUYAAIYAADOYAAYA-YOYA-UYA-OY008Y007Y006Y005Y004Y003Y002Y001AY001Y-CREXYXXYUXYTXYRXXYRXYPXYOXYIXYEEXYEXYAAXYAXYXWIXWEEXWEXWAAXWAXVEXVAXUOXXUOXUXSHAAYATHIYAXOXXOTXORXOPXOAXOXIXXITXIROXIPXIEXXIETXIEPXIEXIXGXESTEXEHXEEXEXANXAAXAX008AX008X007X006AX006X005X004BX004AX004X003X002X001WZWYNNWYNWVWUOXWUOPWUOWUNJWUNWULUWULWUEWUWRONGWRITINWREATWRAPWOXWORKWORWORDSPACEWORWOPWOONWOOLWOODS-CREWOODWONWOWOMANWOLOSOWOEWOAWITHOUWINTERWINJAWINEWINDUWINDWINWIGNYANWIGGLWIDE-HEADEWIDWIANGWAAKWIANGWHOLWHITE-FEATHEREWHITEWHEELEWHEELCHAIWHEELWHEEWHEATWGWEXWESTERWESTWESWEPWEOWENWELLWEIGHWEENWEDGE-TAILEWEAPONWBWAYWAWAXWAW-AYIN-RESHWAWWAWAVWAVEWAVWAUWATTOWATERWATEWATCHWATWASTINGWASSALLAMWASLAWASLWASALLAMWASALLAWARNINWAPWANDERERWANWALLWALKWALWAITINGWAIWAENWAEWAAVUW025W024AW024W023W022W021W020W019W018AW018W017AW017W016W015W014AW014W013W012W011W010AW010W009AW009W008W007W006W005W004W003AW003W002W001VZMETVYXVYTVYRXVYRVYPVYVWAVUXVUTVURXVURVUPVULGAVRACHYVOXVOWEL-CARRIEVOWVOUVOTVOPVOOVOLUMVOLTAGVOIVOICINGVOICELESVOICEVOCAVOVIXVITVISIGOTHIVISARGAYAVISARGAVISARGVIRIAMVIRGOVIRGAVIRAMAVIPVINEVINVILLAGEVIEXVIEWDATVIETVIEPVIEVIDAVICTORVIVEXVEWVEVESTAVESSEVERVERTICALLYVERTICALLVERTICAL-06-06VERTICAL-06-05VERTICAL-06-04VERTICAL-06-03VERTICAL-06-02VERTICAL-06-01VERTICAL-06-00VERTICAL-05-06VERTICAL-05-05VERTICAL-05-04VERTICAL-05-03VERTICAL-05-02VERTICAL-05-01VERTICAL-05-00VERTICAL-04-06VERTICAL-04-05VERTICAL-04-04VERTICAL-04-03VERTICAL-04-02VERTICAL-04-01VERTICAL-04-00VERTICAL-03-06VERTICAL-03-05VERTICAL-03-04VERTICAL-03-03VERTICAL-03-02VERTICAL-03-01VERTICAL-03-00VERTICAL-02-06VERTICAL-02-05VERTICAL-02-04VERTICAL-02-03VERTICAL-02-02VERTICAL-02-01VERTICAL-02-00VERTICAL-01-06VERTICAL-01-05VERTICAL-01-04VERTICAL-01-03VERTICAL-01-02VERTICAL-01-01VERTICAL-01-00VERTICAL-00-06VERTICAL-00-05VERTICAL-00-04VERTICAL-00-03VERTICAL-00-02VERTICAL-00-01VERTICAL-00-00VERTICALVERSICLEVERSVERGEVEPVENDVEHVEVEEVEVEDEVECTOVAYANNAVAXVAVVAVATHYVATVASTNESVASISVARYVARIKAVARIANVARIAVARIVAREIAVAREIVAPVANEVAMAGOMUKHAVAMAGOMUKHVALLEYVAAVUVAAV040AV040V039V038V037AV037V036V035V034V033AV033V032V031AV031V030AV030V029AV029V028AV028V027V026V025V024V023AV023V022V021V020LV020KV020JV020IV020HV020GV020FV020EV020DV020CV020BV020AV020V019V018V017V016V015V014V013V012BV012AV012V011CV011BV011AV011V010V009V008V007BV007AV007V006V005V004V003V002AV002V001IV001HV001GV001FV001EV001DV001CV001BV001AV001UZUUZ3UZUYANNAUYUUYANNAUUUUUUU3UUU2UUEUTUKIUSSU3USSUUSHXUSHUMXUSH2USHUSUSEUSEURUURUSURUDAURUDURUURURNURI3URIURANUSURAUR4UR2URUPWARDSUPWARDUPWARDUPWARUPTURNUPSILONUPSILOUPRIGHUPPEUPADHMANIYAUP-POINTINUONUNNUNMARRIEUNIVERSAUNITYUNITUNIUNIONUNIOUNIFIEUNDUNDERTIEUNDERLINUNDERDOTUNDERBARUNDEUNCIUNASPIRATEDUNAPUNAUUMUMUMUUMBRELLAUMBRELLUMBINUKUUKRAINIAUKARAUKARUKUILLEANNUIGHUUGARITIUEYUEEUEAUDUGUDATTAUDATTUDAATUDUUCUBUFILIUBHAYATUBADAMAUBUATHUAUU042U041U040U039U038U037U036U035U034U033U032AU032U031U030U029AU029U028U027U026U025U024U023AU023U022U021U020U019U018U017U016U015U014U013U012U011U010U009U008U007U006BU006AU006U005U004U003U002U001U-I-IU-EO-EUTZUTZOATZOTZITZITZEETZETZAATZATZTYTYPE-TYPE-TYPE-TYPE-TYPE-TYPE-TYPE-TYPTYOTYITYETYATWOOTWO-WATWO-LINTWO-HEADETWIITWITWENTY-TWOTWENTY-THREETWENTY-SIXTWENTY-SEVENTWENTY-ONETWENTY-NINETWENTY-FOURTWENTY-FIVETWENTY-EIGHTTWENTY-EIGHTTWENTYTWENTTWELVETWELVTWETWAATWATVRIDOTVIMADUTUXTUUMUTUTEYASATTUTTURXTURUTURTLETURO2TURNSTILETURTURBANTURTUPTUOXTUOTTUOPTUOTUNNYTUMETESTUMTUKWENTISTUKTUGRITUG2TUGTUARETTUDDAGTTUDDAAGTTUTTTHATTSUTTSOTTSITTSEETTSETTSATTITTHWETTHOOTTHOTTHITTHETTHAATTHTTEHEHTTEHETTEHTTETTEETTETTAYANNATTAATT2TSWETSWATSVTSSETSHUGSTSHOOKTSHOOTSHESTSHEGTSHETSHETSHATSERETSADITSADTSAADIYTSAATSTRYBLIOTRUTHTRUNKTRUNCATETRUETRUCKTROMIKOSYNAGMATROMIKOPSIFISTONTROMIKOPARAKALESMATROMIKONTROMIKOTROMIKOLYGISMATROKUTASTTROEZENIATRITOTRITIMORIONTRISIMOUTRISEMETRIPODTRIPLITRIPLTRIOTRIISAPTRIGRAMMOTRIGRATRIGORGONTRIFONIASTRIFOLIATTRICOLONTRIANGULATRIANGLE-ROUNTRIANGLE-HEADETRIANGLETRIANGLTRIATRITRESILLOTREMOLO-3TREMOLO-2TREMOLO-1TREETRETREADINGTRAPEZIUMTRANSVERSATRANSPOSITIOTRANSMISSIONTRANSMISSIOTRAFFICTRADTRACKTRTOXTOURNOITOTATOTTORTOISTORCULUSTORCULUTOPBARTOP-LIGHTETOPTOTOOTHTOOTONOSTONGUETONGTONE-6TONE-5TONE-4TONE-3TONE-2TONE-1TONETONATOLONGTOGETHERTODTOANDAKHIATTOATNTLVTLUTLOTLITLHWETLHUTLHOOTLHOTLHITLHEETLHETLHATLEETLATJETIXTIWNTIWATITLOTITTIRYAKTIRTTIRONIATIRTITIPPITIPEHATIPTITINYTINTINNETINAGMATIMESTIMETILDETILDTILTITIKEUT-THIEUTHTIKEUT-SIOS-KIYEOKTIKEUT-SIOSTIKEUT-RIEULTIKEUT-PIEUPTIKEUT-MIEUMTIKEUT-KIYEOKTIKEUT-CIEUCTIKEUT-CHIEUCHTIKEUTTIKEUTIITIGHTIGERTIFINAGTIEXTIEPTITICKTICTIARATHZTHYOOTHWOOTHWOTHWIITHWITHWEETHWAATHWATHURTHURISATHUNGTHUNDERSTORMTHUNDERTHUNDETHUTHROUGHTHROUGTHREE-PER-ETHREE-LINTHREE-THREADTHOUSANDTHOUSANDTHOUSANTHOUTHORNTHORTHONGTHOATHTHIUTHTHITATHIRTY-SECONTHIRTY-ONETHIRTYTHIRTTHIRTEENTHIRTEETHIRDSTHIRDTHIRDTHIRTHITHIITHIGHTHIEUTTHEYTHETHETHETHTHETATHETTHESPIATHESEOSTHESEOTHETHERMODYNAMICTHEREFORETHERTHETHEMATISMOTHEMATHEMTHEHTHETHEETHTHAWTHANTHAKHATTHANNATHANTHATHALTHATHAHANTHAANTHAALUTH-CRETEXTTEXTEVIRTETRASIMOUTETRASEMETETRAPLITETRAFONIASTETHTETTETARTOTETARTIMORIONTETTETESSERATESSERTESSAROTESTERMINATORTEPTENUTOTENUTENTENTHTENTTENTENGTENTETEMPUTELUTELOUTELISHTELEPHONETELEPHONTELEIATEIWSTEGEHTETEDUNGTEARDROP-SPOKETEARDROP-SHANKETEARDROP-BARBETE-UTCHEHEHTCHEHETCHEHTCHETCHETTAYTAXTAWELLEMETAWATAWTAVIYANITAVTATAURUSTAUTATATWEELTATWEETATTOOETATTARUNGTARTAPERTAPTAPTAOTANNETANTANTAMINGTAMTALLTALTALINGTALINTALENTSTALENTAKHALLUSTAKETAK4TAKTAISYOUTAILLESTAILTAITAHTATAGBANWTAGALOTAGTAETACKTACTABULATIONTABLETABTATAALUJTAAITAAFTA2TA-ROLT036T035T034T033AT033T032AT032T031T030T029T028T027T026T025T024T023T022T021T020T019T018T017T016AT016T015T014T013T012T011AT011T010T009AT009T008AT008T007AT007T006T005T004T003AT003T002T001SZZSZWGSZWASZUSZOSZISZEESZESZAASZASZSYXSYTSYRXSYRMATIKISYRMASYRSYPSYOUWASYNEVMASYNDESMOSYNCHRONOUSYNAGMSYNAFISYMMETRYSYMMETRISYMBOL-9SYMBOL-8SYMBOL-7SYMBOL-6SYMBOL-54SYMBOL-53SYMBOL-52SYMBOL-51SYMBOL-50SYMBOL-5SYMBOL-49SYMBOL-48SYMBOL-47SYMBOL-45SYMBOL-43SYMBOL-42SYMBOL-40SYMBOL-4SYMBOL-39SYMBOL-38SYMBOL-37SYMBOL-36SYMBOL-32SYMBOL-30SYMBOL-3SYMBOL-29SYMBOL-27SYMBOL-26SYMBOL-25SYMBOL-24SYMBOL-23SYMBOL-22SYMBOL-21SYMBOL-20SYMBOL-2SYMBOL-19SYMBOL-18SYMBOL-17SYMBOL-16SYMBOL-15SYMBOL-14SYMBOL-13SYMBOL-12SYMBOL-11SYMBOL-10SYMBOL-1SYLOTSYASYSWZSWUNSWORDSSWORDSWOOSWOSWIISWISWGSWEETSWASSWAPPINGSWAASWSVASTSVARITASVARITSUXSUUSUTSUSPENSIOSURXSURROUNDSURROUNSURFACSURESURANGSUR9SURSUSUPRALINEASUPERVISESUPERSETSUPERSESUPERSCRIPSUPERIMPOSESUPERFIXESUPSUOXSUOPSUOSUNGSUNDANESSUNSUSUMMERSUMMATIONSUMMATIOSUMASHSUMSUKUNSUKUSUKUSUKSUITABLESUITSUHURSUD2SUDSUCCEEDSSUCCEEDSUCCEEDSUCCEESUBUNITSUBSTITUTIOSUBSTITUTESUBSTITUTSUBSETSUBSESUBSCRIPSUBPUNCTISSUBLINEASUBJOINESUBJECTSUBITOSUBGROUPSUBGROUSUASSTWASTUDYSTROKESSTROKESTROKE-9STROKE-8STROKE-7STROKE-6STROKE-5STROKE-4STROKE-3STROKE-2STROKE-11STROKE-10STROKE-1STRIPESTRIKETHROUGHSTRIDESTRICTLSTRETCHESTRESSTRENGTHSTRATIASTRAINERSTRAIGHTNESSSTRAIGHSTRAIFSTRAGGISMATASTOVESTOPPINGSTOPPAGESTOPSTOSTONESTOCKSTIMMESTILSTILSTIGMASTEPSTEMSTESTEAMSTAVROUSTAVROSSTAVROSTAUROSSTATERSSTARSTARKSTARSTASTANDSTILLSTANDARSTANDSTANSTALLIONSTAFFSTAFSTACCATOSTACCATISSIMOST2SSYXSSYTSSYRXSSYRSSYPSSYSSUXSSUTSSUPSSOXSSOTSSOPSSOSSIXSSITSSIPSSIEXSSIEPSSIESSISSHESSEXSSEPSSEESSAXSSATSSAPSSANGYEORINHIEUHSSANGTIKEUT-PIEUPSSANGTIKEUTSSANGTHIEUTHSSANGSIOS-TIKEUTSSANGSIOS-PIEUPSSANGSIOS-KIYEOKSSANGSIOSSSANGRIEUL-KHIEUKHSSANGRIEULSSANGPIEUPSSANGNIEUNSSANGMIEUMSSANGKIYEOKSSANGIEUNGSSANGHIEUHSSANGCIEUC-HIEUHSSANGCIEUCSSANGARAEASSAASSASRSQUISSQUIRRESQUIGGLSQUASQUARESSQUAREDSQUARESPWASPUNGSPROUTSPRINGSSPRINGSPRECHGESANSPOTSPOONSPLITTINSPIRITUSPIRITSPIRISPIRANTSPIRALSPIDERSPICESPHERICASPESMILSPEECHSPECIALSPEARSPATHISPARKLESPADSPACINSPSOYSOWILSOWSOUTH-SLAVESOUTSOURCESOUNDSOUNSOUNAPSOUSOOSONGSONSOLIDUSSOLIDUSOGDIASOFTWARE-FUNCTIOSOFSOSOCIETYSOCCESOASSNOWMANSNOWMASNOWFLAKESNOWSNOUTSNOUSNASNAKESNAKSNSMILINSMILESMEARSMASSMALLESMALLSLURSLOWLYSLOSLOVOSLOPINSLOPESLINGSLIDINGSLICESLAVONISLAVESLASHSLASSLANTESKWASKWSKULSKLIROSKINSKIERSKEWESKATESKSJESIXTY-FOURTSIXTYSIXTSIXTHSSIXTHSIXTHSIXTEENTHSSIXTEENTHSIXTEENTSIXTEENSIXTEESIX-STRINSIX-PER-ESIX-LINSISITESIRINGUSIOS-THIEUTHSIOS-SSANGSIOSSIOS-RIEULSIOS-PIEUP-KIYEOKSIOS-PHIEUPHSIOS-PANSIOSSIOS-NIEUNSIOS-MIEUMSIOS-KHIEUKHSIOS-KAPYEOUNPIEUPSIOS-IEUNGSIOS-HIEUHSIOS-CIEUCSIOS-CHIEUCHSIOSINKINGSINGLE-LINSINGLESINGLSINGAATSINSINDHSISIMPLIFIESIMILARSIMILASIMANSISIMASILKSILIQUSILA3SIKISIK2SIKSIISIGNSSIGMASIGMSIGESIG4SIGSIGSIDEWAYSICKNESSSICKLESIBSSHYXSHYTSHYRXSHYRSHYPSHYESHYASHYSHWOYSHWOOSHWOSHWIISHWISHWESHWAASHWASHUXSHUTSHURXSHURSHUPSHUOXSHUOPSHUOSHUFFLSHUBURSHU2SHUSHUSHSHTAPICSHTASHRINESHOYSHOXSHOULDERESHOTSHORTSSHORTSHORTENERSHORT-TWIG-YRSHORT-TWIG-TYSHORT-TWIG-SOSHORT-TWIG-OSSHORT-TWIG-NAUSHORT-TWIG-MADSHORT-TWIG-HAGALSHORT-TWIG-BJARKASHORT-TWIG-ASHORTSHORSHOPSHOOTSHOOSHOGSHOSHOSHOASHOSHIYYAALAASHITASHITSHIRSHISHIPSHINTSHINIGSHINSHISHIMASHIMSHIMSHISHIINSHIISHIFSHIELDSHIDSHISHISHHASHEXSHEVASHEUXSHETSHESHLAMSHESHIGSHESHISHESH2SHESHSHEQESHEPSHENSHELLSHELSHELFSHEISHEG9SHEEPSHEENUSHEENSHEESHEESHE-GOATSHSHCHASHAYSHAXSHAVIYANISHAVIASHATSHARUSHARSHARPSHARSHARASHAR2SHARSHAPINGSHAPESSHAPSHANGSHANSHASHAMROCKSHALSHELETSHAKTISHADOWESHADESHADDASHADDSHADSHASHAB6SHAASHA6SHA3SHASGRSGOSGASGASGSEXTULSEXTILESEXTANSEVERANCESEVENTYSEVENTSEVENTHSEVENTEENSEVENTEESEVESEUXSESTERTIUSESQUIQUADRATESESAMSERVICSERIFSSERIFSEPTEMBERSEPARATORSEPARATOSENTOSENTISEMUNCISEMKATHSEMKSEMIVOWESEMISOFSEMISEXTILESEMIMINIMSEMIDIRECSEMICOLONSEMICOLOSEMICIRCULASEMICIRCLSEMIBREVISEMI-VOICESELFSELECTOR-99SELECTOR-98SELECTOR-97SELECTOR-96SELECTOR-95SELECTOR-94SELECTOR-93SELECTOR-92SELECTOR-91SELECTOR-90SELECTOR-9SELECTOR-89SELECTOR-88SELECTOR-87SELECTOR-86SELECTOR-85SELECTOR-84SELECTOR-83SELECTOR-82SELECTOR-81SELECTOR-80SELECTOR-8SELECTOR-79SELECTOR-78SELECTOR-77SELECTOR-76SELECTOR-75SELECTOR-74SELECTOR-73SELECTOR-72SELECTOR-71SELECTOR-70SELECTOR-7SELECTOR-69SELECTOR-68SELECTOR-67SELECTOR-66SELECTOR-65SELECTOR-64SELECTOR-63SELECTOR-62SELECTOR-61SELECTOR-60SELECTOR-6SELECTOR-59SELECTOR-58SELECTOR-57SELECTOR-56SELECTOR-55SELECTOR-54SELECTOR-53SELECTOR-52SELECTOR-51SELECTOR-50SELECTOR-5SELECTOR-49SELECTOR-48SELECTOR-47SELECTOR-46SELECTOR-45SELECTOR-44SELECTOR-43SELECTOR-42SELECTOR-41SELECTOR-40SELECTOR-4SELECTOR-39SELECTOR-38SELECTOR-37SELECTOR-36SELECTOR-35SELECTOR-34SELECTOR-33SELECTOR-32SELECTOR-31SELECTOR-30SELECTOR-3SELECTOR-29SELECTOR-28SELECTOR-27SELECTOR-26SELECTOR-256SELECTOR-255SELECTOR-254SELECTOR-253SELECTOR-252SELECTOR-251SELECTOR-250SELECTOR-25SELECTOR-249SELECTOR-248SELECTOR-247SELECTOR-246SELECTOR-245SELECTOR-244SELECTOR-243SELECTOR-242SELECTOR-241SELECTOR-240SELECTOR-24SELECTOR-239SELECTOR-238SELECTOR-237SELECTOR-236SELECTOR-235SELECTOR-234SELECTOR-233SELECTOR-232SELECTOR-231SELECTOR-230SELECTOR-23SELECTOR-229SELECTOR-228SELECTOR-227SELECTOR-226SELECTOR-225SELECTOR-224SELECTOR-223SELECTOR-222SELECTOR-221SELECTOR-220SELECTOR-22SELECTOR-219SELECTOR-218SELECTOR-217SELECTOR-216SELECTOR-215SELECTOR-214SELECTOR-213SELECTOR-212SELECTOR-211SELECTOR-210SELECTOR-21SELECTOR-209SELECTOR-208SELECTOR-207SELECTOR-206SELECTOR-205SELECTOR-204SELECTOR-203SELECTOR-202SELECTOR-201SELECTOR-200SELECTOR-20SELECTOR-2SELECTOR-199SELECTOR-198SELECTOR-197SELECTOR-196SELECTOR-195SELECTOR-194SELECTOR-193SELECTOR-192SELECTOR-191SELECTOR-190SELECTOR-19SELECTOR-189SELECTOR-188SELECTOR-187SELECTOR-186SELECTOR-185SELECTOR-184SELECTOR-183SELECTOR-182SELECTOR-181SELECTOR-180SELECTOR-18SELECTOR-179SELECTOR-178SELECTOR-177SELECTOR-176SELECTOR-175SELECTOR-174SELECTOR-173SELECTOR-172SELECTOR-171SELECTOR-170SELECTOR-17SELECTOR-169SELECTOR-168SELECTOR-167SELECTOR-166SELECTOR-165SELECTOR-164SELECTOR-163SELECTOR-162SELECTOR-161SELECTOR-160SELECTOR-16SELECTOR-159SELECTOR-158SELECTOR-157SELECTOR-156SELECTOR-155SELECTOR-154SELECTOR-153SELECTOR-152SELECTOR-151SELECTOR-150SELECTOR-15SELECTOR-149SELECTOR-148SELECTOR-147SELECTOR-146SELECTOR-145SELECTOR-144SELECTOR-143SELECTOR-142SELECTOR-141SELECTOR-140SELECTOR-14SELECTOR-139SELECTOR-138SELECTOR-137SELECTOR-136SELECTOR-135SELECTOR-134SELECTOR-133SELECTOR-132SELECTOR-131SELECTOR-130SELECTOR-13SELECTOR-129SELECTOR-128SELECTOR-127SELECTOR-126SELECTOR-125SELECTOR-124SELECTOR-123SELECTOR-122SELECTOR-121SELECTOR-120SELECTOR-12SELECTOR-119SELECTOR-118SELECTOR-117SELECTOR-116SELECTOR-115SELECTOR-114SELECTOR-113SELECTOR-112SELECTOR-111SELECTOR-110SELECTOR-11SELECTOR-109SELECTOR-108SELECTOR-107SELECTOR-106SELECTOR-105SELECTOR-104SELECTOR-103SELECTOR-102SELECTOR-101SELECTOR-100SELECTOR-10SELECTOR-1SELECTOSEISMASEISMSEHSEGOLSEGNOSEGMENTSEENUSEENSEESECTORSECTIONSECTIOSECRETSECONDSEBATBEISEALSEAGULSDONSDSCWASCRUPLESCRIPTSCREENSCREESCORPIUSSCISSORSSCHWASCHWSCHROEDERSCHOOLSCHOLARSCHEMSCANDICUSSCANDICUSCASCALESSBUSBRUSAYISSAYANNASAYSAXIMATASAWANSAWSAUILSATURNSATKAANKUUSATKAANSASAKSARISARSARSAPASANYOOGSANYAKSANTIIMUSANNYASANGA2SANAHSANSAMYOSAMPISAMPHAOSAMKASAMEKHSAMEKSAMBASAMSALTIRESALTILLOSALTSALLALLAHOSALLSALASALASALSAKOTSAJDAHSAILBOATSAILSAIKURUSAGITTARIUSSAGASAGSASAFHASADHESADESADSASACRIFICIASAAISAADHUSA-IS046S045S044S043S042S041S040S039S038S037S036S035AS035S034S033S032S031S030S029S028S027S026BS026AS026S025S024S023S022S021S020S019S018S017AS017S016S015S014BS014AS014S013S012S011S010S009S008S007S006AS006S005S004S003S002AS002S001S-WS-SHAPERYYRYXRYTRYRXRYRRYPRYARWOORWORWIIRWIRWEERWERWAHARWAARWARUXRUUBURURUTRUSIRURXRURRUPIIRUPERUPRUOXRUOPRUORUNOUTRUNRUMRUMARUMRURULE-DELAYEDRULERUKKAKHARUISRURUARTHANRTAGSRTAGRRYXRRYTRRYRXRRYRRRYPRRYRRUXRRUTRRURXRRURRRUPRRUOXRRUORRURROXRROTRROPRRORREXRRETRREPRREHRRERRERRAXRRAROUNDEROUND-TIPPEROTUNDAROTATEROSHROSETTEROOTROOKROOFROOROMAROROCROBATROARROARNYINRNOONRNOORNARJERJERJRIVERRITUALRITTORURITSIRISINRISHRIRARIPRINGRINFORZANDORIRIKRIKRIIRIGVEDIRIGHTWARDSRIGHTHANRIGHT-TO-LEFRIGHT-SIDRIGHT-SHADOWERIGHT-SHADERIGHT-POINTINRIGHT-HANRIGHT-FACINRIGHTRIEUL-YESIEUNGRIEUL-YEORINHIEUH-HIEUHRIEUL-YEORINHIEUHRIEUL-TIKEUT-HIEUHRIEUL-TIKEUTRIEUL-THIEUTHRIEUL-SSANGTIKEUTRIEUL-SSANGSIOSRIEUL-SSANGPIEUPRIEUL-SSANGKIYEOKRIEUL-SIOSRIEUL-PIEUP-TIKEUTRIEUL-PIEUP-SIOSRIEUL-PIEUP-PHIEUPHRIEUL-PIEUP-HIEUHRIEUL-PIEUPRIEUL-PHIEUPHRIEUL-PANSIOSRIEUL-NIEUNRIEUL-MIEUM-SIOSRIEUL-MIEUM-KIYEOKRIEUL-MIEUM-HIEUHRIEUL-MIEUMRIEUL-KIYEOK-SIOSRIEUL-KIYEOK-HIEUHRIEUL-KIYEOKRIEUL-KAPYEOUNPIEUPRIEUL-HIEUHRIEUL-CIEUCRIEURIELRIEERICEMRICERIARHOTIRHORHRHARGYINGSRGYANRGYREVOLUTIONREVMAREVIAREVERSEDREVERSREUXRETURNRETURRETROFLERETREATRESUPINUSRESTRICTERESTRESPONSERESOURCERESOLUTIONRESISTANCERESIDENCERESRERENGGANREREKANREPRESENTREPLACEMENREPEATEREPEATREPEAREPAREPRENTOGENRENREMURELIGIONRELEASERELATIONARELATIONRELAAREJANREIREGISTEREREFERENCREDUPLICATIONRECYCLINRECYCLERECTILINEARECTANGULARECTANGLERECTANGLRECORDINRECORDERRECORRECEPTIVREAHMUKREACHRDRDERBASRAYSRAYANNARAYRATIORATHARATHRATARATRASWADIRASOURASHARAPISMARANGRANARANRAMRAMBATRAMRAKHANGRAISERAINRAIRAIDRAIDARAIRAHMATULLARAFERAERADIOACTIVRADRADRARABRAAIRAARA3RA2R029R028R027R026R025R024R023R022R021R020R019R018R017R016AR016R015R014R013R012R011R010AR010R009R008R007R006R005R004R003BR003AR003R002AR002R001R-CREQYXQYUQYTQYRXQYRQYPQYOQYIQYEEQYEQYAAQYAQYQWIQWEEQWEQWAAQWAQUXQUVQUUVQUUQUTQUSHSHAYAQURXQURQUPQUOXQUOTQUOTATIOQUOTQUOPQUOQUKQUINDICESIMQUINCUNXQUINARIUQUILLQUIQUFQUESTIONEQUESTIONQUESTIOQUEENQUEQUBUTSQUATERNIOQUARTERSQUARTERQUARTERQUARTEQUANTITQUADRUPLQUADRANTQUADRANQUADQUAQUAQUQQOXQOTQOPHQOPAQOPQOOQOQOFQOQOAQOQNQIXQITSAQITQIPQIIQIEXQIETQIEPQIEQIQHWIQHWEEQHWEQHWAAQHWAQHUQHOQHIQHEEQHEQHAAQHAQETANAQEEQEQAUQATANQARNEQARQAQQAPHQAMATSQAMATQALQAIRTHRAQAIQAFQAQADMAQAAIQAAFUQAAFQ007Q006Q005Q004Q003Q002Q001PZPYXPYTPYRXPYRPYPPYPWOYPWOOPWOPWPWIIPWIPWEEPWEPWAAPWPVPUXPUTPUSHPIKAPUSHINPURXPURITYPURPUPPUOXPUOPPUOPUNGPUNCTUATIONPUNCTUATIOPUMPPUEPUAEPU2PUPTHAHPTEPSIFISTOSYNAGMAPSIFISTOPARAKALESMAPSIFISTOPSIFISTOLYGISMAPSIPSPROVEPROTOVARYPROTOPROSGEGRAMMENIPROPORTIONAPROPORTIONPROPERTPROPELLEPROOFPROLONGEPROLATIONPROJECTIVEPROJECTIONPROGRESSPROFOUNDPRODUCTPRODUCPRIVATEPRISHTHAMATRPRINTPRINPRIMEPRIMPREVIOUPRESENTATIOPRESCRIPTIOPREPONDERANCEPRENKHAPREFACPRECEDINPRECEDESPRECEDEPRECEDEPRECEDEPRECEDPRAM-PIIPRAM-PIPRAM-MUOYPRAM-MUOPRAM-BUONPRAM-BUOPRAM-BEIPRAM-BEPRAMPRAPRPPVPPMPPAPOYPOXPOWERPOWERPOUNPOSTPOSITIOPOSTAPOSSESSIONPORRECTUSPORRECTUPOPPOPOOPONDOPOLPOLEPOKRYTIEPOKOJIPOINTOPOINTERPOINTEPOINTPOINPOETRPOETIPODATUSPOAPOPPNEUMATAPLUTOPLUS-MINUPLUSPLUMEPLUMPLUKPLOWPLOPHUPLETHRONPLASTICSPLANEPLANPLANCPLAKPLAGIOPLACEHOLDEPLACPLAPIZZICATOPIXPIWRPITCHFORKPITCHFORPITPISELEHPISCESPIRIGPIRIPIPINGPIPPINWHEEPILCROPIKURUPIKOPIGPIEXPIEUP-THIEUTHPIEUP-SSANGSIOSPIEUP-SIOS-TIKEUTPIEUP-SIOS-THIEUTHPIEUP-SIOS-PIEUPPIEUP-SIOS-KIYEOKPIEUP-SIOS-CIEUCPIEUP-RIEUL-PHIEUPHPIEUP-RIEULPIEUP-NIEUNPIEUP-MIEUMPIEUP-KHIEUKHPIEUP-CIEUCPIEUP-CHIEUCHPIEUPIEPPIECEPIEPICKPIASUTORUPIASMPIANOPPHWAPHUTHAOPHUPHUNGPHRASEPHOENICIAPHOAPHOPHPHNAEPHINTHUPHILIPPINPHIEUPH-THIEUTHPHIEUPH-SIOSPHIEUPH-PIEUPPHIEUPH-HIEUHPHIEUPPHIPHPHEEPHEPHARYNGEAPHARPHANPHAMPHAISTOPHAGS-PPHAARKAAPHAAPHAPGPFPEUXPETASTOKOUFISMAPETASTIPETASMAPETALLEPESOPESPESH2PESETPEPERTHPERSPECTIVEPERSONPERSOPERSIAPERPENDICULARPERPENDICULAPERMANENPERISPOMENIPERISPOMENPERFECTUPERFECTAPERFECTPERCUSSIVEPERCENPEPETPEPEPEORTPENTASEMEPENTAGONPENSUPENNPENIHIPENGKALPENETRATIONPENCILPELASTONPELASTOPEITHPEHEHPEHEPEHPEPEEZIPEEPPEEPEDESTRIANPEDESTALPEDESTAPEDAPEACEPEACPDPCPAZERPAYEROKPAYANNAPAYPAXPAWNPAPAVIYANIPATTERNPATHAMASATPATPATAKPATAHPATPASUQPASSIVE-PULL-UP-OUTPUPASSIVE-PULL-DOWN-OUTPUPASHTAPASEQPARTNERSHIPARTIALLY-RECYCLEPARTIAPARTHIAPARPARICHONPARESTIGMENOPARERENPARENTHESISPARENTHESIPARAPHRASPARALLELOGRAMPARALLELPARALLEPARAKLITIKIPARAKLITIKPARAKALESMPARAGRAPHOSPARAGRAPHPARAGRAPPARAPARPAPYRUSPAPEPAPPAPAPANYUKUPANYIKUPANYECEKPANYANGGAPANYAKRAPANTIPANSIOS-PIEUPPANSIOS-KAPYEOUNPIEUPPANOLONGPANGWISADPANGRANGKEPPANGLAYARPANGKONPANGKATPANGHULUPANGPANEULEUNGPANAELAENGPANPAMUNGKAHPAMUDPODPAMPHYLIAPAMINGKALPAMEPETPAMENENGPAMADAPAMAAEHPALUTAPALOCHKAPALPALLAWAPALLASPALAUNPALATALIZEPALATALIZATIONPALATAPAIYANNOIPAIRTHRAPAIREPAHLAVPADMPADPADPACKINGPAATUPAASENTOPAAIPAA-PILLAPAAP2P011P010P009P008P007P006P005P004P003AP003P002P001AP001OYRANISMOYANNAOXIAOXIOXEIAOXEIOVERRIDEOVERLONOVERLINEOVERLAYOVERLAPPINOVERLAIDOVERBAROVAOVOUTLINEOUTLINEOUTEOUNKIOUNCOTUOTTAVOTTOTHALAOTHALOSMANYORTHOGONAORTHODOORNATORNAMENTORNAMENORKHOORIGINAORIGINORDINAORCHIDOPTIOOPPRESSIONOPPOSITIONOPPOSINOPPOSEOPERATOROPERATOOPENINOPEN-POPEN-OUTLINEOPEN-HEADEOPEN-CIRCUIT-OUTPUOPEOOZEOOYANNAOOUOOMUOOBOOFILIONUONSUONNONKARONESELFONE-WAONE-LINONAPOMISSIOOMICRONOMICROOMEGAOMEGOMALONOMOLIVEOLIGOOLDOKTOKARAOKAROJIBWAOJEONOILOHMOHOHOGONEKOGONEOGHAOEKODOCTOBEROCOCCLUSIONOBSTRUCTIONOBOLOBOOBOFILIOBLIQUOBJECOBELUSOBELOSOBOAYOAKOABOAFILIOO051O050BO050AO050O049O048O047O046O045O044O043O042O041O040O039O038O037O036DO036CO036BO036AO036O035O034O033AO033O032O031O030AO030O029AO029O028O027O026O025AO025O024AO024O023O022O021O020AO020O019AO019O018O017O016O015O014O013O012O011O010CO010BO010AO010O009O008O007O006FO006EO006DO006CO006BO006AO006O005AO005O004O003O002O001AO001O-YEO-O-IO-ENZYXNZYTNZYRXNZYRNZYPNZYNZUXNZURXNZURNZUPNZUOXNZUONZUNZOXNZOPNZIXNZITNZIPNZIEXNZIEPNZIENZINZEXNZENZAXNZATNZAPNZANYWANYUXNYUTNYUPNYUOXNYUOPNYUONYUNYOXNYOTNYOPNYOONYOANYONYJANYIXNYITNYINYIPNYIN-DONYIEXNYIETNYIEPNYIENYINYNYENYEHNYENYEENYENYNYCANYAANWOONWONWIINWINWENWAANWANWNVNUXNUUNNUTILLUNUTNURXNURNUPNUOXNUOPNUONUNUZNUNUNUNGNUNAVUNUNAVINUNNUNUMERNUMERATONUMERANUMBERNUMNULLNULNUKTANUENGNUENUBIANUAENU11NU022ANU022NU021NU020NU019NU018ANU018NU017NU016NU015NU014NU013NU012NU011ANU011NU010ANU010NU009NU008NU007NU006NU005NU004NU003NU002NU001NTUUNTEENSHANRYXNRYTNRYRXNRYRNRYPNRYNRUXNRUTNRURXNRURNRUPNRUNROXNROPNRONREXNRETNREPNRENRAXNRATNRAPNRANOYNOXNOVEMBERNOTTONOTESNOTEHEADNOTEHEANOTENOTNOTCHENOTCHNOTNOSENORTHWESNORTNORMANONOPNOONUNOONONFORKINGNON-JOINERNON-BREAKINNOMINANOKHUKNODENOANO-BREANNONNNANNGOONNGONNGIINNGINNGAANNGANNGNMNL020NL019NL018NL017ANL017NL016NL015NL014NL013NL012NL011NL010NL009NL008NL007NL006NL005ANL005NL004NL003NL002NL001NKNJYXNJYTNJYRXNJYRNJYPNJYNJUXNJURXNJURNJUPNJUOXNJUONJUAENJUNJOXNJOTNJOPNJOONJONJIXNJITNJIPNJIEXNJIETNJIEPNJIENJINJEENJENJAEMLINJAEMNJNIXNISAGNIRUGUNIPNINTHNINETYNINETNINETEENNINETEENINNINDA2NINDANIMNINIKHAHITNIKAHITNIINIHSHVASANIGIDAMINNIGIDAESHNIGHTNIGGAHITANIEXNIEUN-TIKEUTNIEUN-THIEUTHNIEUN-SIOSNIEUN-RIEULNIEUN-PIEUPNIEUN-PANSIOSNIEUN-KIYEOKNIEUN-HIEUHNIEUN-CIEUCNIEUN-CHIEUCHNIEUNIEPNIENIBNIANI2NHUENHJANHANHNGYENGVENGUOXNGUOTNGUONGOXNGOUNGONGOTNGOPNGONNGOEHNGOENGNGKWAENNGKANGIEXNGIEPNGIENGGUNGGOONGGONGGINGGENNGGEENGGENGGNGEXNGEPNGENNGEADALNGENGAXNGATNGANGAPNGANNGAINGAAINGNFNEXNEXNEWLINENEUTRANEUTERNETNENESTENEQUDAANEPTUNENEPNEONENENANONENNEITHENEGATIVNEGATIONEGATENEENEBENSTIMMENDUXNDUTNDURXNDURNDUPNDOXNDOTNDOPNDOONDOLNDIXNDITNDIPNDIEXNDIENDINDEXNDEPNDEENDENDAXNDATNDAPNDAANBYXNBYTNBYRXNBYRNBYPNBYNBUXNBUTNBURXNBURNBUPNBUNBOXNBOTNBOPNBONBIXNBITNBIPNBIEXNBIEPNBIENBINBAXNBATNBAPNBANAYANNANAYNAXIANAXNAUTHSNAUDINATURANATIONANASKAPNASHINASALIZATIONARRONARNAONANGMONTHONANDNANANAMENAMNAM2NAMNAIRNAGRNAGARNAGANAGNAGNANABLANAASIKYAYANAAKSIKYAYANAAINAANANA2N042N041N040N039N038N037AN037N036N035AN035N034AN034N033AN033N032N031N030N029N028N027N026N025AN025N024N023N022N021N020N019N018BN018AN018N017N016N015N014N013N012N011N010N009N008N007N006N005N004N003N002N001N-CREN-ARMYXMYTMYSLITEMYPMYAMYMYMWOOMWOMWIIMWIMWEEMWEMWAAMWAMWMMVMMUXMUUSIKATOANMUURDHAJMUTMUSICMUSIMUSH3MUSHMUSHMUSMURXMURGU2MUREMURDAMURDMURMUQDAMMUPMUOXMUOTMUOPMUOMUNSUBMUNAHMULTISETMULTISEMULTIPLICATIONMULTIPLICATIOMULTIPLMULTIOCULAMULTIMAPMULTMUKPHRENGMUINMUGMUMUEMUCMUCAADMUANMU-GAAHLAMMSMPAMOXMOVEMOUTHMOUTMOUNTAINMOUNDMOUNMOTHERMOTMORTARMORPHOLOGICAMORNINGMOPMOOSE-CREMOONMOOMOOMONTHMONTMONOSTABLMONOGRAPMONOGRAMMOMONOGRAMONOFONIASMONOCULAMOMOLMOHAMMAMODULMODESTYMODELSMODELMOAMMNYAMNASMMMMLAMLMIXMITMIMISRAMIRIBAARUMIRIMIREDMIPMINYMINUS-OR-PLUMINUSMINISTERMINIMAMIMEMIMMILLIONMILLETMILLMILMILMIKURONMIKROMIKRIMIINMIIMIMIEXMIEUM-TIKEUTMIEUM-SSANGSIOSMIEUM-SSANGNIEUNMIEUM-RIEULMIEUM-PIEUP-SIOSMIEUM-PIEUPMIEUM-PANSIOSMIEUM-NIEUNMIEUM-CIEUCMIEUM-CHIEUCHMIEUMIEPMIEMIDLINMIDDLE-WELSMIDDLMIMICRMIMHZMHMGUXMGUTMGURXMGURMGUPMGUOXMGUOPMGUOMGUMGOXMGOTMGOPMGOMGMGIEXMGIEMGEXMGEPMGEMGBUMGBOOMGBOMGBIMGBEEMGBEMGBAMGAXMGATMGAPMGAMGMEZZOMEXMETRICAMETRIAMETRETEMETOBELUSMETEGMETALMETMESSENIAMESOMESIMESHMERKHAMERKHMERIMERGEMERCURYMENDUTMENMEMEMBERSHIPMEMBERMEMBEMEM-QOPHMEMMEMELONMELODIMELIKMEIZIMEGATONMEGALIMEETORUMEETEMEETMEEMUMEEMMEEEEMEEMEDIUMMEDIUMEDICINEMEATMEASUREMEASUREMEASURMDUMCHMBUMBOOMBOMBIMBENMBEEMBEMBAAMB4MB3MB2MBMMAYEMAYANNAMAYMAXIMAMAXMATTOCKMATRIXMATERIALSMATMASMASSINGMASORMASHFAATMASH2MASCULINMARUKUMARTYRIMARRYINMARRIAGMARKERMARK-4MARK-3MARK-2MARK-1MAREMARCHMARCATO-STACCATOMARCATOMARBUTAMARBUTMARMAQAFMAPIQMAMANSYONMANNAMANNAMANGALAMMANCHMANACLESMALTESMALEMALMALAKOMAKSURAMAIYAMOKMAITAIKHUMAIRUMAIMUANMAIMALAIMAIKUROMAIDENMAHJONMAHHAMAHAPRANAMAHAPAKHMAHAAPRAANMAHMADYAMADUMADDAMADDAMADDMACRON-GRAVEMACRON-BREVEMACRON-ACUTEMACRONMACROMAAIMAAMA2M044M043M042M041M040AM040M039M038M037M036M035M034M033BM033AM033M032M031AM031M030M029M028AM028M027M026M025M024AM024M023M022AM022M021M020M019M018M017AM017M016AM016M015AM015M014M013M012HM012GM012FM012EM012DM012CM012BM012AM012M011M010AM010M009M008M007M006M005M004M003AM003M002M001BM001AM001LLYYLYXLYTLYRXLYRLYPLYDIALYCIALXLWOOLWOLWIILWILWELWAALWALUXLUTLURXLUPLUOXLUOTLUOPLUOLUNGSILUNATLULULLUISLUHURLUHLUGALLUGALUELU3LU2LULOZENGELOZENGLOXLOWELOW-LOURELOTUSLOTLORRAINELOQLOPLOOTLOOPLOOLONSUMLONGALONGLONG-BRANCH-YRLONG-BRANCH-SOLONG-BRANCH-OSLONG-BRANCH-MADLONG-BRANCH-HAGALLONG-BRANCH-ALOLLLOGLOGOTYPLOGOGRALOGLOCATIVELOCATIOLOALNLMLLLALJUDIJELJELJLIXLIWNLIVRLITTLLITRLITLISLISHLIRLIQUILIPLINKINLINLINGSALINESLINELINE-9LINE-7LINE-3LINE-1LIMMU4LIMMU2LIMMULIMMLIMITELIMITATIONLIMITLILYLILITHLILLIILIGHTNINGLIGHTHOUSELIGHTLIFELIEXLIETLIEPLIELIDLIBRALIABILITLHIILHAVIYANILHALHAALHLEZHLEXLEVELETTERLESSELESS-THANLESS-THALEPLEOLENTICULALENISLENGTHENERLENGTLENGALENGLEMOILELETLELELELEIMMALEIMMLEGSLEGIONLEGETOLEGLEFTWARDSLEFT-TO-RIGHLEFT-STELEFT-SIDLEFT-SHADELEFT-POINTINLEFT-HANLEFT-FACINLEFTLEEKLEEEELEATHERLEAFLEADERLDANLD2LCLCLAZLAYANNALAXLALAULALAUKALATINATLATIKLATERALATLATLASLARYNGEALARGELARGLAPLANGUAGLANESLAMEDHLAMEDLAMELAMELAMLAMDALAMDLAMBDLAMADHLALLALAKKHANGYAOLAJANYALANLALAHSHULAGUSLAGLAGARLAGALAGABLAGALAEVLAELACKLACALABOURINGLABORLABIALIZATIOLABATLAANLAAMULAAIL006AL002AL-TYPL-SHAPEKYURIIKYUKYOKYLISMAKYIKYEEKYEKYATHOKYAAKYAKXWIKXWEEKXWEKXWAAKXWAKXUKXOKXIKXEEKXEKXAAKXAKWU318KWOOKWOKWIIKWIKWEEKWEKWAYKWAAKVAKVKUXKUUHKUTKUSMAKUSHU2KURXKURUZEIROKURTKUROONEKURKUKUPKUOXKUOPKUOKUNGKUNDDALIYAKULKUKU7KU4KUKU3KUKTKSSAKSIKREMASTIKRATIMOYPORROONKRATIMOKOUFISMAKRATIMATAKRATIMKPUKPOOKPOKPIKPENKPEEKPEKPANKPAKOXKOVUUKOTOKORUNAKORONISKOREAKORANIKOQNDONKOPPAKOPKOOPOKOOMUUTKOOKONTEVMAKONTEVMKOMKOMBUVAKOMBUVKOMBKOKKOKOIKOKOHKOGHOMKOETKOAKNIGHTKNIFEKNIFKMKKLITONKLASMAKLASMKLAKLKKUKKOKKIKKEEKKEKKAKKKJEKIYEOK-TIKEUTKIYEOK-SIOS-KIYEOKKIYEOK-RIEULKIYEOK-PIEUPKIYEOK-NIEUNKIYEOK-KHIEUKHKIYEOK-CHIEUCHKIYEOKIXKITKISIM5KISIMKISHKISALKIROWATTOKIROMEETORUKIROGURAMUKIROKIRGHIKIPKIKINSHIPKINDERGARTENKIIKIHKIEXKIEPKIEKIDKIKICKKHZKHWAIKHUEN-LUKHUEKHUATKHOUKHOKHONKHOMUTKHOKHKHITKHIEUKKHIKHHOKHHAKHETHKHEIKHEEKHEKHARKHAPHKHANKHANDKHANKHAMTKHAKASSIAKHAIKHAHKHAKHAAKGKEYCAPKEYBOARDKEYKEKEXKEUXKETTKESH2KERETKEOWKENTIMATAKENTIMATKENTIMKENATKENKEMPULKEMPUKEMPLIKEMPLKEMPHRENGKEMBANGKELVIKEHEHKEHEKEHKEFULAKEESUKEEPINKEENGKCALKBKAZAKKAYANNAKAYAKAXKAWIKAVYKAKAUNAKAUKATOKATHISTIKATHAKKATAVASMAKATAVKATAKANA-HIRAGANKASRATANKASRATAKASRAKASRKASKALKASKAKASHMIRKARSHANAKARORIIKAREKARATTOKARANKAPYEOUNSSANGPIEUPKAPYEOUNRIEULKAPYEOUNPHIEUPHKAPYEOUNMIEUMKAPPAKAPPKAPOKAPHKAPALKAPAKAPKANTAJKANGKANKANAKOKAM4KAM2KAKOKAKABATKAKKAKAIRIKAIKAKAFKAKAD5KADKAD4KAD3KADKAD2KABKABKAAIKAAFUKAAFKA2KAK008K007K006K005K004K003K002K001JWAJUUJUTJUPITERJUOTJUOPJUNOJUNEJULYJUEUIJUDGEJUDEO-SPANISJOYOUJOYJOJONGJONJOKERJOINEDJOINJOAJJYXJJYTJJYPJJYJJUXJJUTJJURXJJURJJUPJJUOXJJUOPJJUOJJUJJOXJJOTJJOPJJOJJIXJJITJJIPJJIEXJJIETJJIEPJJIEJJIJJEEJJEJJAJILJIHVAMULIYAJIAJHOJHEHJHANJHAMJHAJEUJERUSALEMJERAJERAJERJEHJEJEGOGANJEEMJAYANNAJAVIYANIJARJAPANESJANUARYJALLAJALALOUHOUJADEJAAJ-SIMPLIFIEIZHITSAIZHITSIZHEIYEKIYANNAIUJAIUITERATIOITEMISSHARISISONISOISEN-ISENISAKIIS-PILLAIRUYANNAIRUUYANNAIOTIFIEIOTATEIOTAIOTIORIODHADHINVISIBLINVERTEDINVERTEINVERSINTIINTERSYLLABIINTERSECTIONINTERSECTIOINTERSECTININTERROBANGINTERPOLATIOINTERLOCKEINTERLINEAINTERIOINTERESINTERCALATEINTEGRATIONINTEGRATIOINTEGRALINTEGRAINSULAINSTRUMENTAINSIDEINSERTIOINSECTINSCRIPTIONAINNOCENCEINNNINNERINNEINNININGUINIINHIBIINHERENINGWAZINFORMATIOINFLUENCEINFINITYINFINITINDUSTRIAINDIRECINDICATORINDIINDEXINDEPENDENINCREMENTINCREASEINCREASEINCOMPLETINCLUDININCHINAPIN-ALAFIMPERIAIMPERFECTUIMPERFECTAIMPERFECTIMISEOIMIN3IMINIMIIMIFTHORONIMIFTHORAIMIFONONIMIDIARGONIMAGILUYANNAILUYILUUYANNAILUTILIMMU4ILIMMU3ILIMMUILIMMIL2IKARAIKARIJIIYANNAIGIIGIGGWSIFINIEUNG-TIKEUTIEUNG-THIEUTHIEUNG-SSANGKIYEOKIEUNG-RIEULIEUNG-PIEUPIEUNG-PHIEUPHIEUNG-KIYEOKIEUNG-KHIEUKHIEUNG-CIEUCIEUNG-CHIEUCHIEUNIDLEIDIMIDIIDEOGRAPH-FAD9IDEOGRAPH-FAD8IDEOGRAPH-FAD7IDEOGRAPH-FAD6IDEOGRAPH-FAD5IDEOGRAPH-FAD4IDEOGRAPH-FAD3IDEOGRAPH-FAD2IDEOGRAPH-FAD1IDEOGRAPH-FAD0IDEOGRAPH-FACFIDEOGRAPH-FACEIDEOGRAPH-FACDIDEOGRAPH-FACCIDEOGRAPH-FACBIDEOGRAPH-FACAIDEOGRAPH-FAC9IDEOGRAPH-FAC8IDEOGRAPH-FAC7IDEOGRAPH-FAC6IDEOGRAPH-FAC5IDEOGRAPH-FAC4IDEOGRAPH-FAC3IDEOGRAPH-FAC2IDEOGRAPH-FAC1IDEOGRAPH-FAC0IDEOGRAPH-FABFIDEOGRAPH-FABEIDEOGRAPH-FABDIDEOGRAPH-FABCIDEOGRAPH-FABBIDEOGRAPH-FABAIDEOGRAPH-FAB9IDEOGRAPH-FAB8IDEOGRAPH-FAB7IDEOGRAPH-FAB6IDEOGRAPH-FAB5IDEOGRAPH-FAB4IDEOGRAPH-FAB3IDEOGRAPH-FAB2IDEOGRAPH-FAB1IDEOGRAPH-FAB0IDEOGRAPH-FAAFIDEOGRAPH-FAAEIDEOGRAPH-FAADIDEOGRAPH-FAACIDEOGRAPH-FAABIDEOGRAPH-FAAAIDEOGRAPH-FAA9IDEOGRAPH-FAA8IDEOGRAPH-FAA7IDEOGRAPH-FAA6IDEOGRAPH-FAA5IDEOGRAPH-FAA4IDEOGRAPH-FAA3IDEOGRAPH-FAA2IDEOGRAPH-FAA1IDEOGRAPH-FAA0IDEOGRAPH-FA9FIDEOGRAPH-FA9EIDEOGRAPH-FA9DIDEOGRAPH-FA9CIDEOGRAPH-FA9BIDEOGRAPH-FA9AIDEOGRAPH-FA99IDEOGRAPH-FA98IDEOGRAPH-FA97IDEOGRAPH-FA96IDEOGRAPH-FA95IDEOGRAPH-FA94IDEOGRAPH-FA93IDEOGRAPH-FA92IDEOGRAPH-FA91IDEOGRAPH-FA90IDEOGRAPH-FA8FIDEOGRAPH-FA8EIDEOGRAPH-FA8DIDEOGRAPH-FA8CIDEOGRAPH-FA8BIDEOGRAPH-FA8AIDEOGRAPH-FA89IDEOGRAPH-FA88IDEOGRAPH-FA87IDEOGRAPH-FA86IDEOGRAPH-FA85IDEOGRAPH-FA84IDEOGRAPH-FA83IDEOGRAPH-FA82IDEOGRAPH-FA81IDEOGRAPH-FA80IDEOGRAPH-FA7FIDEOGRAPH-FA7EIDEOGRAPH-FA7DIDEOGRAPH-FA7CIDEOGRAPH-FA7BIDEOGRAPH-FA7AIDEOGRAPH-FA79IDEOGRAPH-FA78IDEOGRAPH-FA77IDEOGRAPH-FA76IDEOGRAPH-FA75IDEOGRAPH-FA74IDEOGRAPH-FA73IDEOGRAPH-FA72IDEOGRAPH-FA71IDEOGRAPH-FA70IDEOGRAPH-FA6DIDEOGRAPH-FA6CIDEOGRAPH-FA6BIDEOGRAPH-FA6AIDEOGRAPH-FA69IDEOGRAPH-FA68IDEOGRAPH-FA67IDEOGRAPH-FA66IDEOGRAPH-FA65IDEOGRAPH-FA64IDEOGRAPH-FA63IDEOGRAPH-FA62IDEOGRAPH-FA61IDEOGRAPH-FA60IDEOGRAPH-FA5FIDEOGRAPH-FA5EIDEOGRAPH-FA5DIDEOGRAPH-FA5CIDEOGRAPH-FA5BIDEOGRAPH-FA5AIDEOGRAPH-FA59IDEOGRAPH-FA58IDEOGRAPH-FA57IDEOGRAPH-FA56IDEOGRAPH-FA55IDEOGRAPH-FA54IDEOGRAPH-FA53IDEOGRAPH-FA52IDEOGRAPH-FA51IDEOGRAPH-FA50IDEOGRAPH-FA4FIDEOGRAPH-FA4EIDEOGRAPH-FA4DIDEOGRAPH-FA4CIDEOGRAPH-FA4BIDEOGRAPH-FA4AIDEOGRAPH-FA49IDEOGRAPH-FA48IDEOGRAPH-FA47IDEOGRAPH-FA46IDEOGRAPH-FA45IDEOGRAPH-FA44IDEOGRAPH-FA43IDEOGRAPH-FA42IDEOGRAPH-FA41IDEOGRAPH-FA40IDEOGRAPH-FA3FIDEOGRAPH-FA3EIDEOGRAPH-FA3DIDEOGRAPH-FA3CIDEOGRAPH-FA3BIDEOGRAPH-FA3AIDEOGRAPH-FA39IDEOGRAPH-FA38IDEOGRAPH-FA37IDEOGRAPH-FA36IDEOGRAPH-FA35IDEOGRAPH-FA34IDEOGRAPH-FA33IDEOGRAPH-FA32IDEOGRAPH-FA31IDEOGRAPH-FA30IDEOGRAPH-FA2DIDEOGRAPH-FA2CIDEOGRAPH-FA2BIDEOGRAPH-FA2AIDEOGRAPH-FA29IDEOGRAPH-FA28IDEOGRAPH-FA27IDEOGRAPH-FA26IDEOGRAPH-FA25IDEOGRAPH-FA24IDEOGRAPH-FA23IDEOGRAPH-FA22IDEOGRAPH-FA21IDEOGRAPH-FA20IDEOGRAPH-FA1FIDEOGRAPH-FA1EIDEOGRAPH-FA1DIDEOGRAPH-FA1CIDEOGRAPH-FA1BIDEOGRAPH-FA1AIDEOGRAPH-FA19IDEOGRAPH-FA18IDEOGRAPH-FA17IDEOGRAPH-FA16IDEOGRAPH-FA15IDEOGRAPH-FA14IDEOGRAPH-FA13IDEOGRAPH-FA12IDEOGRAPH-FA11IDEOGRAPH-FA10IDEOGRAPH-FA0FIDEOGRAPH-FA0EIDEOGRAPH-FA0DIDEOGRAPH-FA0CIDEOGRAPH-FA0BIDEOGRAPH-FA0AIDEOGRAPH-FA09IDEOGRAPH-FA08IDEOGRAPH-FA07IDEOGRAPH-FA06IDEOGRAPH-FA05IDEOGRAPH-FA04IDEOGRAPH-FA03IDEOGRAPH-FA02IDEOGRAPH-FA01IDEOGRAPH-FA00IDEOGRAPH-F9FFIDEOGRAPH-F9FEIDEOGRAPH-F9FDIDEOGRAPH-F9FCIDEOGRAPH-F9FBIDEOGRAPH-F9FAIDEOGRAPH-F9F9IDEOGRAPH-F9F8IDEOGRAPH-F9F7IDEOGRAPH-F9F6IDEOGRAPH-F9F5IDEOGRAPH-F9F4IDEOGRAPH-F9F3IDEOGRAPH-F9F2IDEOGRAPH-F9F1IDEOGRAPH-F9F0IDEOGRAPH-F9EFIDEOGRAPH-F9EEIDEOGRAPH-F9EDIDEOGRAPH-F9ECIDEOGRAPH-F9EBIDEOGRAPH-F9EAIDEOGRAPH-F9E9IDEOGRAPH-F9E8IDEOGRAPH-F9E7IDEOGRAPH-F9E6IDEOGRAPH-F9E5IDEOGRAPH-F9E4IDEOGRAPH-F9E3IDEOGRAPH-F9E2IDEOGRAPH-F9E1IDEOGRAPH-F9E0IDEOGRAPH-F9DFIDEOGRAPH-F9DEIDEOGRAPH-F9DDIDEOGRAPH-F9DCIDEOGRAPH-F9DBIDEOGRAPH-F9DAIDEOGRAPH-F9D9IDEOGRAPH-F9D8IDEOGRAPH-F9D7IDEOGRAPH-F9D6IDEOGRAPH-F9D5IDEOGRAPH-F9D4IDEOGRAPH-F9D3IDEOGRAPH-F9D2IDEOGRAPH-F9D1IDEOGRAPH-F9D0IDEOGRAPH-F9CFIDEOGRAPH-F9CEIDEOGRAPH-F9CDIDEOGRAPH-F9CCIDEOGRAPH-F9CBIDEOGRAPH-F9CAIDEOGRAPH-F9C9IDEOGRAPH-F9C8IDEOGRAPH-F9C7IDEOGRAPH-F9C6IDEOGRAPH-F9C5IDEOGRAPH-F9C4IDEOGRAPH-F9C3IDEOGRAPH-F9C2IDEOGRAPH-F9C1IDEOGRAPH-F9C0IDEOGRAPH-F9BFIDEOGRAPH-F9BEIDEOGRAPH-F9BDIDEOGRAPH-F9BCIDEOGRAPH-F9BBIDEOGRAPH-F9BAIDEOGRAPH-F9B9IDEOGRAPH-F9B8IDEOGRAPH-F9B7IDEOGRAPH-F9B6IDEOGRAPH-F9B5IDEOGRAPH-F9B4IDEOGRAPH-F9B3IDEOGRAPH-F9B2IDEOGRAPH-F9B1IDEOGRAPH-F9B0IDEOGRAPH-F9AFIDEOGRAPH-F9AEIDEOGRAPH-F9ADIDEOGRAPH-F9ACIDEOGRAPH-F9ABIDEOGRAPH-F9AAIDEOGRAPH-F9A9IDEOGRAPH-F9A8IDEOGRAPH-F9A7IDEOGRAPH-F9A6IDEOGRAPH-F9A5IDEOGRAPH-F9A4IDEOGRAPH-F9A3IDEOGRAPH-F9A2IDEOGRAPH-F9A1IDEOGRAPH-F9A0IDEOGRAPH-F99FIDEOGRAPH-F99EIDEOGRAPH-F99DIDEOGRAPH-F99CIDEOGRAPH-F99BIDEOGRAPH-F99AIDEOGRAPH-F999IDEOGRAPH-F998IDEOGRAPH-F997IDEOGRAPH-F996IDEOGRAPH-F995IDEOGRAPH-F994IDEOGRAPH-F993IDEOGRAPH-F992IDEOGRAPH-F991IDEOGRAPH-F990IDEOGRAPH-F98FIDEOGRAPH-F98EIDEOGRAPH-F98DIDEOGRAPH-F98CIDEOGRAPH-F98BIDEOGRAPH-F98AIDEOGRAPH-F989IDEOGRAPH-F988IDEOGRAPH-F987IDEOGRAPH-F986IDEOGRAPH-F985IDEOGRAPH-F984IDEOGRAPH-F983IDEOGRAPH-F982IDEOGRAPH-F981IDEOGRAPH-F980IDEOGRAPH-F97FIDEOGRAPH-F97EIDEOGRAPH-F97DIDEOGRAPH-F97CIDEOGRAPH-F97BIDEOGRAPH-F97AIDEOGRAPH-F979IDEOGRAPH-F978IDEOGRAPH-F977IDEOGRAPH-F976IDEOGRAPH-F975IDEOGRAPH-F974IDEOGRAPH-F973IDEOGRAPH-F972IDEOGRAPH-F971IDEOGRAPH-F970IDEOGRAPH-F96FIDEOGRAPH-F96EIDEOGRAPH-F96DIDEOGRAPH-F96CIDEOGRAPH-F96BIDEOGRAPH-F96AIDEOGRAPH-F969IDEOGRAPH-F968IDEOGRAPH-F967IDEOGRAPH-F966IDEOGRAPH-F965IDEOGRAPH-F964IDEOGRAPH-F963IDEOGRAPH-F962IDEOGRAPH-F961IDEOGRAPH-F960IDEOGRAPH-F95FIDEOGRAPH-F95EIDEOGRAPH-F95DIDEOGRAPH-F95CIDEOGRAPH-F95BIDEOGRAPH-F95AIDEOGRAPH-F959IDEOGRAPH-F958IDEOGRAPH-F957IDEOGRAPH-F956IDEOGRAPH-F955IDEOGRAPH-F954IDEOGRAPH-F953IDEOGRAPH-F952IDEOGRAPH-F951IDEOGRAPH-F950IDEOGRAPH-F94FIDEOGRAPH-F94EIDEOGRAPH-F94DIDEOGRAPH-F94CIDEOGRAPH-F94BIDEOGRAPH-F94AIDEOGRAPH-F949IDEOGRAPH-F948IDEOGRAPH-F947IDEOGRAPH-F946IDEOGRAPH-F945IDEOGRAPH-F944IDEOGRAPH-F943IDEOGRAPH-F942IDEOGRAPH-F941IDEOGRAPH-F940IDEOGRAPH-F93FIDEOGRAPH-F93EIDEOGRAPH-F93DIDEOGRAPH-F93CIDEOGRAPH-F93BIDEOGRAPH-F93AIDEOGRAPH-F939IDEOGRAPH-F938IDEOGRAPH-F937IDEOGRAPH-F936IDEOGRAPH-F935IDEOGRAPH-F934IDEOGRAPH-F933IDEOGRAPH-F932IDEOGRAPH-F931IDEOGRAPH-F930IDEOGRAPH-F92FIDEOGRAPH-F92EIDEOGRAPH-F92DIDEOGRAPH-F92CIDEOGRAPH-F92BIDEOGRAPH-F92AIDEOGRAPH-F929IDEOGRAPH-F928IDEOGRAPH-F927IDEOGRAPH-F926IDEOGRAPH-F925IDEOGRAPH-F924IDEOGRAPH-F923IDEOGRAPH-F922IDEOGRAPH-F921IDEOGRAPH-F920IDEOGRAPH-F91FIDEOGRAPH-F91EIDEOGRAPH-F91DIDEOGRAPH-F91CIDEOGRAPH-F91BIDEOGRAPH-F91AIDEOGRAPH-F919IDEOGRAPH-F918IDEOGRAPH-F917IDEOGRAPH-F916IDEOGRAPH-F915IDEOGRAPH-F914IDEOGRAPH-F913IDEOGRAPH-F912IDEOGRAPH-F911IDEOGRAPH-F910IDEOGRAPH-F90FIDEOGRAPH-F90EIDEOGRAPH-F90DIDEOGRAPH-F90CIDEOGRAPH-F90BIDEOGRAPH-F90AIDEOGRAPH-F909IDEOGRAPH-F908IDEOGRAPH-F907IDEOGRAPH-F906IDEOGRAPH-F905IDEOGRAPH-F904IDEOGRAPH-F903IDEOGRAPH-F902IDEOGRAPH-F901IDEOGRAPH-F900IDEOGRAPH-904AIDEOGRAPH-8D70IDEOGRAPH-8CA9IDEOGRAPH-89E3IDEOGRAPH-7D42IDEOGRAPH-76D7IDEOGRAPH-751FIDEOGRAPH-7121IDEOGRAPH-70B9IDEOGRAPH-6F14IDEOGRAPH-672CIDEOGRAPH-6620IDEOGRAPH-65B0IDEOGRAPH-6599IDEOGRAPH-6557IDEOGRAPH-6355IDEOGRAPH-6307IDEOGRAPH-6295IDEOGRAPH-6253IDEOGRAPH-624BIDEOGRAPH-5F8CIDEOGRAPH-5DE6IDEOGRAPH-5B89IDEOGRAPH-5B57IDEOGRAPH-5929IDEOGRAPH-591AIDEOGRAPH-58F0IDEOGRAPH-5439IDEOGRAPH-53F3IDEOGRAPH-53CCIDEOGRAPH-52DDIDEOGRAPH-524DIDEOGRAPH-521DIDEOGRAPH-518DIDEOGRAPH-4EA4IDEOGRAPH-4E8CIDEOGRAPH-4E2DIDEOGRAPH-4E09IDEOGRAPH-4E00IDEOGRAPH-2FA1DIDEOGRAPH-2FA1CIDEOGRAPH-2FA1BIDEOGRAPH-2FA1AIDEOGRAPH-2FA19IDEOGRAPH-2FA18IDEOGRAPH-2FA17IDEOGRAPH-2FA16IDEOGRAPH-2FA15IDEOGRAPH-2FA14IDEOGRAPH-2FA13IDEOGRAPH-2FA12IDEOGRAPH-2FA11IDEOGRAPH-2FA10IDEOGRAPH-2FA0FIDEOGRAPH-2FA0EIDEOGRAPH-2FA0DIDEOGRAPH-2FA0CIDEOGRAPH-2FA0BIDEOGRAPH-2FA0AIDEOGRAPH-2FA09IDEOGRAPH-2FA08IDEOGRAPH-2FA07IDEOGRAPH-2FA06IDEOGRAPH-2FA05IDEOGRAPH-2FA04IDEOGRAPH-2FA03IDEOGRAPH-2FA02IDEOGRAPH-2FA01IDEOGRAPH-2FA00IDEOGRAPH-2F9FFIDEOGRAPH-2F9FEIDEOGRAPH-2F9FDIDEOGRAPH-2F9FCIDEOGRAPH-2F9FBIDEOGRAPH-2F9FAIDEOGRAPH-2F9F9IDEOGRAPH-2F9F8IDEOGRAPH-2F9F7IDEOGRAPH-2F9F6IDEOGRAPH-2F9F5IDEOGRAPH-2F9F4IDEOGRAPH-2F9F3IDEOGRAPH-2F9F2IDEOGRAPH-2F9F1IDEOGRAPH-2F9F0IDEOGRAPH-2F9EFIDEOGRAPH-2F9EEIDEOGRAPH-2F9EDIDEOGRAPH-2F9ECIDEOGRAPH-2F9EBIDEOGRAPH-2F9EAIDEOGRAPH-2F9E9IDEOGRAPH-2F9E8IDEOGRAPH-2F9E7IDEOGRAPH-2F9E6IDEOGRAPH-2F9E5IDEOGRAPH-2F9E4IDEOGRAPH-2F9E3IDEOGRAPH-2F9E2IDEOGRAPH-2F9E1IDEOGRAPH-2F9E0IDEOGRAPH-2F9DFIDEOGRAPH-2F9DEIDEOGRAPH-2F9DDIDEOGRAPH-2F9DCIDEOGRAPH-2F9DBIDEOGRAPH-2F9DAIDEOGRAPH-2F9D9IDEOGRAPH-2F9D8IDEOGRAPH-2F9D7IDEOGRAPH-2F9D6IDEOGRAPH-2F9D5IDEOGRAPH-2F9D4IDEOGRAPH-2F9D3IDEOGRAPH-2F9D2IDEOGRAPH-2F9D1IDEOGRAPH-2F9D0IDEOGRAPH-2F9CFIDEOGRAPH-2F9CEIDEOGRAPH-2F9CDIDEOGRAPH-2F9CCIDEOGRAPH-2F9CBIDEOGRAPH-2F9CAIDEOGRAPH-2F9C9IDEOGRAPH-2F9C8IDEOGRAPH-2F9C7IDEOGRAPH-2F9C6IDEOGRAPH-2F9C5IDEOGRAPH-2F9C4IDEOGRAPH-2F9C3IDEOGRAPH-2F9C2IDEOGRAPH-2F9C1IDEOGRAPH-2F9C0IDEOGRAPH-2F9BFIDEOGRAPH-2F9BEIDEOGRAPH-2F9BDIDEOGRAPH-2F9BCIDEOGRAPH-2F9BBIDEOGRAPH-2F9BAIDEOGRAPH-2F9B9IDEOGRAPH-2F9B8IDEOGRAPH-2F9B7IDEOGRAPH-2F9B6IDEOGRAPH-2F9B5IDEOGRAPH-2F9B4IDEOGRAPH-2F9B3IDEOGRAPH-2F9B2IDEOGRAPH-2F9B1IDEOGRAPH-2F9B0IDEOGRAPH-2F9AFIDEOGRAPH-2F9AEIDEOGRAPH-2F9ADIDEOGRAPH-2F9ACIDEOGRAPH-2F9ABIDEOGRAPH-2F9AAIDEOGRAPH-2F9A9IDEOGRAPH-2F9A8IDEOGRAPH-2F9A7IDEOGRAPH-2F9A6IDEOGRAPH-2F9A5IDEOGRAPH-2F9A4IDEOGRAPH-2F9A3IDEOGRAPH-2F9A2IDEOGRAPH-2F9A1IDEOGRAPH-2F9A0IDEOGRAPH-2F99FIDEOGRAPH-2F99EIDEOGRAPH-2F99DIDEOGRAPH-2F99CIDEOGRAPH-2F99BIDEOGRAPH-2F99AIDEOGRAPH-2F999IDEOGRAPH-2F998IDEOGRAPH-2F997IDEOGRAPH-2F996IDEOGRAPH-2F995IDEOGRAPH-2F994IDEOGRAPH-2F993IDEOGRAPH-2F992IDEOGRAPH-2F991IDEOGRAPH-2F990IDEOGRAPH-2F98FIDEOGRAPH-2F98EIDEOGRAPH-2F98DIDEOGRAPH-2F98CIDEOGRAPH-2F98BIDEOGRAPH-2F98AIDEOGRAPH-2F989IDEOGRAPH-2F988IDEOGRAPH-2F987IDEOGRAPH-2F986IDEOGRAPH-2F985IDEOGRAPH-2F984IDEOGRAPH-2F983IDEOGRAPH-2F982IDEOGRAPH-2F981IDEOGRAPH-2F980IDEOGRAPH-2F97FIDEOGRAPH-2F97EIDEOGRAPH-2F97DIDEOGRAPH-2F97CIDEOGRAPH-2F97BIDEOGRAPH-2F97AIDEOGRAPH-2F979IDEOGRAPH-2F978IDEOGRAPH-2F977IDEOGRAPH-2F976IDEOGRAPH-2F975IDEOGRAPH-2F974IDEOGRAPH-2F973IDEOGRAPH-2F972IDEOGRAPH-2F971IDEOGRAPH-2F970IDEOGRAPH-2F96FIDEOGRAPH-2F96EIDEOGRAPH-2F96DIDEOGRAPH-2F96CIDEOGRAPH-2F96BIDEOGRAPH-2F96AIDEOGRAPH-2F969IDEOGRAPH-2F968IDEOGRAPH-2F967IDEOGRAPH-2F966IDEOGRAPH-2F965IDEOGRAPH-2F964IDEOGRAPH-2F963IDEOGRAPH-2F962IDEOGRAPH-2F961IDEOGRAPH-2F960IDEOGRAPH-2F95FIDEOGRAPH-2F95EIDEOGRAPH-2F95DIDEOGRAPH-2F95CIDEOGRAPH-2F95BIDEOGRAPH-2F95AIDEOGRAPH-2F959IDEOGRAPH-2F958IDEOGRAPH-2F957IDEOGRAPH-2F956IDEOGRAPH-2F955IDEOGRAPH-2F954IDEOGRAPH-2F953IDEOGRAPH-2F952IDEOGRAPH-2F951IDEOGRAPH-2F950IDEOGRAPH-2F94FIDEOGRAPH-2F94EIDEOGRAPH-2F94DIDEOGRAPH-2F94CIDEOGRAPH-2F94BIDEOGRAPH-2F94AIDEOGRAPH-2F949IDEOGRAPH-2F948IDEOGRAPH-2F947IDEOGRAPH-2F946IDEOGRAPH-2F945IDEOGRAPH-2F944IDEOGRAPH-2F943IDEOGRAPH-2F942IDEOGRAPH-2F941IDEOGRAPH-2F940IDEOGRAPH-2F93FIDEOGRAPH-2F93EIDEOGRAPH-2F93DIDEOGRAPH-2F93CIDEOGRAPH-2F93BIDEOGRAPH-2F93AIDEOGRAPH-2F939IDEOGRAPH-2F938IDEOGRAPH-2F937IDEOGRAPH-2F936IDEOGRAPH-2F935IDEOGRAPH-2F934IDEOGRAPH-2F933IDEOGRAPH-2F932IDEOGRAPH-2F931IDEOGRAPH-2F930IDEOGRAPH-2F92FIDEOGRAPH-2F92EIDEOGRAPH-2F92DIDEOGRAPH-2F92CIDEOGRAPH-2F92BIDEOGRAPH-2F92AIDEOGRAPH-2F929IDEOGRAPH-2F928IDEOGRAPH-2F927IDEOGRAPH-2F926IDEOGRAPH-2F925IDEOGRAPH-2F924IDEOGRAPH-2F923IDEOGRAPH-2F922IDEOGRAPH-2F921IDEOGRAPH-2F920IDEOGRAPH-2F91FIDEOGRAPH-2F91EIDEOGRAPH-2F91DIDEOGRAPH-2F91CIDEOGRAPH-2F91BIDEOGRAPH-2F91AIDEOGRAPH-2F919IDEOGRAPH-2F918IDEOGRAPH-2F917IDEOGRAPH-2F916IDEOGRAPH-2F915IDEOGRAPH-2F914IDEOGRAPH-2F913IDEOGRAPH-2F912IDEOGRAPH-2F911IDEOGRAPH-2F910IDEOGRAPH-2F90FIDEOGRAPH-2F90EIDEOGRAPH-2F90DIDEOGRAPH-2F90CIDEOGRAPH-2F90BIDEOGRAPH-2F90AIDEOGRAPH-2F909IDEOGRAPH-2F908IDEOGRAPH-2F907IDEOGRAPH-2F906IDEOGRAPH-2F905IDEOGRAPH-2F904IDEOGRAPH-2F903IDEOGRAPH-2F902IDEOGRAPH-2F901IDEOGRAPH-2F900IDEOGRAPH-2F8FFIDEOGRAPH-2F8FEIDEOGRAPH-2F8FDIDEOGRAPH-2F8FCIDEOGRAPH-2F8FBIDEOGRAPH-2F8FAIDEOGRAPH-2F8F9IDEOGRAPH-2F8F8IDEOGRAPH-2F8F7IDEOGRAPH-2F8F6IDEOGRAPH-2F8F5IDEOGRAPH-2F8F4IDEOGRAPH-2F8F3IDEOGRAPH-2F8F2IDEOGRAPH-2F8F1IDEOGRAPH-2F8F0IDEOGRAPH-2F8EFIDEOGRAPH-2F8EEIDEOGRAPH-2F8EDIDEOGRAPH-2F8ECIDEOGRAPH-2F8EBIDEOGRAPH-2F8EAIDEOGRAPH-2F8E9IDEOGRAPH-2F8E8IDEOGRAPH-2F8E7IDEOGRAPH-2F8E6IDEOGRAPH-2F8E5IDEOGRAPH-2F8E4IDEOGRAPH-2F8E3IDEOGRAPH-2F8E2IDEOGRAPH-2F8E1IDEOGRAPH-2F8E0IDEOGRAPH-2F8DFIDEOGRAPH-2F8DEIDEOGRAPH-2F8DDIDEOGRAPH-2F8DCIDEOGRAPH-2F8DBIDEOGRAPH-2F8DAIDEOGRAPH-2F8D9IDEOGRAPH-2F8D8IDEOGRAPH-2F8D7IDEOGRAPH-2F8D6IDEOGRAPH-2F8D5IDEOGRAPH-2F8D4IDEOGRAPH-2F8D3IDEOGRAPH-2F8D2IDEOGRAPH-2F8D1IDEOGRAPH-2F8D0IDEOGRAPH-2F8CFIDEOGRAPH-2F8CEIDEOGRAPH-2F8CDIDEOGRAPH-2F8CCIDEOGRAPH-2F8CBIDEOGRAPH-2F8CAIDEOGRAPH-2F8C9IDEOGRAPH-2F8C8IDEOGRAPH-2F8C7IDEOGRAPH-2F8C6IDEOGRAPH-2F8C5IDEOGRAPH-2F8C4IDEOGRAPH-2F8C3IDEOGRAPH-2F8C2IDEOGRAPH-2F8C1IDEOGRAPH-2F8C0IDEOGRAPH-2F8BFIDEOGRAPH-2F8BEIDEOGRAPH-2F8BDIDEOGRAPH-2F8BCIDEOGRAPH-2F8BBIDEOGRAPH-2F8BAIDEOGRAPH-2F8B9IDEOGRAPH-2F8B8IDEOGRAPH-2F8B7IDEOGRAPH-2F8B6IDEOGRAPH-2F8B5IDEOGRAPH-2F8B4IDEOGRAPH-2F8B3IDEOGRAPH-2F8B2IDEOGRAPH-2F8B1IDEOGRAPH-2F8B0IDEOGRAPH-2F8AFIDEOGRAPH-2F8AEIDEOGRAPH-2F8ADIDEOGRAPH-2F8ACIDEOGRAPH-2F8ABIDEOGRAPH-2F8AAIDEOGRAPH-2F8A9IDEOGRAPH-2F8A8IDEOGRAPH-2F8A7IDEOGRAPH-2F8A6IDEOGRAPH-2F8A5IDEOGRAPH-2F8A4IDEOGRAPH-2F8A3IDEOGRAPH-2F8A2IDEOGRAPH-2F8A1IDEOGRAPH-2F8A0IDEOGRAPH-2F89FIDEOGRAPH-2F89EIDEOGRAPH-2F89DIDEOGRAPH-2F89CIDEOGRAPH-2F89BIDEOGRAPH-2F89AIDEOGRAPH-2F899IDEOGRAPH-2F898IDEOGRAPH-2F897IDEOGRAPH-2F896IDEOGRAPH-2F895IDEOGRAPH-2F894IDEOGRAPH-2F893IDEOGRAPH-2F892IDEOGRAPH-2F891IDEOGRAPH-2F890IDEOGRAPH-2F88FIDEOGRAPH-2F88EIDEOGRAPH-2F88DIDEOGRAPH-2F88CIDEOGRAPH-2F88BIDEOGRAPH-2F88AIDEOGRAPH-2F889IDEOGRAPH-2F888IDEOGRAPH-2F887IDEOGRAPH-2F886IDEOGRAPH-2F885IDEOGRAPH-2F884IDEOGRAPH-2F883IDEOGRAPH-2F882IDEOGRAPH-2F881IDEOGRAPH-2F880IDEOGRAPH-2F87FIDEOGRAPH-2F87EIDEOGRAPH-2F87DIDEOGRAPH-2F87CIDEOGRAPH-2F87BIDEOGRAPH-2F87AIDEOGRAPH-2F879IDEOGRAPH-2F878IDEOGRAPH-2F877IDEOGRAPH-2F876IDEOGRAPH-2F875IDEOGRAPH-2F874IDEOGRAPH-2F873IDEOGRAPH-2F872IDEOGRAPH-2F871IDEOGRAPH-2F870IDEOGRAPH-2F86FIDEOGRAPH-2F86EIDEOGRAPH-2F86DIDEOGRAPH-2F86CIDEOGRAPH-2F86BIDEOGRAPH-2F86AIDEOGRAPH-2F869IDEOGRAPH-2F868IDEOGRAPH-2F867IDEOGRAPH-2F866IDEOGRAPH-2F865IDEOGRAPH-2F864IDEOGRAPH-2F863IDEOGRAPH-2F862IDEOGRAPH-2F861IDEOGRAPH-2F860IDEOGRAPH-2F85FIDEOGRAPH-2F85EIDEOGRAPH-2F85DIDEOGRAPH-2F85CIDEOGRAPH-2F85BIDEOGRAPH-2F85AIDEOGRAPH-2F859IDEOGRAPH-2F858IDEOGRAPH-2F857IDEOGRAPH-2F856IDEOGRAPH-2F855IDEOGRAPH-2F854IDEOGRAPH-2F853IDEOGRAPH-2F852IDEOGRAPH-2F851IDEOGRAPH-2F850IDEOGRAPH-2F84FIDEOGRAPH-2F84EIDEOGRAPH-2F84DIDEOGRAPH-2F84CIDEOGRAPH-2F84BIDEOGRAPH-2F84AIDEOGRAPH-2F849IDEOGRAPH-2F848IDEOGRAPH-2F847IDEOGRAPH-2F846IDEOGRAPH-2F845IDEOGRAPH-2F844IDEOGRAPH-2F843IDEOGRAPH-2F842IDEOGRAPH-2F841IDEOGRAPH-2F840IDEOGRAPH-2F83FIDEOGRAPH-2F83EIDEOGRAPH-2F83DIDEOGRAPH-2F83CIDEOGRAPH-2F83BIDEOGRAPH-2F83AIDEOGRAPH-2F839IDEOGRAPH-2F838IDEOGRAPH-2F837IDEOGRAPH-2F836IDEOGRAPH-2F835IDEOGRAPH-2F834IDEOGRAPH-2F833IDEOGRAPH-2F832IDEOGRAPH-2F831IDEOGRAPH-2F830IDEOGRAPH-2F82FIDEOGRAPH-2F82EIDEOGRAPH-2F82DIDEOGRAPH-2F82CIDEOGRAPH-2F82BIDEOGRAPH-2F82AIDEOGRAPH-2F829IDEOGRAPH-2F828IDEOGRAPH-2F827IDEOGRAPH-2F826IDEOGRAPH-2F825IDEOGRAPH-2F824IDEOGRAPH-2F823IDEOGRAPH-2F822IDEOGRAPH-2F821IDEOGRAPH-2F820IDEOGRAPH-2F81FIDEOGRAPH-2F81EIDEOGRAPH-2F81DIDEOGRAPH-2F81CIDEOGRAPH-2F81BIDEOGRAPH-2F81AIDEOGRAPH-2F819IDEOGRAPH-2F818IDEOGRAPH-2F817IDEOGRAPH-2F816IDEOGRAPH-2F815IDEOGRAPH-2F814IDEOGRAPH-2F813IDEOGRAPH-2F812IDEOGRAPH-2F811IDEOGRAPH-2F810IDEOGRAPH-2F80FIDEOGRAPH-2F80EIDEOGRAPH-2F80DIDEOGRAPH-2F80CIDEOGRAPH-2F80BIDEOGRAPH-2F80AIDEOGRAPH-2F809IDEOGRAPH-2F808IDEOGRAPH-2F807IDEOGRAPH-2F806IDEOGRAPH-2F805IDEOGRAPH-2F804IDEOGRAPH-2F803IDEOGRAPH-2F802IDEOGRAPH-2F801IDEOGRAPH-2F800IDENTIFICATIONIDENTICAICHOUICHOSICHIMATOSICHADINICELANDIC-YRIBIFILIIAUDAI015I014I013I012I011AI011I010AI010I009AI009I008I007I006I005AI005I004I003I002I001I-YUI-YOI-YEOI-YEI-YAEI-YA-OI-YAI-O-II-OI-EUI-BEAMI-ARAEAI-AHZZZGHZZZHZZPHZZHZWGHZWHZTHZGHYSTERESIHYPODIASTOLEHYPHENATIOHYPHEN-MINUSHYPHENHYPHEHXWGHXUOXHXUOTHXUOPHXUOHXOXHXOTHXOPHXOHXIXHXITHXIPHXIEXHXIETHXIEPHXIEHXIHXEXHXEPHXEHXAXHXATHXAPHXAHWUHWAIRHVHURANHUOTHUNDREDHUNDREHUNHUMANHUMAHUL2HUIITOHUB2HUBHUBHUARADDOHRYVNIHPWGHPAHPHOURGLASSHOUHOTAHORSEHORIZONTALLHORIZONTAL-06-06HORIZONTAL-06-05HORIZONTAL-06-04HORIZONTAL-06-03HORIZONTAL-06-02HORIZONTAL-06-01HORIZONTAL-06-00HORIZONTAL-05-06HORIZONTAL-05-05HORIZONTAL-05-04HORIZONTAL-05-03HORIZONTAL-05-02HORIZONTAL-05-01HORIZONTAL-05-00HORIZONTAL-04-06HORIZONTAL-04-05HORIZONTAL-04-04HORIZONTAL-04-03HORIZONTAL-04-02HORIZONTAL-04-01HORIZONTAL-04-00HORIZONTAL-03-06HORIZONTAL-03-05HORIZONTAL-03-04HORIZONTAL-03-03HORIZONTAL-03-02HORIZONTAL-03-01HORIZONTAL-03-00HORIZONTAL-02-06HORIZONTAL-02-05HORIZONTAL-02-04HORIZONTAL-02-03HORIZONTAL-02-02HORIZONTAL-02-01HORIZONTAL-02-00HORIZONTAL-01-06HORIZONTAL-01-05HORIZONTAL-01-04HORIZONTAL-01-03HORIZONTAL-01-02HORIZONTAL-01-01HORIZONTAL-01-00HORIZONTAL-00-06HORIZONTAL-00-05HORIZONTAL-00-04HORIZONTAL-00-03HORIZONTAL-00-02HORIZONTAL-00-01HORIZONTAL-00-00HORIZONTALHORIHORHOORUHOONHOMOTHETICHOMOTHETIHOLEHOLDINHOLAMHOLAHOKAHOIHOEHNUTHNUOXHNUOHNOXHNOTHNOPHNIXHNITHNIPHNIEXHNIETHNIEPHNIEHNIHNEXHNEPHNEHNAXHNATHNAPHNAHMYXHMYRXHMYRHMYPHMYHMUXHMUTHMURXHMURHMUPHMUOXHMUOPHMUOHMUHMOXHMOTHMOPHMOHMIXHMITHMIPHMIEXHMIEPHMIEHMIHMEHMAXHMATHMAPHMAHLYXHLYTHLYRXHLYRHLYPHLYHLUXHLUTHLURXHLURHLUPHLUOXHLUOPHLUOHLUHLOXHLOPHLOHLIXHLITHLIPHLIEXHLIEPHLIEHLIHLEXHLEPHLEHLAXHLATHLAPHLAHKHIZBHISTORIHIRIQHIGH-REVERSED-HIEXHIEUH-SIOSHIEUH-RIEULHIEUH-PIEUPHIEUH-NIEUNHIEUH-MIEUMHIEUHIEHIDINHIDETHIDEHHWAHHUHHIHHEEHHEHHAAHGHEXIFORHEXAGONHERUTUHERUHERMITIAHERMIONIAHERMESHERAEUHENGHENHEMPHELMETHELMEHELHEKUTAARUHEISEIHEAVYHEAVENLHEAVENHEAVEHEARTHEARHEADSTROKEHEADSTONHEADINGHBASA-ESASHBASHAYANNAHAVEHAUPTSTIMMEHATHIHATEHATAHASEHASANTAHARPOONHARPOOHARMONICHARKLEAHARDNESSHARHANUNOHANGZHOHANDSHANDLESHANDHAN-AKATHAMZAHAMMEHALFHALBERDHALANTAHAITUHAIRHAGLAHAGLHAFUKHAHAFUKHHAEGHAEHAARUHAAMHAHA-HAH008H007H006AH006H005H004H003H002H001H-TYPGYUGYONGYOGYIGYFGYEEGYASGYAAGYAGYGWUGWIGWEEGWEGWAAGWAGVGURUSHGURUNGURAMUTONGUR7GUNUGUNGUMGUGULGUGUEHGUEGUDGUGUARDEDNESSGUARANGUGTEGSUMGSUGRGROUNDGRONTHISMATAGREGORIAGREEGREATNESSGREATER-THANGREATER-THAGREATEGREAGRAVEYARGRAVE-MACRONGRAVE-ACUTE-GRAVEGRAVGRATERGRASSGRASGRAPHEMGRAMMGRAINGRACEGRACGPAGORTHMIKOGORTGORGOTERIGORGOSYNTHETONGORGOGORGIGORAGONGGOLDGOKGOINGOALGOAGOAGNYISGNAVIYANIGLOTTAGLISSANDGLEICGLAGOLIGLAGJEGIXGITGISHGISGISALGIRUDAAGIR3GIRGIR2GIRGIPGINIIGIMELGIMEGIMGIGAGIETGIDIMGIBAGI4GIGHZGHWAGHUNNAGHUNNGHUGHOUGHOSTGHOGHIGHHAGHEEGHEGHGHAYNGHANGHAMALGHAINUGHAINGHAIGHADGHAGGWIGGWEEGGWEGGWAAGGWAGGUXGGUTGGURXGGURGGUPGGUOXGGUOTGGUOPGGUOGGOXGGOTGGOPGGIXGGITGGIEXGGIEPGGIEGGEXGGETGGEPGGAXGGATGGAPGGAAGETGESHUGESHTINGESHTIGESH2GERSHAYIMGERMAGERESHGERESGEOMETRICALLGEOMETRIGENTLGENITIVEGENIKGENERIGEMINIGEMINATIOGEDOLAGEDEGEBGEBGEARGEAGDANGCIGGCAGBONGBENGBAKURUNENGBGAYANUKITTAGAYANNAGAYGAUNTLETGATHERINGGATHERINGATEGASHANGARSHUNIGARONGARMENTGAR3GAPPEGAGANMAGANGIAGANDGAN2GANGAMMAGAMLAGAMLGAMANGAMALGAMAGAMGAGGAFGAGAETTA-PILLAGADOLGADGAGABAGABGAAFUGAG054G053G052G051G050G049G048G047G046G045AG045G044G043AG043G042G041G040G039G038G037AG037G036AG036G035G034G033G032G031G030G029G028G027G026AG026G025G024G023G022G021G020AG020G019G018G017G016G015G014G013G012G011AG011G010G009G008G007BG007AG007G006AG006G005G004G003G002G001FYXFYTFYPFYAFYFWIFWEEFWEFWAAFWAFUXFUTFUSEFUSFURXFURFUPFUNERAFUNCTIONFULLNESSFULFUEFTHORFROWNINFROWNFRONT-TILTEFROFROGFRITUFRICATIVEFRETBOARDFRENCFREFRANFRAMEFRAGRANTFRAGMENTFRACTIOFOXFOURTEENFOURTEEFOUR-STRINFOUR-PER-EFOUR-LINFOUFOUNTAINFOSTERINGFORTYFORTFORTEFORMFORMATTINGFORKEFORCESFORCEFOPFOOTSTOOLFOOTNOTFOOTFOOFONGMANFOMFOLLYFOLLOWINGFOFMFLYFLUTEFLOWERFLOWEFLOURISHFLORETTEFLORAFLOORFLIPFLIGHTFLEXUSFLEUR-DE-LISFLATTENEFLATNESSFLATFLAFLAG-5FLAG-4FLAG-3FLAG-2FLAG-1FLAGFLAFLAFLFIXED-FORFIXFIVE-LINFIVFITAFITFISHHOOKFISHHOOFISHEYEFISHFISFIRSFIREFIPFINITFINGERNAILSFINGEREFINANCIALFILLERFILLEFILLFILFILFIIFIGURE-3FIGURE-2FIGURE-1FIGURFIGHTFIFTYFIFTFIFTHSFIFTHFIFTEENFIFTEEFIELDFHTORFFLFFIFESTIVALFERRYFERMATAFERMATFEOFENFENCEFEMININFEMALEFEMALFELLOWSHIPFEIFEHFEHFEFEENGFEEDFEEFEEFEBRUARYFEATHERFEATHEFEARNFAYANNAFAXFATHERFATHATANFATHATAFATHAFATHFATFARSFAPFANGFANEROSIFANFAMILYFALLINFAILUREFAIHUFAHRENHEITFACTOFACSIMILFACE-6FACE-5FACE-4FACE-3FACE-2FACE-1FAAMAEFAAIFAAFUFAAF053F052F051CF051BF051AF051F050F049F048F047AF047F046AF046F045AF045F044F043F042F041F040F039F038AF038F037AF037F036F035F034F033F032F031AF031F030F029F028F027F026F025F024F023F022F021AF021F020F019F018F017F016F015F014F013AF013F012F011F010F009F008F007F006F005F004F003F002F001AF001EZEZENEZEEZEYBEYFILIEYANNAEXTRA-LOEXTRA-HIGEXTENSIONEXTENDEEXPONENEXOEXEXISTSEXISTEXHAUSTIONEXCLAMATIONEXCLAMATIOEXCESSEXCELLENTEWEEVENINGEURO-CURRENCEUREULEEU-UEU-OEU-EUEU-EOEU-EEU-AETNAHTAETHEETEROETERNITYESUKUUDOESTIMATESESTIMATEESHE3ESH21ESHESH16ESCAPEES-TEERROR-BARREERRERIN2ERGERASEQUIVALENEQUIDEQUIANGULAEQUALSEQUALEQUALEPSILONEPSILOEPIGRAPHIEPIDAUREAEPENTHETIEPEGERMAEOLHXEOHENYENVELOPEENUMERATIOENTRY-2ENTRY-1ENTRYENTHUSIASMENTERPRISEENTERINENTERENTEENQUIRYENOENNENLARGEMENTENDOFONONENDINENDEPENDEAVOURENENCOUNTERSENCLOSUREENCLOSINENCENARXIENARMONIOEMPTEMPHATIEMPHASIEMBROIDERYEMBELLISHMENTEMBEDDINGELTELLIPSISELLIPSEELIFIELEVENELEVEELEMENELECTRICAELECTRIELAFRONEKSTREPTONEKSEKFONITIKONEKARAEJECEISEIGHTYEIGHTEIGHTHSEIGHTHEIGHTHEIGHTEENEIGHTEEEIEEHWAEGYPTOLOGICAEGIREGGEEYANNAEEKAAEEBEEFILIEDITORIAEDINEDDECEBEFILIEASTEREASEARTHLEARTHEARTEARLEAMHANCHOLLEAGLEEADHADHEABHADHEE038E037E036E034AE034E033E032E031E030E029E028AE028E027E026E025E024E023E022E021E020AE020E019E018E017AE017E016AE016E015E014E013E012E011E010E009AE009E008AE008E007E006E005E004E003E002E001DZZEDZWEDZUDZODZJEDZIDZHEDZHADZELODZEEDZEDZADZDDYODYDYEHDYEDWODWEDWADVISVARADVDUTIESDURATIONDUR2DUPONDIUDUOXDUODUN4DUN3DUNDUNDUMDULDUDUHDUGUDDUB2DUBDUDDRYDRDRUMDRUDROPSDROP-SHADOWEDRIVEDRIVDRIDRAUGHTDRAGONDRAFTINDRACHMASDRACHMADRACHMDOWNWARDSDOWNWARDDOWN-POINTINDOWNDOVEDOUBTDOUBLEDOUBLE-LINDOUBLE-ENDEDOUBLEDOTTED-PDOTTED-NDOTTED-LDOTTEDDOTTEDOTS-8DOTS-78DOTS-7DOTS-68DOTS-678DOTS-67DOTS-6DOTS-58DOTS-578DOTS-57DOTS-568DOTS-5678DOTS-567DOTS-56DOTS-5DOTS-48DOTS-478DOTS-47DOTS-468DOTS-4678DOTS-467DOTS-46DOTS-458DOTS-4578DOTS-457DOTS-4568DOTS-45678DOTS-4567DOTS-456DOTS-45DOTS-4DOTS-38DOTS-378DOTS-37DOTS-368DOTS-3678DOTS-367DOTS-36DOTS-358DOTS-3578DOTS-357DOTS-3568DOTS-35678DOTS-3567DOTS-356DOTS-35DOTS-348DOTS-3478DOTS-347DOTS-3468DOTS-34678DOTS-3467DOTS-346DOTS-3458DOTS-34578DOTS-3457DOTS-34568DOTS-345678DOTS-34567DOTS-3456DOTS-345DOTS-34DOTS-3DOTS-28DOTS-278DOTS-27DOTS-268DOTS-2678DOTS-267DOTS-26DOTS-258DOTS-2578DOTS-257DOTS-2568DOTS-25678DOTS-2567DOTS-256DOTS-25DOTS-248DOTS-2478DOTS-247DOTS-2468DOTS-24678DOTS-2467DOTS-246DOTS-2458DOTS-24578DOTS-2457DOTS-24568DOTS-245678DOTS-24567DOTS-2456DOTS-245DOTS-24DOTS-238DOTS-2378DOTS-237DOTS-2368DOTS-23678DOTS-2367DOTS-236DOTS-2358DOTS-23578DOTS-2357DOTS-23568DOTS-235678DOTS-23567DOTS-2356DOTS-235DOTS-2348DOTS-23478DOTS-2347DOTS-23468DOTS-234678DOTS-23467DOTS-2346DOTS-23458DOTS-234578DOTS-23457DOTS-234568DOTS-2345678DOTS-234567DOTS-23456DOTS-2345DOTS-234DOTS-23DOTS-2DOTS-18DOTS-178DOTS-17DOTS-168DOTS-1678DOTS-167DOTS-16DOTS-158DOTS-1578DOTS-157DOTS-1568DOTS-15678DOTS-1567DOTS-156DOTS-15DOTS-148DOTS-1478DOTS-147DOTS-1468DOTS-14678DOTS-1467DOTS-146DOTS-1458DOTS-14578DOTS-1457DOTS-14568DOTS-145678DOTS-14567DOTS-1456DOTS-145DOTS-14DOTS-138DOTS-1378DOTS-137DOTS-1368DOTS-13678DOTS-1367DOTS-136DOTS-1358DOTS-13578DOTS-1357DOTS-13568DOTS-135678DOTS-13567DOTS-1356DOTS-135DOTS-1348DOTS-13478DOTS-1347DOTS-13468DOTS-134678DOTS-13467DOTS-1346DOTS-13458DOTS-134578DOTS-13457DOTS-134568DOTS-1345678DOTS-134567DOTS-13456DOTS-1345DOTS-134DOTS-13DOTS-128DOTS-1278DOTS-127DOTS-1268DOTS-12678DOTS-1267DOTS-126DOTS-1258DOTS-12578DOTS-1257DOTS-12568DOTS-125678DOTS-12567DOTS-1256DOTS-125DOTS-1248DOTS-12478DOTS-1247DOTS-12468DOTS-124678DOTS-12467DOTS-1246DOTS-12458DOTS-124578DOTS-12457DOTS-124568DOTS-1245678DOTS-124567DOTS-12456DOTS-1245DOTS-124DOTS-1238DOTS-12378DOTS-1237DOTS-12368DOTS-123678DOTS-12367DOTS-1236DOTS-12358DOTS-123578DOTS-12357DOTS-123568DOTS-1235678DOTS-123567DOTS-12356DOTS-1235DOTS-12348DOTS-123478DOTS-12347DOTS-123468DOTS-1234678DOTS-123467DOTS-12346DOTS-123458DOTS-1234578DOTS-123457DOTS-1234568DOTS-12345678DOTS-1234567DOTS-123456DOTS-12345DOTS-1234DOTS-123DOTS-12DOTS-1DOTSDOTLESDORUDOORDOONGDONGDOMAIDOLLADOLIUMDOKMAIDOITDOGDOEDODEKATADOBRODOACHASHMEEDOACHASHMEDOADO-ODMDDLUDLODLIDLEEDLADLDKARDKADJERVIDJERVDJEDJADJDIVORCDIVISIONDIVISIODIVINATIONDIVIDESDIVIDERDIVIDEDIVIDEDIVIDDIVERGENCEDITTDISTORTIONDISTINGUISHDISPERSIONDISIMOUDISHDISCONTINUOUDISDISABLEDIRGDIRECTLDIRECTIONADIPTEDIPPERDIPLOUNDIPLIDIPLDINGBADIDIMMINGDIMINUTION-3DIMINUTION-2DIMINUTION-1DIMINISHMENTDIMIDIDIMENSIONADIMENSIODIM2DILDIGRAPHDIGRAPDIGRAMMODIGRAMMDIGRADIGORGONDIGORGODIGAMMADIGDIFTOGGODIFONIASDIFFICULTDIFFICULTIESDIFFERENTIALDIFFERENCDIFATDIESISDIESIDIEPDIDIBDIATONODIATONIKDIASTOLDIAMONDDIAMONDIAMETEDIALYTIKADIALYTIKDIALECT-DIAGONALDIAGONADIAERESIZEDIAERESISDIAERESIDHOUDHOODHODHIDHHUDHHOODHHODHHIDHHEEDHHEDHHADHEEDHARMADHALETHDHALATHDHALDHADHEDHAALUDHADEZDEYTERODEYTERODEXIADEVICDEVELOPMENTDEUNGDESIDESCRIPTIODESCENDINDESCENDERDERET-HIDETDERETDEPARTUREDEPARTINDENTISTRDENTADENOMINATORDENOMINATODENNENDENGDENDENARIUDELTADELTDELTDELPHIDELIVERANCEDELIMITERDELIMITEDELETEDELETDEKADEKDEIDEHIDEGREDEFINITIONDEFECTIVENESDEERDEELDECRESCENDODECREASEDECISIVENESSDECIMADECEMBERDECAYEDDEBIDEATHDEADDDWADDUXDDUTDDURXDDURDDUPDDUOXDDUOPDDUODDUDDOXDDOTDDOPDDOADDIXDDITDDIPDDIEXDDIEPDDIEDDIDDHODDHADDEXDDEPDDEEDDEDDDHADDDADDAYANNADDAXDDATDDAPDDALDDADDAHALDDAHADDAADDADAVIYANIDAVIDDATDASIADASHEDASHDASDASEIADARTDARKENINGDARKENINDARDARGADARA4DARA3DARDAP-PRADAP-PIDAP-MUODAP-BUODAP-BEDADANTAJDANGDANDANDADAMPDAMDAMMATANDAMMATADAMMADAMMDAMARUDALETHDALETDALEDALDADALATHDALATDALATDAIRDAINGDAHYAAUSH-2DAHYAAUSHDAGSDAGGERDAGESHDAGESDAGBASINNADAGADAGALGADADAENGDAEDADDADAASUDAADHUD067HD067GD067FD067ED067DD067CD067BD067AD067D066D065D064D063D062D061D060D059D058D057D056D055D054AD054D053D052AD052D051D050ID050HD050GD050FD050ED050DD050CD050BD050AD050D049D048AD048D047D046AD046D045D044D043D042D041D040D039D038D037D036D035D034AD034D033D032D031AD031D030D029D028D027AD027D026D025D024D023D022D021D020D019D018D017D016D015D014D013D012D011D010D009D008AD008D007D006D005D004D003D002D001CYXCYTCYRXCYRENAICYRCYPRIOCYPERUSCYPCYLINDRICITYCYACYCWOOCWOCWIICWICWEORTHCWECWAACUXCUTCUCUSTOMECURXCURVINCURVECURVECURVCURRENTCURRENCURLCURLCURCUPCUCUOXCUOPCUOCUCUBEDCUBCUATRILLOCUATRILLCUCRYPTOGRAMMICRUZEIRCROSSINCROSSHATCCROSSED-TAILCROSSECROSSBONESCROSSCROSCROPCROIXCRESCENTCRESCENCREDICREATIVCOXCOWCOVERCOUNTINCOUNTERSINKCOUNTERBORECOUNCICOTCORRESPONDCORRECTCORPSECORPORATIONCORONISCORNERSCORNERCORNECOPYRIGHTCOPYRIGHCOPYCOPRODUCTCOPCOOCONVERGINCONTROCONTRARIETYCONTRACTIONCONTOURECONTOUCONTENTIONCONTEMPLATIONCONTAINCONTAININCONTAICONTACTCONSTANTCONSTANCONSTANCYCONSONANCONSECUTIVCONJUNCTIONCONJUGATCONJOININCONICACONGRUENCONGRATULATIONCONFLICTCONCAVE-SIDECONCAVE-POINTECONCOMPOSITIONCOMPOSITIOCOMPLIANCECOMPLETIONCOMPLETEDCOMPLEMENTCOMPARECOMMOCOMMERCIACOMMACOMMCOMINCOMETCOMBCOLUMNCOLORCOLLCOFFINCOENGCODACOACOCMCCLUSTECLUB-SPOKECLUBCLUCLOUDCLOUCLOTHESCLOTHCLOSENESSCLOSEDCLOSECLOSCLOCKWISCLIVISCLINGINCLIMACUSCLIFFCLICKCLEF-2CLEF-1CLEFCLECLEACLAWCLANCIXCIVILIANCITCIRCUMFLEXCIRCUMFLECIRCULATIOCIRCLESCIRCLECIPCIICIEXCIEUC-SSANGPIEUPCIEUC-PIEUPCIEUC-IEUNGCIEUCIETCIEPCIECICHYXCHYTCHYRXCHYRCHYPCHUXCHURXCHURCHCHURCHUPCHUOXCHUOTCHUOPCHUOCHULACHUCHRYSANTHEMUMCHRONOUCHRONONCHROMCHROCHRIVICHOXCHOTCHOREVMCHOPCHOKECHOECHOACHOCHCHITUEUMSSANGSIOSCHITUEUMSSANGCIEUCCHITUEUMSIOSCHITUEUMCIEUCCHITUEUMCHIEUCHCHIRONCHIRETCHINGCHINESCHINCHILLCHILDCHILCHIKCHIEUCH-KHIEUKHCHIEUCH-HIEUHCHIEUCCHICHCHHACHEXCHEVROCHETCHESCHEPCHECHEINAPCHEIKHEICHEECHECKCHECCHCHAXCHAVIYANICHATTAWACHATCHARIOTCHARIOCHARACTERSCHARACTERCHARCHAPCHANGECHANGCHANCHAMKOCHAMILONCHAMILICHAIRCHAINSCHADACHACHAACEXCERESCEREKCER-WACEPCEONGCHIEUMSSANGSIOSCEONGCHIEUMSSANGCIEUCCEONGCHIEUMSIOSCEONGCHIEUMCIEUCCEONGCHIEUMCHIEUCHCENTURIACENTRELINCENTRECENTRECENTRCENCELSIUSCEIRTCEILINGCEECEDILLACEDILLCEDCECEKCECAKCECACEALCCCUCCOCCICCHUCCHOCCHICCHEECCHECCHAACCHACCEECCECCAACCACAYNCAYANNACAXCAVECAUTIOCAULDRONCAUDACATAWACATCASTLECARYSTIACARTCARRIAGCARPENTRCARONCAROCARICARIACARETCARECARCARCACAPTIVECAPRICORNCAPOCAPITALCANTILLATIOCANCANDRABINDUCANDRABINDCANDRACANDRCANCERCANCELLATIOCANCELCANCECANCAMNUCALYACALYCALLCALCCAKRACAESURACADUCEUSCADCAANGCAAICC024C023C022C021C020C019C018C017C016C015C014C013C012C011C010AC010C009C008C007C006C005C004C003C002CC002BC002AC002C001C-SIMPLIFIEC-39C-18BZUNBZHBYELORUSSIAN-UKRAINIABBXGBWIBWEEBWEBWABUUMISHBUBUSSYERUBURBUR2BUBUOXBUOPBUOBUMPBULUGBULUBULLSEYEBULLBULLETBULLEBULLBUKYBUHIBUGINESBUCKLEBSTARBSKUBSKABSDUBRUSHBRUSBRONZEBROKEBROABRISTLEBRIDGBREVISBREVE-MACRONBREVBREATBREAKTHROUGHBRDBRANCHINBRANCHBRANCBRAKCETBRACKETEBRACKEBRACEBQBOWTIEBOWTIBOWBOBOUNDARBOTTOM-LIGHTEBOTTOMBOTTOBORUTOBOOMERANGBONEBOLBODYBOARBOABLUEBLOODBLOCKBLENDEBLANKBLANBLADBLACKFOOBLACK-LETTEBLACK-FEATHEREBLACKBKABITTERBITINBISMILLABISHOPBISECTINBISAHBIRUBIRGABIRDBIOHAZARBINOCULABINDINBINDIBINARBILABIABIGBIBIETBIDENTABIBLE-CREBIBBBHUBHOOBHOBHIBHETHBHEEBHEBHAMBHABEYYALBEXBEVERAGEBETWEENBETWEEBETHBETABETBETBEBESIDBERKANABERBEBEPBEORBENZENBENDEBENDBEBELTBELBELOBELLBELBELGTHOBEITHBEHINBEHEHBEHEBEHBEBEGINNINGBEGIBEFORBEETABEEHIVEBEEHBEEBECAUSEBEAVEBEATBEANBEAMEBCADBCABBYXBBYTBBYPBBYBBUXBBUTBBURXBBURBBUPBBUOXBBUOPBBUOBBUBBOXBBOTBBOPBBOBBIXBBITBBIPBBIEXBBIETBBIEPBBIEBBIBBEXBBEPBBEBBAXBBATBBAPBBABAYANNABAUBATHTUBBATHAMASATBASSABASHKIBASHBASEBALLBASEBASBARSBARRIERBARREKHBARREEBARREBARLINEBARLEYBARIYOOSANBARA2BABANTOCBANBANDBAN2BANBAMBOOSBAMBOOBALUDABALLOBALLOON-SPOKEBALAGBALBABAIRKANBAIMAIBAHTBAHIRGOMUKHABAHAR2BAGABAG3BABADGERBADBACKSPACEBACKSLASHBACKSLASBACK-TILTEBACKBACBAARERUB305B259B258B257B256B255B25B253B252B251B250B249B248B24B246B245B24B24B24B24B236B234B23B232B23B23B229B228B227B226B22B222B221B22B219B218B217B216B215B214B213B212B211B210B209B208B207B206B205B204B203B202B201B200B19B190B189B185B184B183B182B181B180B179B178B177B17B174B17B172B171B170B169B168B167B166B165B164B16B16B161B160B15B158B157B15B155B154B153B152B15B150B146B14B142B14B14B13B13B132B13B13B12B12B12B12B12B12B12B109B109B108B108B107B107B106B106B105B105B10B10B10B10B09B09B089B08B086B08B083B082B08B08B079B07B07B07B07B07B07B07B07B07B06B06B06B06B06B064B063B06B06B06B05B05B05B056B05B05B05B05B05B05B049B04B047B04B04B04B04B04B04B04B03B03B03B03B034B03B03B03B03B02B02B02B02B02B02B02B022B02B02B019B018B01B01B01B01B01B01B01B01B009B00B008B00B007B00B006B00B005AB005B00B004B00B003B00B002B00B001B00AZUAYEAYBAYAHAXEAWEAVESTAAVERAGAVAKRAHASANYAAVAGRAHAAUYANNAAUTUMNAUSTRAAURAMAZDAAHAAURAMAZDAA-2AURAMAZDAAAUNNAUGUSTAUGMENTATIOAUEATTIATTHACANATTENTIONATTAATOATNAATMAAUATIYAATHARVAVEDIATHAPASCAASYURASYMPTOTICALLASTROLOGICAASTERISMASTERISKASTERISKASTERISASTERISCUSASSYRIAASSERTIONASPIRATEASPERASHGABASH9ASHASCENTASCENDINASAL2ARUHUAARTABARSEOSARSEOARROWSARROWHEADARROWHEAARROW-TAILARRIVEARRAYARPEGGIATAROUSINAROURAROUND-PROFILEAROUNARMYARMOURARARLAUARKTIKARKABARKAANUARISTERAARISTERARIESARGOTERIARGOSYNTHETONARGIAREPAARDHAVISARGAARCHAIONARCHAIOARCHAIARCARCARARAMAIARAEAEARAEA-UARAEA-IARAEA-EOARAEA-EARAEA-AARADARAARABIC-INDIARABIAAR-RAHMAAR-RAHEEMAQUARIUSAPUAPRILAPPROXIMATELAPPROXIMATEAPPROACHEAPPROACHAPPLICATIONAPOTHESAPOTHEMAAPOSTROPHEAPOSTROFOSAPOSTROFOAPOSTROFOAPODEXIAAPODERMAPLOUNAPLAPINAPESAPARTAPAATOANUSVARAYAANUSVARAANUSVARANUDATTAANUDATTANTIRESTRICTIONANTIKENOMAANTIKENOKYLISMAANTIFONIAANTICLOCKWISE-ROTATEANTICLOCKWISANTARGOMUKHAANSUANSHEANPEAANANNUITANNOTATIOANNAAUANKHANHUANGULARANGSTROANGKHANKHUANGEDANDAPANCORAANCHORANATRICHISMAANAPAMPSAMPERSANDAMOUNAMBAMARAMAAMALGAMATIOALVEOLAALTERNATIVALTERNATIOALTERNATALTAALPHAALPHALPAPRANAALPAPRAANALPAALMOSALLOALLIANCEALLALLAALIGNEALIFUALGIALFAALEUALEPHALEMBICALEFALAYHEALAYHALAPHAL-LAKUNAAKTIESELSKABAKHMIMIAKBAAKARAAKARAIYANNAAIVILIAITOAIRPLANEAINNAILMAIKARAAIHVUSAHSDAAHSAAHAGGAAHADAGUNGAGOGAGGRAVATIONAGGRAVATEAGAINAFTEAFSAAQAFRICAAFOREMENTIONEDAFGHANAEYANNAAEYAETAESCULAPIUSAESCAESAERAELA-PILLAAELAEKAEGEAAEGAEEYANNAAEEAEDA-PILLAAEDAEBAADVANCEADEGADEADDRESSEADDAKADAACUTE-MACRONACUTE-GRAVE-ACUTEACUTACTUALLACTIVATACROPHONIACKNOWLEDGEACCUMULATIONACCOUNACCENT-STACCATOACCENTACCENACADEMABYSMAABUNDANCEABKHASIAABBREVIATIOABAFILIABAAYANNAAAYAAWAAOAAJAABAAFILIAA032AA031AA030AA029AA028AA027AA026AA025AA024AA023AA022AA021AA020AA019AA018AA017AA016AA015AA014AA013AA012AA011AA010AA009AA008AA007BAA007AAA007AA006AA005AA004AA003AA002AA001A070A069A068A067A066A065A064A063A062A061A060A059A058A057A056A055A054A053A052A051A050A049A048A047A046A045AA045A044A043AA043A042AA042A041A040AA040A039A038A037A036A035A034A033A032AA017AA014AA006BA006AA005AA-EU-U-PHRU-KHYU-KHYIL-DZU-CHA-CHAL\gs ' nxp    !"# $isnan(z) -> bool Checks if the real or imaginary part of z not a number (NaN)unicode(object='') -> unicode object unicode(string[, encoding[, errors]]) -> unicode object Create a new Unicode object from the given encoded string. encoding defaults to the current default string encoding. errors can be 'strict', 'replace' or 'ignore' and defaults to 'strict'.compress(data [, compresslevel=9]) -> string Compress data in one shot. If you want to compress data sequentially, use an instance of BZ2Compressor instead. The compresslevel parameter, if given, must be a number between 1 and 9. Dunrecognized parse tree node typecompileCompile this ST object into a code object.isexprDetermines if this ST object was created from an expression.issuiteDetermines if this ST object was created from a suite.tolistCreates a list-tree representation of this ST.totupleCreates a tuple-tree representation of this ST.__sizeof__Returns size in memory, in bytes.parser.stIntermediate representation of a Python parse tree.astline_infocol_infoO!|OO:st2tuple|OO:totupleast2tuple is removed in 3.x; use st2tupleastline_infocol_infoO!|OO:st2list|OO:tolistast2list is removed in 3.x; use st2listastfilenameO!|s:compilest|s:compilecompileast is removed in 3.x; use compilestastO!:isexpr:isexprastO!:issuite:issuitesources:exprs:suitesequenceO:sequence2stsequence2st() requires a single sequence argumentparse tree does not use a valid start symbolunspecified ST error occurredtuple2ast is removed in 3.x; use tuple2stosIllegal node construct.terminal nodes must have 2 or 3 entriessecond item in terminal node must be a string, found %sthird item in terminal node must be an integer, found %sosunknown node type.unsupported number of child nodesosIllegal syntax-tree; cannot start with terminal symbol.osIllegal component tuple.Expected node type %d, got %d.Illegal number of children for %s node.Illegal terminal: expected "%s",,class:class()()if:else:ififelif:()parameterssuitetestlisttestlist1testlist_safeexpected variable argument trailer for varargslist,**illegal variable argument trailer for varargslistvarargslist missing child nodes=,,=,=illegal formation for varargslistlist_itercomp_iterlist_forforincomp_forforinlist_ififcomp_ifif()fpdeffpliststmtsimple_stmt;;small_stmtillegal small_stmt child typeUnrecognized child node of small_stmt: %d.compound_stmtIllegal compound statement type: %d.augassign+=-=*=/=//=%=&=|=^=<<=>>=**=illegal augmented assignment operator=printprint_stmt,print_stmt,del_stmtdelreturnraise,,raise,yieldyield_stmtasimport_as_name.asillegal number of children for dotted_as_name,,import_nameimportfromimport()import_stmtillegal import_stmt child typeUnrecognized child node of import_stmt: %d.illegal global statementglobal,execillegal exec statementin,assertillegal assert statement,while:else:forin:else:try::exceptIllegal number of children for try/%s node.finallytry/finally::else:finallytry/except/finally:exceptas,ifelseorandnotinisillegal operator '%s'illegal comparison operator typecomp_opisnotnotinunknown comparison operator|^&illegal number of nodes for 'power'**atom)illegal list display atommissing child nodes of listmaker,,illegal trailing nodes for listmakermissing child nodes of testlist_comp,,illegal trailing nodes for testlist_comp@()aswith:def:lambda:lambdeflambda:old_lambdefarglistneed '(', ')' for generator expression,illegal arglist specification (extra stuff on end)*,**illegal use of '*' in arglist**illegal use of '**' in arglistillegal arglist specification=)trailertrailertrailersubscriptlistinvalid number of arguments for subscript nodesubscript...::sliceopsliceop:exprlist,::illegal number of nodes for dictorsetmaker,:,illegal trailing nodes for dictorsetmakerflow_stmtillegal flow_stmt typepasspassbreakbreakcontinuecontinueunrecognized node typecould not validate expression tupleVALIDATION FAILURE: report this to the maintainer!Error Parsing encoding_declO!:_picklerOiO(O)ast2tupleCreates a tuple-tree representation of an ST.ast2listCreates a list-tree representation of an ST.compileastCompiles an ST object into a code object.compilestCompiles an ST object into a code object.exprCreates an ST object from an expression.isexprDetermines if an ST object was created from an expression.issuiteDetermines if an ST object was created from a suite.suiteCreates an ST object from a suite.sequence2astCreates an ST object from a tree representation.sequence2stCreates an ST object from a tree representation.st2tupleCreates a tuple-tree representation of an ST.st2listCreates a list-tree representation of an ST.tuple2astCreates an ST object from a tree representation.tuple2stCreates an ST object from a tree representation._picklerReturns the pickle magic to allow ST objects to be pickled.parserparser.ParserErrorParserErrorASTTypeSTType__copyright____doc____version__copy_regpicklesequence2st_picklerL"N"O"P"Q"R"S"T"U"V"i"',j3O2.o8l0!x3"}[H)$ -kG)-'9q$&/cshutdown(s) -> socket Does the SSL shutdown handshake with the remote end, and returns the underlying socket object.+S.isdigit() -> bool Return True if all characters in S are digits and there is at least one character in S, False otherwise.m. ]w.&'% 0'%A'%M'%WSTOPSIG(status) -> integer Return the signal that stopped the process that provided the 'status' value.0123456789/tmp/tf00000000000000123456789ABCDEF0123456789abcdefS.rsplit([sep [,maxsplit]]) -> list of strings Return a list of the words in the string S, using sep as the delimiter string, starting at the end of the string and working to the front. If maxsplit is given, at most maxsplit splits are done. If sep is not specified or is None, any whitespace string is a separator.fromunicode(ustr) Extends this array with data from the unicode string ustr. The array must be a type 'u' array; otherwise a ValueError is raised. Use array.fromstring(ustr.decode(...)) to append Unicode data to an array of some other type.23456789abcdefghijkmnpqrstuvwxyz; q8; $;4Y";-."3"9"upper(s) -> string Return a copy of the string s converted to uppercase.proxygetweakrefcountgetweakrefsproxy_weakrefWeak-reference support module.refReferenceTypeProxyTypeCallableProxyTypeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/$1$1$1!$1D*$10$1j6$1=$1~F$1O$1LX$1_$1d$1Mi$1jkl3rl3{l3l3l3Unknown format code '%c' for object of type '%.200s'Unknown format code '\x%x' for object of type '%.200s'Cannot specify ',' with '%c'.Cannot specify ',' with '\x%x'.Too many decimal digits in format stringFormat specifier missing precisionInvalid conversion specificationSign not allowed in string format specifierAlternate form (#) not allowed in string format specifier'=' alignment not allowed in string format specifierH)A/T'!;D&h8Ԍ$n$ Y: < <GetBase() -> url Return base URL string for the parser.C objects to be exported from one extension module to another C objects are used for communication between extension modules. They provide a way for an extension module to export a C interface to other extension modules, so that extension modules can use the Python import mechanism to link to one another.chdir(path) Change the current working directory to the specified path.L@ @4H!E"U`h3$0$'g)>Jfdopen(fd, [, mode='r' [, bufsize]]) -> file_object Return an open file object connected to a file descriptor./e#1E;V!;  ğ6,Eޟ6r$Lpow(x, y[, z]) -> number With two arguments, equivalent to x**y. With three arguments, equivalent to (x**y) % z, but may be more efficient (e.g. for longs).'!SE8"m$9)lockf (fd, operation, length=0, start=0, whence=0) This is essentially a wrapper around the fcntl() locking calls. fd is the file descriptor of the file to lock or unlock, and operation is one of the following values: LOCK_UN - unlock LOCK_SH - acquire a shared lock LOCK_EX - acquire an exclusive lock When operation is LOCK_SH or LOCK_EX, it can also be bitwise ORed with LOCK_NB to avoid blocking on lock acquisition. If LOCK_NB is used and the lock cannot be acquired, an IOError will be raised and the exception will have an errno attribute set to EACCES or EAGAIN (depending on the operating system -- for portability, check for either value). length is the number of bytes to lock, with the default meaning to lock to EOF. start is the byte offset, relative to whence, to that the lock starts. whence is as with fileobj.seek(), specifically: 0 - relative to the start of the file (SEEK_SET) 1 - relative to the current buffer position (SEEK_CUR) 2 - relative to the end of the file (SEEK_END)'-?'-?'-=@'-@'-@H)ߘ-A RC+))(ascii) -> bin. Decode a line of base64 data+qJ (O:|  E md_U{t6Dm)lGBV-Exb3v{!##&[(()*O+P+F+,+$,-111r33333333J4Q4K4e44Z5596G686:67 7d777$8=8:<=@====~?@AAAC)FFHMJVKoKLMN7NjNNJPUP"QQQQRLR.TTUWWYZZZ[K\d\.^V^e^b^^^^#_\___ `_````pbbLc=d~ffghhQioiijXjjjsllenoooo q9qssstItvv1vvw#wRwyz{{{|}~ UkȅɅ׆IFk)qC͊݊q62ϕPƘr۝=IĞ۞Ο/"7E@fromfd(fd, family, type[, proto]) -> socket object Create a socket object from a duplicate of the given file descriptor. The remaining arguments are the same as for socket().H)L"p1tmaxDBL_MAX -- maximum representable finite floatmax_expDBL_MAX_EXP -- maximum int e such that radix**(e-1) is representablemax_10_expDBL_MAX_10_EXP -- maximum int e such that 10**e is representableminDBL_MIN -- Minimum positive normalizer floatmin_expDBL_MIN_EXP -- minimum int e such that radix**(e-1) is a normalized floatmin_10_expDBL_MIN_10_EXP -- minimum int e such that 10**e is a normalizeddigDBL_DIG -- digitsmant_digDBL_MANT_DIG -- mantissa digitsepsilonDBL_EPSILON -- Difference between 1 and the next representable floatradixFLT_RADIX -- radix of exponentroundsFLT_ROUNDS -- addition roundssys.float_infofloat() argument must be a string or a numberinvalid literal for float(): %.200sa float is requirednb_float should return float objectrichcompareaddsubtractmultiplyfloat division by zerodivideclassic float divisionfloat division by zerodividefloat modulomodulofloat divmod()divmod(dd)pow() 3rd argument not allowed unless all arguments are integers0.0 cannot be raised to a negative powernegative number cannot be raised to a fractional powerpowis_integer%s0%se%d-rounded value too large to represent0123456789abcdef-0x0.0p+00x0.0p+0-0x%sp%c%d0x%sp%c%dnfinityan(d)hexadecimal value too large to represent as a floatinvalid hexadecimal floating-point stringhexadecimal string too long to convertCannot pass infinity to float.as_integer_ratio.Cannot pass NaN to float.as_integer_ratio.as_integer_ratiox|O:float(d)__getformat__() argument must be string, not %.500sdoublefloat__getformat__() argument 1 must be 'double' or 'float'unknownIEEE, little-endianIEEE, big-endianinsane float_format or double_formatss:__setformat__doublefloat__setformat__() argument 1 must be 'double' or 'float'unknownIEEE, little-endianIEEE, big-endian__setformat__() argument 2 must be 'unknown', 'IEEE, little-endian' or 'IEEE, big-endian'can only set %s format to 'unknown' or the detected platform valueO:__format____format__ requires str or unicodeconjugateReturns self, the complex conjugate of any float.__trunc__Returns the Integral closest to x between 0 and x.as_integer_ratiofromhexhexis_integerReturns True if the float is an integer.__getnewargs____getformat____setformat____format__realthe real part of a complex numberimagthe imaginary part of a complex numberfloatC??CKK# cleanup floats : %d unfreed float%s s# frexp() result out of rangefloat too large to pack with f formatfrexp() result out of rangefloat too large to pack with d formatcan't unpack IEEE 754 special value on non-IEEE platformcan't unpack IEEE 754 special value on non-IEEE platformB.strip([bytes]) -> bytearray Strip leading and trailing bytes contained in the argument. If the argument is omitted, strip ASCII whitespace.p-$zDF$/__init__.pyc/__init__.pyo/__init__.py.pyc.pyo.py>?456789:;<=  !"#$%&'()*+,-./0123ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/u-ru-su-slink(src, dst) Create a hard link to a file.getpwnam(name) -> (pw_name,pw_passwd,pw_uid, pw_gid,pw_gecos,pw_dir,pw_shell) Return the password database entry for the given user name. See help(pwd) for more on password database entries.isatty() -> bool. True if the file is connected to a tty device.gettrace() Return the global debug tracing function set with sys.settrace. See the debugger chapter in the library manual.writerows(sequence of sequences) Construct and write a series of sequences to a csv file. Non-string elements will be converted to string.insert(i,x) Insert a new item x into the array before position i.H)3FcNAiF@Nx#|$X$J$ Ɯ$˜$FReturn state information for pickling.write(data) -> None Write the 'data' string to file. Note that due to buffering, close() may be needed before the file on disk reflects the data written. Ϙ-d823456789abcdefghijkmnpqrstuvwxyz__hello____phello____phello__.spam֞$l8#E 4xh;v8P $d0 H)s]6r7#t!`*z/d*WD#P-:֟)۟)))kill(pid, sig) Kill a process with a signal.0Zk%4@!/fmod(x, y) Return fmod(x, y), according to platform C. x % y may differ.?MX=?QY@GU-x?taBe+pcؗҜ<3#I9=D2[%Cod( ,P̋!ԋ!!4POd?#8P!l!@P-DPHP !LP-6lPPXPTP@lP|!@!pPxPtP!H!PX!`!Ph!p!ePx!P!!PȜ!PPPPPP!!PPPPPP!PPPPԞ!P T$T Y"PP!PPPx!PPQ! QQPQ!Q!Q$QQ!!Q! Q(Q,Q0Q!@QHQ4Q x[y]S.rpartition(sep) -> (head, sep, tail) Search for the separator sep in S, starting at the end of S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return two empty strings and S.R!RR!!$!!RRH"R!RRRR!RRRR!RRR!!RRRR!!RRRRRR!RSL!S !!S Sd!t!S!R !T!S!S! S$S|!S!!(S!,Sinsort_left(a, x[, lo[, hi]]) Insert item x in list a, and keep it sorted assuming a is sorted. If x is already in a, insert it to the left of the leftmost x. Optional args lo (default 0) and hi (default len(a)) bound the slice of a to be searched. - 4S None. Update D from dict/iterable E and F. If E present and has a .keys() method, does: for k in E: D[k] = E[k] If E present and lacks .keys() method, does: for (k, v) in E: D[k] = v In either case, this is followed by: for k in F: D[k] = F[k]tell() -> int Return the current file position, an integer (may be a long integer). wait3(options) -> (pid, status, rusage) Wait for completion of a child process.instancemethod(function, instance, class) Create an instance method object.  !"#$%&'()))*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNNOPQRSTUVWXYZ[\]^_`abcdddddddddddddddddddddddddddddddddddddddddddddddddddedddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddfgddddddddh))ijklmnopqrstttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttuvvvvvvvvvvvvvvvvwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxxyz{|}}~))))))))))))))Ndddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddxxxxwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww        !""#"$%%%&&&&&&'&&&&&&&&&'&&&&&&('&&&&&')**++++)+***+**++)+**+++()**+*+)+&*&+&+&+&+&+&+&+,)&*&+&+&+&*&+&+&+&+&+')&+&*&+&+&)-&+&+)&+&+&+-')&*&+&*')&*&+&+')&+&+&+&+&+&+&+&+&+')&+&*&+&+&+&+&+&+&&+&+&+#.,,.,.,,.,,,..,,,,.,,.,,,...,,.,&+,.,.,,.,..,.,&+,,,.,.,,../,...////01#01#01#&*&*&*&*&*&*&*&*.&+&+&+,.&+&+&+&+&++01#&+,,&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+,.&+,.,.,.&+&+&+&+&+&+&+......,,.,,..,.,,,,.,.,.,.,..)...............)................................................../...........................222222222334444444556537377737338455555595622222555555535455555555555555555:::::;:::::::;;:;:;::<====<>=====??@@@@AA====@@=@@==BBBBC====;;;DD:DDE;===;;;==F;;;====;<==;GHHGHHG;;;;;;;;;;;;;,.,.I5,.2...J9K&J&&&&&&+''''''''''''''''''''''''&&+++++))))))))))))))))).)))))))+++++,##0LL##.,.,.,.,.,.,.,.,.,.,.,.,.###.0#M,.0,..,,,&N,&,,,&,,,,&&&,'''''''''N'''''''''''''''''''''')))))))))*))))))))))))))))))))))+*.+...+....+++.,.,.,.,.,.,.,.,.,.,.,.&+,.,.,.,.,.OPPPPPQQ,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,&+,.,.,.,.,.,..&+&+,.&+,.&+&+&+,.&+&+&+,.&+&+&+&+&+&+,.&+,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,4RRRRRR......................................#RSTPPPPTPPPUTPPPPPPTTTTTTPPTPPUVPWXYZ[\]^_``abcdefghfPTf_iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiffjjjjMMkllmnoPPPPPPPPpqrooostttttsssssssssssssssssssssssssussssssssssvwxpqryz{{|TPPPPPTPP}}}}}}}}}}l~~ossssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssststsssssssssssssssstosPPPPPPPjQPPPPTPuuPPTPPTssssssoooooooooooooosssssssssssssssssssssssssssssssPTPPTPPTTTPTTPTPPPTPTPTPTPPssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiPPPPPPPTPiiiiiiiiiiiiiiiiiiiiiiPPPPPPPPPPPPPPPPPPPPPfffffffffffffff/////////////////////////////////////////////////////PTPP//RRR4//////////////////////////////////////////////////////////O///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////O///////////////////////////////////////////////////////////////////////////////////////////O//////////////////////////////////////////////////////////////////////////////////////////////////////////O/////////////////////////////////////////////////////////////////R///////////////////////////////////////////////////////4RRR////////////////////////////////////4/OOORRRRRRRRRRRRRROOOOOTTOOOOOOOTOTO//////////////////////////////////////PPRPP////OOOOOOOOTOOOOOOOORRRRROOOO///////////////////////////////////////////RRRRRR/////////////////////////////T/OO,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,///////////////////////////////////////////R2///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////PORRRRRRRR/////////////////////////////////////////////////////////////////////////////////////////////////////S////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////RR//////////////////////////////////////////////////////////////////////////////////////////////////////////////////////RRR///////////////////////////////////RR//////////////////////////////////////////////////////////////////////////////////////RRR4RRR/PS///////////////////////////////////4/////////////////////////////////////////////////////////////////////////////////////////////V////////////////////////////////////////////////////////////////////////////////////////////////////UPT/////////////////////////////////////////////////////////////////////////////////////////////////////////////PTRR/////////////////////////////////////////////////////PPPPPPPPTRRRRRRR4RRRRRR////////////////////////////////////////////////RRRRRRROOOOOOOOOOPTPPPPPPPOOOOOOOOO////////////////////////////////////////////////////////////////////RRRRR/////////////////////////////////444444RRPPPRTTTTTPPTTTTP////T////............................................222422222222222422222222222222222242222222222222222222#########.............2..................................2222222222222222222222222222222222222PPTPPPPPPPTPPTPPPPPPPPPPPPPPPPPPPPPPTPT&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+++++#..,.&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+&+,.,.,.++++++++&&&&&&&&++++++&&&&&&++++++++&&&&&&&&++++++++&&&&&&&&++++++&&&&&&++++++++&&&&++++++++&&&&&&&&++++++++++++++++++++++++++++++++++++++&&&999K+++++&&KKK+++++&&&KKK+++++++&&&&K+++++&&9Sl$M2"""""22222PPPPPPPPQQQQPQQQPTPTTTTP00#000##0000000000000#00,0####00MMMM0####M.O%%%%%%,.%(((((MMM((MMMMMMMMMMMM(MM(M(MMMMM(((((((((((MMMMMMMMMMMMMMMM(MMMMMM(MM(MMMMMMMMM(MMMMMMMMMMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMOMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%""""""""""""""""""""((MMMMMMMM(OMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,...............................................,.,,,..,.,.,.,,,,.,..,......#2,,,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,..,.,.PPP......................................//////////////////////////////////////////////////////2///////////////////////////////////////////////////////////////////////////////PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP$$$$SS$$3////////////////////////////////////////444444RR////////////4//////////////////,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,./PQQQPP3,.,.,.,.,.,.,.,.,.,.,.,.//////////////////////////////////////////////////////////////////////PPRRRRRR5555555555555555555555533333333355,.,.,.,.,.,.,...,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.,.2........,.,.,,.,.,.,.,.3,./////////////////////////////////////OO//////////////////////////////////////////////////////////////////////////////////////////////////////RRPPPPPPPPPPPPPPPPPP//////RRR/////////////////////////////TTTRR///////////////////////R///////////////////////////////////////////////RRRRRRRRRRRRR4RR////////////////////////////////////////////////////RRRR////////////////4//////OOO/////////////////////////////////////////////////P/PPT//PP/////PP/P///4RR///////////////////////////////////R                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                          ############                                   FFFFFFFFFFFFFFFFPPPPPPPs ! "#$%&%%''''''''''%()(**************************"#+,+--------------------------")#)"#./0..11111111112111111111111111111111111111111111111111111111221111111111111111111111111111111111111111111111111111!!)+3!!4555544666///////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////ROOOOOOOOOO77777777777777777777777777777777777777777777777777777OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOT////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////R////////////////////////////////////////////R,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,........................................//////////////////////////////////////////////////////////////////////////////iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiif88888888iiiiiiiiiiiiiiiiiiiiii888888iiiiiiiiiiiiiiiiiiiiiiiiiifiTPiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiPT88888888fffffffffiiiiiiiiiiiiiiiiiiiiiiiiiiiii88fiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii88888888iiiiiiiiiiiiiiiiiii88888888iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii9999999999999999999999999999999//////////////////////////////////////////RRRRRR///////////////////////////////////////////////////////////////////////////////////////////////////////////////RRRR///////////////////////////////////////////////OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO:::::::;;OOO<;;;;;TTTTTTTTOOPPPPPTTOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPPPOOOOOOOOOOOOO::::::OOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPP00000000000000000000000000##########################00000000000000000000000000#########################00000000000000000000000000##########################000000000000000000#######################00000000000000000000000000##########################000000000000000000000##########################0000000000000000000##########################00000000000000000000000000##########################00000000000000000000000000##########################00000000000000000000000000##########################00000000000000000000000000##########################00000000000000000000000000##########################00000000000000000000000000############################0000000000000000000000000=###############################0000000000000000000000000=###############################0000000000000000000000000=###############################0000000000000000000000000=###############################0000000000000000000000000=###############################0#>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>"""""""""""?                              FFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFFF                                                                                                                              slice(stop) slice(start, stop[, step]) Create a slice object. This is used for extended slicing (e.g. a[0:10:2]).W/H;k/`$fstat(fd) -> dir-tuple Stat a fd.$e! j! p!ۯ w!ű disable() -> None Disable automatic garbage collection. Private method returning an estimate of len(list(it)).inet_ntoa(packed_ip) -> ip_address_string Convert an IP address from 32-bit packed binary format to string format|>-]?>-?>-?signal(sig, action) -> action Set the action for the given signal. The action can be SIG_DFL, SIG_IGN, or a callable Python object. The previous action is returned. See getsignal() for possible return values. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.startfinishsecondsmillimicrothe timing module has been removed in Python 3.0; use time.clock() insteadtimingS.strip([chars]) -> unicode Return a copy of the string S with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is a str, it will be converted to unicode before strippingunmount(old, [name]) -> None Unmount name from old.;xs8 ;B}8;@/oZ*Efficient binary diff.$WCRANGE$$WCMODS?M:$<8y8b8`s88188(88n8J8B8888Y̐88 V8V848'8!8]08@8h8j8`H8NNJ8B88F8h<8088?8Ҧ8'88N8D8`8$868o8^8FF`8!z808"8$8HB8R8Gj8V8H8S<8888S@8J8v88g88881H8883U:8WeX8'H8Nf8r88kp8z8)8-"8fork() -> pid Fork a child process. Return 0 to child process and PID of child to parent process.w)|)Read and return up to n bytes, with at most one read() call to the underlying raw stream. A short result does not imply that EOF is imminent. Returns an empty bytes object on EOF. seek(offset[, whence]) -> None. Move to new file position. Argument offset is a byte count. Optional argument whence defaults to 0 (offset from start of file, offset should be >= 0); other values are 1 (move relative to current position, positive or negative), and 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file). If the file is opened in text mode, only offsets returned by tell() are legal. Use of other offsets causes undefined behavior. Note that not all file objects are seekable.cosh(x) Return the hyperbolic cosine of x.S.split([sep [,maxsplit]]) -> list of strings Return a list of the words in the string S, using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done. If sep is not specified or is None, any whitespace string is a separator and empty strings are removed from the result.-Unpack the string containing packed C structure data, according to fmt. Requires len(string) == calcsize(fmt).Z5#mlocked() -> bool (locked_lock() is an obsolete synonym) Return whether the lock is in the locked state.3 <D!u1`;t8b  :ISO-8859-1st_devst_modest_nlinkst_sizest_mtimest_ctimeosutil.statstat objects...siNsiO:statfilesnot a sequencenot a stringpathstatskips#|OO:listdirlistdirlist a directory statfilesstat a series of files or symlinks Returns None for non-existent entries and entries of other types. osutil.hgO:encodedirexpected a string~2e.h.hg~20s#:lowerencodedh/mercurial.utilmercurial.utilsha1module 'mercurial.util' has no attribute 'sha1's#digestresult of digest is not a 20-byte hashstring too longO:pathencodeexpected a stringosnamePlan9sysnamesite?40cputype?386i386setpgid(pid, pgrp) Call the system call setpgid()./net/cs!port=%d %s=*%s=%s/net/cs!ip=%s dom=*dom=%s%stcpudp%dhttp://www.w3.org/2000/xmlns/̠!Ԡ!ޠ!!!!!!!!#!*!9!B!)% )% (`4Bqq?B.upper() -> copy of B Return a copy of B with all ASCII characters converted to uppercase.G1F P1G1+H r/G1H b"G1'I 89999'949?9S9`9u9GC object already tracked../Objects/methodobject.c../Objects/methodobject.c../Objects/methodobject.c%.200s() takes no arguments (%zd given)%.200s() takes exactly one argument (%zd given)../Objects/methodobject.c%.200s() takes no keyword argumentsmethod.__self__ not accessible in restricted mode__doc____name____self____module__builtin_function_or_method order comparisons not supported in 3.xbuiltin_function_or_method__methods____methods__ not supported in 3.x__doc__\#e#n# u#|######### #This module supports asynchronous I/O on multiple file descriptors. *** IMPORTANT NOTICE *** On Windows and OpenVMS, only sockets are supported; on Unix, all file descriptors.rmdir(path) Remove a directory.$0$$$$t#$5$IB$X$\b$t$*t$$m$TPBQ`}Pp==33115t ND  l`VD4 +  T>!#%'v)j+\-Z/L1<365 7 9: < h>#@A,JCEF HJzLNPQSUWYx[p]T_acdf\h Bjlmo qs%\uwxz|~ `H<p$ VQH,hQė-j: "|  XZ,Y`,xINffffff?!$ ; -1#ԡ :L.extend(iterable) -- extend list by appending elements from the iterableexc_clear() -> None Clear global information on the current exception. Subsequent calls to exc_info() will return (None,None,None) until another exception is raised in the current thread or the execution stack returns to a frame where another exception is being handled.atoi(s [,base]) -> int Return the integer represented by the string s in the given base, which defaults to 10. The string s must consist of one or more digits, possibly preceded by a sign. If base is 0, it is chosen from the leading characters of s, 0 for octal, 0x or 0X for hexadecimal. If base is 16, a preceding 0x or 0X is accepted.H)*;+e ,8.$8S9#l'ߴH)X63q8=This module makes available standard errno system symbols. The value of each symbol is the corresponding integer value, e.g., on most systems, errno.ENOENT equals the integer 2. The dictionary errno.errorcode maps numeric codes to symbol names, e.g., errno.errorcode[2] could be the string 'ENOENT'. Symbols that are not relevant to the underlying system are not defined. To map error codes to error messages, use the function os.strerror(), e.g. os.strerror(2) could return 'No such file or directory'.Access to the Unix group database. Group entries are reported as 4-tuples containing the following fields from the group database, in order: name - name of the group passwd - group password (encrypted); often empty gid - numeric ID of the group mem - list of members The gid is an integer, name and password are strings. (Note that most users are not explicitly listed as members of the groups they are in according to the password database. Check both databases to get complete membership information.)A?9E?9lseek(fd, pos, how) -> newpos Set the current position of a file descriptor./usr/(e`@Python import machinery not initializedmodule functions cannot set METH_CLASS or METH_STATIC__doc__unmatched paren in formatUnmatched paren in formatUnmatched paren in formatUnmatched paren in formatstring too long for Python stringNULL object passed to Py_BuildValuebad format char passed to Py_BuildValuePyModule_AddObject() needs module as first argPyModule_AddObject() needs non-NULL valuemodule '%s' has no __dict__G$L$R$s!)E'Ņ-"~f-!~"-!~-!}-!~T-!~-!~-!~-!~D-!~-!~-!~x-!~4-"~-!~-!~f-!~"-!}-#~-!~P-!} -"}-"~|-!~8-!~-!ugettokens(s, sep) -> list of stringsbuffer_info() -> (address, length) Return a tuple (address, length) giving the current memory address and the length in items of the buffer used to hold array's contents The length should be multiplied by the itemsize attribute to calculate the buffer length in bytes.ԡregister_error(errors, handler) Register the specified error handler under the name errors. handler must be a callable object, that will be called with an exception instance containing information about the location of the encoding/decoding error and must return a (replacement, new position) tuple.K# K#K#3"d!Ib3Nb3pb3ub3s-$bEb-;ba55?I-frozenset() -> empty frozenset object frozenset(iterable) -> frozenset object Build an immutable unordered collection of unique elements.c;array item must be charh;array item must be integersigned char is less than minimumsigned char is greater than maximumb;array item must be integeru#;array item must be unicode characterarray item must be unicode characterh;array item must be integeri;array item must be integerunsigned short is less than minimumunsigned short is greater than maximumi;array item must be integerl;array item must be integerunsigned int is less than minimumunsigned int is greater than maximuml;array item must be integerl;array item must be integerunsigned long is less than minimumunsigned long is greater than maximumf;array item must be floatd;array item must be float../Modules/arraymodule.c../Modules/arraymodule.carray index out of rangecan only append array (not "%.200s") to arraycan only assign array (not "%.200s") to array slicearray assignment index out of rangecan only extend with array of same kindcan only extend array with array (not "%.200s")array.index(x): x not in listarray.remove(x): x not in list|n:poppop from empty arraypop index out of rangenO:insertdon't know how to byteswap this array typeOn:fromfilearg1 must be open filenot enough items in filearray.read() not supported in 3.x; use array.fromfile()arg must be open filearray.write() not supported in 3.x; use array.tofile()arg must be lists#:fromstringstring length not a multiple of item sizeu#:fromunicodefromunicode() may only be called on type 'u' arraystounicode() may only be called on type 'u' arrays__dict__O(cO)Otypecodethe typecode character used to create the arrayitemsizethe size, in bytes, of one array itemappendbuffer_infobyteswap__copy__count__deepcopy__extendfromfilefromlistfromstringfromunicodeindexinsertpopread__reduce__removereversetofiletolisttostringtounicodewrite__sizeof__array('%c')array('%c', )array indices must be integersarray assignment index out of rangearray indices must be integercan only assign array (not "%.200s") to array sliceattempt to assign array of size %zd to extended slice of size %zdAccessing non-existent array segmentAccessing non-existent array segmentarray.array()c|O:arraybad typecode (must be c, b, B, u, h, H, i, I, l, L, f or d)array.array../Modules/arraymodule.carrayiteratorarrayArrayTypearrayReturn the symmetric difference of two sets as a new set. (i.e. all elements that are in exactly one of the sets.)format(value[, format_spec]) -> string Returns value.__format__(format_spec) format_spec defaults to ""$&}$e$1$ʳ$Wӳ$PUBLICReport whether this set contains another set.p--p1-$-4$N9T939 Decode a string of qp-encoded datagroupby(iterable[, keyfunc]) -> create an iterator which returns (key, sub-iterator) grouped by each value of key(value). getpwuid(uid) -> (pw_name,pw_passwd,pw_uid, pw_gid,pw_gecos,pw_dir,pw_shell) Return the password database entry for the given numeric user ID. See help(pwd) for more on password database entries.L.append(object) -- append object to endS.endswith(suffix[, start[, end]]) -> bool Return True if S ends with the specified suffix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. suffix can also be a tuple of strings to try.(ascii) -> bin. Decode a line of uuencoded datainputerrorserrorsinputfinalstreamerrorsstrictignorereplacestrictignorereplaceerrors must be a stringerrorshow to treat errorsillegal multibyte sequenceincomplete multibyte sequenceinternal codec errorunknown runtime errorencoding error handler must return (unicode, int) tupleposition %zd from error handler out of boundsillegal multibyte sequenceincomplete multibyte sequenceinternal codec errorunknown runtime errordecoding error handler must return (unicode, int) tupleposition %zd from error handler out of boundsO|z:encodecouldn't convert the object to unicode.s*|z:decodeencodedecodeMultibyteCodeccouldn't convert the object to unicode.pending buffer overflowpending buffer overflowO|i:encodeencodereset|s:IncrementalEncodercodeccodec is unexpected typeMultibyteIncrementalEncoders*|i:decodedecodereset|s:IncrementalDecodercodeccodec is unexpected typeMultibyteIncrementalDecoderistream function returned a non-string objectreadarg 1 must be an integerreadreadlinearg 1 must be an integerreadlinereadlinesarg 1 must be an integerreadreadreadlinereadlinesresetstreamO|s:StreamReadercodeccodec is unexpected typeMultibyteStreamReaderwriteOarg must be a sequence objectwriteOO|s:StreamWritercodeccodec is unexpected typewritewritelinesresetstreamMultibyteStreamWritermultibytecodec.__map_*argument type invalidmultibytecodec.__map_*__create_codec_multibytecodeccan't initialize the _multibytecodec module;SG.^\N]eg^ggXa dAegj`ioj    !"# $split(string[, maxsplit = 0]) --> list. Split string by the occurrences of pattern.A buffered reader and writer object together. A buffered reader object and buffered writer object put together to form a sequential IO object that can read and write. This is typically used with a socket or two-way pipe. reader and writer are RawIOBase objects that are readable and writeable respectively. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE. // /Tools that operate on functions.B.replace(old, new[, count]) -> bytes Return a copy of B with all occurrences of subsection old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.execve(path, args, env) Execute a path with arguments and environment, replacing current process. path: path of executable file args: tuple or list of arguments env: dictionary of strings mapping to stringsdecode(obj, [encoding[,errors]]) -> object Decodes obj using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle ValueErrors.Ajћ@scanstring(basestring, end, encoding, strict=True) -> (str, end) Scan the string s for a JSON string. End is the index of the character in s after the quote that started the JSON string. Unescapes all valid JSON string escape sequences and raises ValueError on attempt to decode an invalid string. If strict is False then literal control characters are allowed in the string. Returns a tuple of the decoded string and the index of the character in s after the end quote.$9I$c6 P#c6A @1c6uA 6c666 'c67 $!d6S8 J-d67 $0d69 .!d69  )4d6L: 3Jd6@ ,.Vd6> 6hd6> #rd6@ 4-|d69 49d6= *.d6)> @4d6o= !d6= 3d6>> ..d6< \6d6Q= @+d6{A dq;string -> string. Returns a string that behaves for cmp locale-aware.6,E6r"LFalseTrueTrueFalsex|O:boolboolExtend the left side of the deque with elements from the iterableProfiler(custom_timer=None, time_unit=None, subcalls=True, builtins=True) Builds a profiler object using the specified timer function. The default timer is a fast built-in one based on real time. For custom timer functions returning integers, time_unit can be a float specifying a scale (i.e. how long each integer unit is, in seconds). H)!UE-lUU9 PS33I3S3q3~33333%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%% %%%%%%%  !"#%%%%%%  !"#%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%utime(path, (atime, mtime)) utime(path, None) Set the access and modified time of the file to the given values. If the second form is used, set the access and modified times to the current time.җӫr?j0UWOXìK8K8execv(path, args) Execute an executable path with arguments, replacing current process. path: path of executable file args: tuple or list of stringsPython C API version mismatch for module %.100s: This Python has API version %d, module %.100s has version %d.(data, oldcrc) -> newcrc. Compute hqx CRC incrementallyW/zx3mkdir(path [, mode=0777]) Create a directory.#$U l! A$z  t?-" z" %%s /1@T?|/`#m^##=ǿ@ ?%l ?PP1b,@ɀ?????_@L?`?T{?|=?ӟ9mӇ9^;9=ǿ==`=`@=%l;_??>fw\W/ $-.1`$BZ2File(name [, mode='r', buffering=0, compresslevel=9]) -> file object Open a bz2 file. The mode can be 'r' or 'w', for reading (default) or writing. When opened for writing, the file will be created if it doesn't exist, and truncated otherwise. If the buffering argument is given, 0 means unbuffered, and larger numbers specify the buffer size. If compresslevel is given, must be a number between 1 and 9. Add a 'U' to mode to open the file for input with universal newline support. Any line ending in the input file will be seen as a '\n' in Python. Also, a file so opened gains the attribute 'newlines'; the value for this attribute is one of None (no newline read yet), '\r', '\n', '\r\n' or a tuple containing all the newline types seen. Universal newlines are available only when reading. vars([object]) -> dictionary Without arguments, equivalent to locals(). With an argument, equivalent to object.__dict__.S.capitalize() -> unicode Return a capitalized version of S, i.e. make the first character have upper case and the rest lower case.../Objects/tupleobject.cGC object already tracked../Objects/tupleobject.c../Objects/tupleobject.ctuple index out of range../Objects/tupleobject.ctuple assignment index out of range(, ,)()(...) while getting the repr of a tuple(,)), tuple index out of range../Objects/tupleobject.ccan only concatenate tuple (not "%.200s") to tupleO|O&O&:indextuple.index(x): x not in tuplesequence|O:tupletuple indices must be integers, not %.200s(N)__getnewargs____sizeof__indexcounttuple../Objects/tupleobject.cGC object already tracked__length_hint__tupleiterator../Objects/tupleobject.cGC object already trackedf6<0a6_getframe([depth]) -> frameobject Return a frame object from the call stack. If optional integer depth is given, return the frame object that many calls below the top of the stack. If that is deeper than the call stack, ValueError is raised. The default for depth is zero, returning the frame at the top of the call stack. This function should be used for internal and specialized purposes only.q?$?b@R{PD?-(b2a_qp(data, quotetabs=0, istext=1, header=0) -> s; Encode a string using quoted-printable encoding. On encoding, when istext is set, newlines are not encoded, and white space at end of lines is. When istext is not set, \r and \n (CR/LF) are both encoded. When quotetabs is set, space and tabs are encoded.1u.&1u9+1u .41u0',$p-3$0-:$0 +E$X#P$g3X$u6`$g3h$ <p$g3x$ <$X!)$ %$@P-$Lt1$m-$R-H)0- d9$"$1connect_ex(address) -> errno This is like connect(address), but returns an error code (the errno value) instead of raising an exception when an error occurs.reversed(sequence) -> reverse iterator over values of the sequence Return a reverse iterator <|31 <Qp/ <\s6 <) <r ascii. Uuencode line of datawarningsPYTHONDEBUGPYTHONVERBOSEPYTHONOPTIMIZEPYTHONDONTWRITEBYTECODEPYTHONHASHSEEDPy_Initialize: can't make first interpreterPy_Initialize: can't make first threadPy_Initialize: can't init framesPy_Initialize: can't init intsPy_Initialize: can't init longsPy_Initialize: can't init bytearrayPy_Initialize: can't make modules dictionaryPy_Initialize: can't make modules_reloading dictionaryPy_Initialize: can't initialize __builtin__Py_Initialize: can't initialize builtins dictPy_Initialize: can't initialize sysPy_Initialize: can't initialize sys dictsyssysmodulesexceptionsexceptions__builtin____builtin__warningsPYTHONIOENCODINGstdinisattyCannot set codeset of stdinstdoutisattyCannot set codeset of stdoutstderrisattyCannot set codeset of stderrPy_NewInterpreter: call Py_Initialize first__builtin____builtin__syssysmodulesPy_EndInterpreter: thread is not currentPy_EndInterpreter: thread still has a framePy_EndInterpreter: not the last threadpythonPYTHONHOME__main__can't create __main__ module__builtins____builtin____builtins__can't add __builtins__ to __main__site???ps1ps1>>> ps2ps2... ps1ps2__main__.pyc.pyo__main____file____file__rbpython: Can't reopen .pyc file .pyo__file____main__O(ziiz)msgfilenamelinenooffsettext ^ codestderr last_typelast_valuelast_tracebackexcepthookError in sys.excepthook: Original exception was: sys.excepthook is missing stderrlost sys.stderr print_file_and_line File ":%d" __module__exceptions.: Bad magic number in .pyc fileBad code object in .pyc fileexpected an indented blockunexpected indentunexpected unindentinvalid syntaxinvalid tokenEOF while scanning triple-quoted string literalEOL while scanning string literalunexpected EOF while parsinginconsistent use of tabs and spaces in indentationexpression too longunindent does not match any outer indentation leveltoo many levels of indentationunknown decode errorunexpected character after line continuation charactererror=%d unknown parsing error(ziiz)(sO)Fatal Python error: %s threading_shutdownexitfuncexitfuncError in sys.exitfunc: ???socket([family[, type[, proto]]]) -> socket object Open a socket of the given type. The family argument specifies the address family; it defaults to AF_INET. The type argument specifies whether this is a stream (SOCK_STREAM, this is the default) or datagram (SOCK_DGRAM) socket. The protocol argument defaults to 0, specifying the default protocol. Keyword arguments are accepted. A socket object represents one endpoint of a network connection. Methods of socket objects (keyword arguments not allowed): accept() -- accept a connection, returning new socket and client address bind(addr) -- bind the socket to a local address close() -- close the socket connect(addr) -- connect the socket to a remote address connect_ex(addr) -- connect, return an error code instead of an exception dup() -- return a new socket object identical to the current one [*] fileno() -- return underlying file descriptor getpeername() -- return remote address [*] getsockname() -- return local address getsockopt(level, optname[, buflen]) -- get socket options gettimeout() -- return timeout or None listen(n) -- start listening for incoming connections makefile([mode, [bufsize]]) -- return a file object for the socket [*] recv(buflen[, flags]) -- receive data recv_into(buffer[, nbytes[, flags]]) -- receive data (into a buffer) recvfrom(buflen[, flags]) -- receive data and sender's address recvfrom_into(buffer[, nbytes, [, flags]) -- receive data and sender's address (into a buffer) sendall(data[, flags]) -- send all data send(data[, flags]) -- send data, may not send all of it sendto(data[, flags], addr) -- send data to a given address setblocking(0 | 1) -- set or clear the blocking I/O flag setsockopt(level, optname, value) -- set socket options settimeout(None | float) -- set or clear the timeout shutdown(how) -- shut down traffic in one or both directions [*] not available on all platforms!grp.struct_group: Results from getgr*() routines. This object may be accessed either as a tuple of (gr_name,gr_passwd,gr_gid,gr_mem) or via the object attributes as named in the above tuple. callable(object) -> bool Return whether the object is callable (i.e., some kind of function). Note that classes are callable, as are instances with a __call__() method.WIFSTOPPED(status) -> bool Return True if the process returning 'status' was stopped.makefile([mode[, buffersize]]) -> file object Return a regular file object corresponding to the socket. The mode and buffersize arguments are as for the built-in open() function.lock_held() -> boolean Return True if the import lock is currently held, else False. On platforms without threads, return False.;SG.^\N]eg^ggXa dAegj`joj    !"# $exp(x) Return the exponential value e**x.truncate(): truncate the file at the current position.H)>"ȰD`#-;{8'!p%-rfork(flags) -> pid Manipulate process resources. If new child is created, return 0 to child process and PID of child to parent process. count Returns the number of already decrypted bytes available for read, pending on the connection. encode_basestring_ascii(basestring) -> str Return an ASCII-only JSON representation of a Python stringtestoverflow div by 0 nested outer nested inner trailing outer nested prior nested interior nested trailing PASS FAIL Division by zero, outer zoneDivision by zero, inner zoneDivision by zero, prior errorDivision by zero, nest3 errorDivision by zeroOverflowfpetestfpetest.errorerror/srv/ptyfs5?W"Y"tolist() -> list Convert array to an ordinary list with the same items.${3&{3({3+{3ldexp(x, i) Return x * (2**i).A{3C{3E{3H{3dG.find_module(fullname, path=None) -> self or None. Search for a module specified by 'fullname'. 'fullname' must be the fully qualified (dotted) module name. It returns the zipimporter instance itself if the module was found, or None if it wasn't. The optional 'path' argument is ignored -- it's there for compatibility with the importer protocol.4U}!'set_threshold(threshold0, [threshold1, threshold2]) -> None Sets the collection thresholds. Setting threshold0 to zero disables collection. )WW)WW)X XX`),)XX X$X4)REQUIRED,X؜)0X8X None pause execution.H)'"A+##i:alarmiO:signalsignal only works in main threadsignal number out of rangesignal handler must be signal.SIG_IGN, signal.SIG_DFL, or a callable objecti:getsignalsignal number out of rangei:set_wakeup_fdset_wakeup_fd only works in main threadinvalid fdalarmsignalgetsignalset_wakeup_fdpausedefault_int_handlersignalSIG_DFLSIG_IGNNSIGdefault_int_handlerSIGHUPSIGINTSIGQUITSIGILLSIGABRTSIGFPESIGKILLSIGBUSSIGSEGVSIGPIPESIGALRMSIGTERMSIGUSR1SIGUSR2SIGCHLDSIGSTOPSIGTSTPSIGCONTSIGTTINSIGTTOU(iO)signalsignalwrite(s) -- Write a string to the file Note (hack:) writing None resets the bufferlower(s) -> string Return a copy of the string s converted to lowercase.udptcplistenbind 0announce %dannounce ****1-6- ;-@-H)#;,,i*m****H)8|=#D8$** *X%*6(-0Eڞ6[-~,8"a0LL.__sizeof__() -- size of L in memory, in bytes                    PPPPPP          !"PP  # $ P P   P T[P  PgkvzP                          P                 ,!5!;SG.^\N]eg^ggXa dAegj`shh    !"# $_##\##@$\#$$%?descriptor '%s' for '%s' objects doesn't apply to '%s' objectdescriptor '%s' for type '%s' needs either an object or a typedescriptor '%s' for type '%s' needs a type, not a '%s' as arg 2descriptor '%s' for type '%s' doesn't apply to type '%s'attribute '%.300s' of '%.100s' objects is not readabledescriptor '%.200s' for '%.100s' objects doesn't apply to '%.100s' objectattribute '%.300s' of '%.100s' objects is not writabledescriptor '%.300s' of '%.100s' object needs an argumentdescriptor '%.200s' requires a '%.100s' object but received a '%.100s'descriptor '%s' of '%.100s' object needs an argumentdescriptor '%s' requires a type but received a '%.100s'descriptor '%s' requires a subtype of '%.100s' but received '%.100sdescriptor '%.300s' of '%.100s' object needs an argumentdescriptor '%.200s' requires a '%.100s' object but received a '%.100s'__objclass____name____doc____doc____doc____doc__method_descriptorclassmethod_descriptormember_descriptorgetset_descriptorwrapper_descriptorgetget(OO)keysvaluesitemsiterkeysitervaluesiteritemscopyhas_keyD.has_key(k) -> True if D has a key k, else FalsegetD.get(k[,d]) -> D[k] if D.has_key(k), else d. d defaults to None.keysD.keys() -> list of D's keysvaluesD.values() -> list of D's valuesitemsD.items() -> list of D's (key, value) pairs, as 2-tuplesiterkeysD.iterkeys() -> an iterator over the keys of DitervaluesD.itervalues() -> an iterator over the values of DiteritemsD.iteritems() -> an iterator over the (key, value) items of DcopyD.copy() -> a shallow copy of Ddict_proxy(%s)dictproxyGC object already tracked__self____objclass____name____doc__wrapper %s doesn't take keyword argumentsmethod-wrapperGC object already trackedfgetfsetfdel__doc__gettersetterdeleterunreadable attribute(O)can't delete attributecan't set attribute(O)(OO)OOOOfgetfsetfdeldoc|OOOO:property__doc____doc__property -)_3-_l&--a"!-a4C)/-t_hk/5-q^!H$O$U$i[$d$m$v$}$ $$$$$4$5$ $s-W`s-`sorted(iterable, cmp=None, key=None, reverse=False) --> new sorted listid(object) -> integer Return the identity of an object. This is guaranteed to be unique among simultaneously existing objects. (Hint: it's the object's memory address.)Return the union of sets as a new set. (i.e. all elements that are in either set.)Create a new buffered reader using the given readable raw IO object.NNN)N+N.N@NGNHNQN4ZNiNN,4.4NNNNNNNNNNOOdO7O>OTOXOwOxOzO}OOOOOOOOOOOOj4OPPPPP"Ph4BPFPNPSPWPcPfPjPpPPPPPPPPPPPPPPPPPPPP4QQQ`QsQQQ4QQQ4QQQRRRUR\RlRwRRRRRRRRRR5RR S S$S5S>SBSgSlSzSSSSS]5^5SSc5SSUT$T(Tn5CTbTfTlTTTTTTTTTTTTTTTTUU U^I^\8V^a8k^l^m^n^^^^^^^^^^____G_c_r_~______8__________9`"`$`9L``````````````aaaaa:ao9AaFa`a|aaaaaaaaaaaab#b)bFbLbQbRbabdb{bmbsbbbbbc cc2c5c;chDhEhIhLhUhWhw;khnhzh|hhhhm;hhhhhhhhhhhhhhhhhhhii;;;i;Fiiiliriziii;iiiiiiiiii0jiiii;iijjj2j3j4j?jFjIjzjNjRjdj~jjj;jjjjjjjjjjjjjjj kkkkk&I+r4r8r9r,NBrSrWrcrnrorxrrrrrrrr`>rf>h>rrssss>9s,s1s3s=sRs>kslsnsosqswsssssssssssssssssssstst$t1t9tSt@tCtMtRt]tqttttttttttttttttttttt u$u*uW?=u>u@uHuNuPuRuluruquzu}u~uuuu?uw?uuuuuuuuuuuuuuuvvvv?vvv%v(v}@}G}BY}Z}j}p}B}}}}}}}}}}}}}}}}CX~~~ ~'~,~E~s~u~~~~~+C~~~CC<;>CDO4Racdm}~{Q $,0Cfqu{ŀՀ؀ C5C$',=DiDD"DÁցہ!"24QS^ab{}Džʅ؅م߅!$'9<@ SVowz!ÆцՆ׆憸E!#1:>@CQXder|E·߇ (.2<FJX_dio҈шӈۈAF7BEIeFb։؉뉡FF!5>EMX׊  -C GQ^v9=EGOTWimsdG֌Ռٌ lƍȍٍ G!"'H69KTblmoюԎNH+@JXfƏ$ʏ͏ӏՏ 7CD]HÐȐܐߐ79:FGWYadtyÑđڑ 3BGJNQVY`aegh|}ƒΒВגْ ')GQWZkqsǓܓ 24;Emoxyȕ,34 bytearray. bytearray(string, encoding[, errors]) -> bytearray. bytearray(bytes_or_bytearray) -> mutable copy of bytes_or_bytearray. bytearray(memory_view) -> bytearray. Construct an mutable bytearray object from: - an iterable yielding integers in range(256) - a text string encoded using the specified encoding - a bytes or a bytearray object - any object implementing the buffer API. bytearray(int) -> bytearray. Construct a zero-initialized bytearray of the given length.PyEval_AcquireThread: NULL new thread statePyEval_AcquireThread: non-NULL old thread statePyEval_ReleaseThread: NULL thread statePyEval_ReleaseThread: wrong thread statethreading_after_forkPyEval_SaveThread: NULL tstatePyEval_RestoreThread: NULL tstatemaximum recursion depth exceeded%sceval: tstate mix-upceval: orphan tstatelocal variable '%.200s' referenced before assignmentinvalid argument to DUP_TOPX (bytecode corruption?)displayhooklost sys.displayhookstdoutlost sys.stdout stdoutlost sys.stdout bad RAISE_VARARGS opargno locals'finally' pops bad exceptionno locals found when storing %sname '%.200s' is not definedno locals when deleting %sglobal name '%.200s' is not definedno locals when loading %sname '%.200s' is not definedglobal name '%.200s' is not definedlocal variable '%.200s' referenced before assignmentlocal variable '%.200s' referenced before assignmentfree variable '%.200s' referenced before assignment in enclosing scope__import____import__ not foundno locals found during 'import *'__exit____enter__XXX lineno: %d, opcode: %d unknown opcodeerror return without exception setPyEval_EvalCodeEx: NULL globals%.200s() takes %s %d argument%s (%d given)at mostexactlys%.200s() keywords must be strings%.200s() got an unexpected keyword argument '%.400s'%.200s() got multiple values for keyword argument '%.400s'%.200s() takes %s %d argument%s (%d given)at leastexactlys%.200s() takes no arguments (%d given)replaceexc_typeexc_valueexc_tracebackexc_typeexc_valueexc_tracebackraise: arg 3 must be a traceback or Nonecalling %s() should have returned an instance of BaseException, not '%s'instance exception may not have a separate valueexceptions must be old-style classes or derived from BaseException, not %sexceptions must derive from BaseException in 3.xneed more than %d value%s to unpackstoo many values to unpackstdout argument list must be a tuplekeyword list must be a dictionary()()() constructor instance object%.200s() takes no arguments (%d given)%.200s() takes exactly one argument (%d given)%.200s%s got multiple values for keyword argument '%.200s'%.200s%.200s argument after ** must be a mapping, not %.200s%.200s%.200s argument after * must be a sequence, not %200sslice indices must be integers or None or have an __index__ methodcatching of string exceptions is deprecatedcatching classes that don't inherit from BaseException is not allowed in 3.xcatching of string exceptions is deprecatedcatching classes that don't inherit from BaseException is not allowed in 3.xcannot import name %.230s__all____dict__from-import-* object has no __dict__ and no __all__keys__metaclass____class____metaclass__Error when calling the metaclass bases %sglobals and locals cannot be NULLexec: arg 1 must be a string, file, or code objectexec: arg 2 must be a dictionary or Noneexec: arg 3 must be a mapping or None__builtins____builtins__code object passed to exec may not contain free variablesstrings are too large to concatgetgroups() -> list of group IDs Return list of supplemental group IDs for the process.Separate the underlying buffer from the TextIOBase and return it. After the underlying buffer has been detached, the TextIO is in an unusable state. getuid() -> uid Return the current process's user id.  );1E1Read at most n characters, returned as a string. If the argument is negative or omitted, read until EOF is reached. Return an empty string at EOF.  5?access(path, mode) -> True if granted, False otherwise Use the real uid/gid to test for access to a path. Note that most operations will use the effective uid/gid, therefore this routine can be used in a suid/sgid environment to test if the invoking user has the specified access to the path. The mode argument can be F_OK to test existence, or the inclusive-OR of R_OK, W_OK, and X_OK.The python bz2 module provides a comprehensive interface for the bz2 compression library. It implements a complete file interface, one shot (de)compression functions, and types for sequential (de)compression. getsockopt(level, option[, buffersize]) -> value Get a socket option. See the Unix manual for level and option. If a nonzero buffersize argument is given, the return value is a string of that length; otherwise it is an integer.writable() -> bool. True if file was opened in a write mode.cannot add more blocks to the dequepop from an empty dequepop from an empty deque|n:rotatedeque mutated during iterationdeque mutated during remove().deque.remove(x): x not in dequedeque index out of rangedeque index out of rangeOOi__dict__O(O)O(On)O(OO)OO(On)O[...]deque(%%r, maxlen=%zd)deque(%r), [...]deque([])], maxlen=%ld)iterablemaxlen|OO:dequemaxlen must be non-negativemaxlenmaximum size of a deque or None if unboundedappendappendleftclear__copy__countextendextendleftpoppopleft__reduce__remove__reversed__reverserotate__sizeof__collections.dequedeque mutated during iteration__length_hint__deque_iteratordeque mutated during iterationdeque_reverse_iteratoriteritems()__missing__copy__copy____reduce__default_factoryFactory for default value called by __missing__().defaultdict(None, )None...defaultdict(%s, %s)first argument must be callablecollections.defaultdict_collectionsdequedefaultdictAdd an element to a set. This has no effect if the element is already present.?Read until newline or EOF. Returns an empty string if EOF is hit immediately. ;+h/+/lI-)":"L"T"f"$7/pC#!omE̋6mEnFl#UUUUUU?y$z$|$$$$$$$$$$$$$$$$$$=/usr/Add an element to the left side of the deque.WTERMSIG(status) -> integer Return the signal that terminated the process that provided the 'status' value.%.200s: line %i, column %iscodeoffsetlinenostrictstrict../Modules/pyexpat.cCharacterData(NN)StartElement(N)EndElement(NO&)ProcessingInstruction(NNNNN)UnparsedEntityDeclNiNNNNNEntityDecl(O&O&i)XmlDecl(iiO&N)NNElementDecl(NNO&O&i)AttlistDeclNiSkippedEntity(NNNN)NotationDecl(NN)StartNamespaceDecl(N)EndNamespaceDecl(O&)Comment()StartCdataSection()EndCdataSection(N)Default(N)DefaultHandlerExpand()NotStandalone(O&NNN)ExternalEntityRef(NNNi)StartDoctypeDecl()EndDoctypeDecls#|i:Parseread() did not return a string object (type=%.400s)read() returned too much data: %i bytes requested, %i returnedreadargument must have 'read' attributes:SetBasezz|s:ExternalEntityParserCreatei|O:UseForeignDTDParseParseFileSetBaseGetBaseExternalEntityParserCreateSetParamEntityParsingGetInputContextUseForeignDTDreplaceXML_ParserCreate failedErrorCodeErrorLineNumberErrorColumnNumberErrorByteIndexCurrentLineNumberCurrentColumnNumberCurrentByteIndexbuffer_sizebuffer_textbuffer_usednamespace_prefixesordered_attributesreturns_unicodespecified_attributesintern__members__ErrorCodeErrorLineNumberErrorColumnNumberErrorByteIndexCurrentLineNumberCurrentColumnNumberCurrentByteIndexbuffer_sizebuffer_textbuffer_usednamespace_prefixesordered_attributesreturns_unicodespecified_attributesinternCannot delete attributebuffer_textnamespace_prefixesordered_attributesreturns_unicodespecified_attributesbuffer_sizebuffer_size must be an integerbuffer_size must be greater than zerobuffer_size must not be greater than %iCharacterDataHandlerpyexpat.xmlparserencodingnamespace_separatorintern|zzO:ParserCreatenamespace_separator must be at most one character, omitted, or Noneintern must be a dictionaryl:ErrorStringzParserCreateErrorStringpyexpat.errorspyexpat.modelpyexpatxml.parsers.expat.ExpatErrorerrorExpatErrorXMLParserType2.7.5__version__EXPAT_VERSIONversion_info(iii)native_encodingUTF-8modulespyexpat.errorserrorspyexpat.modelmodelsifeaturesXML_ERROR_NO_MEMORYXML_ERROR_SYNTAXXML_ERROR_NO_ELEMENTSXML_ERROR_INVALID_TOKENXML_ERROR_UNCLOSED_TOKENXML_ERROR_PARTIAL_CHARXML_ERROR_TAG_MISMATCHXML_ERROR_DUPLICATE_ATTRIBUTEXML_ERROR_JUNK_AFTER_DOC_ELEMENTXML_ERROR_PARAM_ENTITY_REFXML_ERROR_UNDEFINED_ENTITYXML_ERROR_RECURSIVE_ENTITY_REFXML_ERROR_ASYNC_ENTITYXML_ERROR_BAD_CHAR_REFXML_ERROR_BINARY_ENTITY_REFXML_ERROR_ATTRIBUTE_EXTERNAL_ENTITY_REFXML_ERROR_MISPLACED_XML_PIXML_ERROR_UNKNOWN_ENCODINGXML_ERROR_INCORRECT_ENCODINGXML_ERROR_UNCLOSED_CDATA_SECTIONXML_ERROR_EXTERNAL_ENTITY_HANDLINGXML_ERROR_NOT_STANDALONEXML_ERROR_UNEXPECTED_STATEXML_ERROR_ENTITY_DECLARED_IN_PEXML_ERROR_FEATURE_REQUIRES_XML_DTDXML_ERROR_CANT_CHANGE_FEATURE_ONCE_PARSINGXML_ERROR_UNBOUND_PREFIXXML_ERROR_UNDECLARING_PREFIXXML_ERROR_INCOMPLETE_PEXML_ERROR_XML_DECLXML_ERROR_TEXT_DECLXML_ERROR_PUBLICIDXML_ERROR_SUSPENDEDXML_ERROR_NOT_SUSPENDEDXML_ERROR_ABORTEDXML_ERROR_FINISHEDXML_ERROR_SUSPEND_PE__doc__Constants used to describe error conditions.XML_PARAM_ENTITY_PARSING_NEVERXML_PARAM_ENTITY_PARSING_UNLESS_STANDALONEXML_PARAM_ENTITY_PARSING_ALWAYS__doc__Constants used to interpret content model information.XML_CTYPE_EMPTYXML_CTYPE_ANYXML_CTYPE_MIXEDXML_CTYPE_NAMEXML_CTYPE_CHOICEXML_CTYPE_SEQXML_CQUANT_NONEXML_CQUANT_OPTXML_CQUANT_REPXML_CQUANT_PLUSpyexpat.expat_CAPI 1.0pyexpat.expat_CAPIexpat_CAPIStartElementHandlerEndElementHandlerProcessingInstructionHandlerCharacterDataHandlerUnparsedEntityDeclHandlerNotationDeclHandlerStartNamespaceDeclHandlerEndNamespaceDeclHandlerCommentHandlerStartCdataSectionHandlerEndCdataSectionHandlerDefaultHandlerDefaultHandlerExpandNotStandaloneHandlerExternalEntityRefHandlerStartDoctypeDeclHandlerEndDoctypeDeclHandlerEntityDeclHandlerXmlDeclHandlerElementDeclHandlerAttlistDeclHandlerSkippedEntityHandlerprint(value, ..., sep=' ', end='\n', file=sys.stdout) Prints the values to a stream, or to sys.stdout by default. Optional keyword arguments: file: a file-like object (stream); defaults to the current sys.stdout. sep: string inserted between values, default a space. end: string appended after the last value, default a newline.**exit([status]) Exit the interpreter by raising SystemExit(status). If the status is omitted or None, it defaults to zero (i.e., success). If the status is numeric, it will be used as the system exit status. If it is another kind of object, it will be printed and the system exit status will be one (i.e., failure).S.unpack_from(buffer[, offset]) -> (v1, v2, ...) Return tuple containing values unpacked according to this Struct's format. Unlike unpack, unpack_from can unpack values from any object supporting the buffer API, not just str. Requires len(buffer[offset:]) >= self.size. See struct.__doc__ for more on format strings./proc/%d/noteid#B ;/V//|Ű///i/o//{//{/2/C//[/Ͳ/ղ//;/h/"l//a#//"/ܳ/"// /(/0/L/%P/l/%t/////Դ/ش//&/l/<u//</Ƶ/ε// /f/j////S/Ķ/S̶//f//f//y/8/y@/Z/^/t/|/////ַ/ݷ///(///O/Z/z/l//l///ݸ////"/*/F/LJ/f/Lm/////۹/// /-/c2/T/c]///к/ٺ/%///W/e//z//z/;/@/b/k//4//4Ǽ////'/M/R/t/}//K/ƽ/KϽ/////?/+F/|/+//ľ///c/k////0/H/0T//a//a//1/%/11/W/_////"//"//}"//}"(/K/#T/y/#//'$//'$//$"/K/$X////// // // // /9/  True if D has a key k, else Falsefind_module(name, [path]) -> (file, filename, (suffix, mode, type)) Search for a module. If path is omitted or None, search for a built-in, frozen or special module and continue search in sys.path. The module name cannot contain '.'; to search for a submodule of a package, pass the submodule name and the package's __path__.setcheckinterval(n) Tell the Python interpreter to check for asynchronous events every n instructions. This also affects how often thread switches occur.ENTITIEScode(argcount, nlocals, stacksize, flags, codestring, constants, names, varnames, filename, name, firstlineno, lnotab[, freevars[, cellvars]]) Create a code object. Not for the faint of heart.reduce(function, sequence[, initial]) -> value Apply a function of two arguments cumulatively to the items of a sequence, from left to right, so as to reduce the sequence to a single value. For example, reduce(lambda x, y: x+y, [1, 2, 3, 4, 5]) calculates ((((1+2)+3)+4)+5). If initial is present, it is placed before the items of the sequence in the calculation, and serves as a default when the sequence is empty.V/A)V/'V//V/^|.V/C$4V/ܪ)V/ $;V/x/V/?H'V/l,-V/|3W/,-W/:`!setrecursionlimit(n) Set the maximum depth of the Python interpreter stack to n. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python. The highest possible limit is platform- dependent.copy(array) Return a copy of the array.B.join(iterable_of_bytes) -> bytes Concatenates any number of bytearray objects, with B in between each pair.S.isdecimal() -> bool Return True if there are only decimal characters in S, False otherwise.?s#|is#bad base85 character at position %dbad base85 character at position %dbad base85 sequence at position %db85encodeEncode text in base85. If the second parameter is true, pad the result to a multiple of five characters. b85decodeDecode base85 text. base85ocbuffer overflow in getpath.c's joinpath()os.pyModules/SetupLibos.pyos.py/sysos.pylib-dynloadpybuilddir.txtrPlan9Liblib-dynload/386lib-dynload/sys/lib/python2.7:/sys/lib/python2.7/site-packagesPYTHONPATHPATHcpython/Plan9Could not find platform independent libraries /sys/syslib/python00.zip2.72.7Could not find platform dependent libraries /386lib/lib-dynloadConsider setting $PYTHONHOME to [:] Not enough memory for dynamic PYTHONPATH. Using default static PYTHONPATH. /sys/lib/python2.7:/sys/lib/python2.7/site-packages/sys/386/dev/time/net/%s/%d/data/net/%s/%d/ctludp/net/udp/clonetcp/net/tcp/clone%b3i!/b3>b3/enable(subcalls=True, builtins=True) Start collecting profiling information. If 'subcalls' is True, also records for each function statistics separated according to its current caller. If 'builtins' is True, records the time spent in built-in functions separately from their caller. complex(real[, imag]) -> complex number Create a complex number from a real part and an optional imaginary part. This is equivalent to (real + imag*1j) where imag defaults to 0.@p)y)))ۓ))) #)e) n)| /!~8/!g/!~/!~>/!x/!dv/!o/!~/!~/!s2/!v/!q/!~</!~/!~/!~p/!~,/!~/!~/!~`/!~/!~/!~/!~P/!~ /!~/!~ /!~@!/!~!/!~"/!~t#/!~0$/!~$/!~%/!~d&/!~ '/!~'/!~(/!~T)/!~*/!~*/!~+/!~D,/!~-/!~-/!~x./!~4//!~//!~0/!~h1/!~$2/!~2/!~3/!~X4/!~5/!~5/!~6/!~H7/!~8/!~8/!~|9/!~8:/!~:/!~;/!~l/!~\?/!~@/!~@/!~A/!~LB/!~C/!~C/!~D/!~= 2 and <= 36invalid literal for int() with base %d: %s%ldinteger division or modulo by zeroclassic int divisiondivision by zero(ll)pow() 2nd argument cannot be negative when 3rd argument specifiedpow() 3rd argument cannot be 0negative shift countnegative shift countxbase|Oi:intint() missing string argumentinvalid literal for int() with base %d: %sint() can't convert non-string with explicit base(l)O:__format____format__ requires str or unicodeconjugateReturns self, the complex conjugate of any int.bit_length__trunc__Truncating an Integral returns itself.__getnewargs____format__realthe real part of a complex numberimagthe imaginary part of a complex numbernumeratorthe numerator of a rational number in lowest termsdenominatorthe denominator of a rational number in lowest termsint# cleanup ints : %d unfreed int%s s# v-(vE:v(?+X';7vtDescriptor to change the deleter on a property.'v''Fu''(z'deque([iterable[, maxlen]]) --> deque object Build an ordered collection with optimized access from its endpoints.H)-ŝA4/cH) ;,,v,g4itemgetter(item, ...) --> itemgetter object Return a callable object that fetches the given item(s) from its operand. After f = itemgetter(2), the call f(r) returns r[2]. After g = itemgetter(2, 5, 3), the call g(r) returns (r[2], r[5], r[3])flock(fd, operation) Perform the lock operation op on file descriptor fd. See the Unix manual page for flock(3) for details. (On some systems, this function is emulated using fcntl().)The abstract base class for all I/O classes, acting on streams of bytes. There is no public constructor. This class provides dummy implementations for many methods that derived classes can override selectively; the default implementations represent a file that cannot be read, written or seeked. Even though IOBase does not declare read, readinto, or write because their signatures will vary, implementations and clients should consider those methods part of the interface. Also, implementations may raise a IOError when operations they do not support are called. The basic type used for binary data read from or written to a file is bytes. bytearrays are accepted too, and in some cases (such as readinto) needed. Text I/O classes work with str data. Note that calling any method (even inquiries) on a closed stream is undefined. Implementations may raise IOError in this case. IOBase (and its subclasses) support the iterator protocol, meaning that an IOBase object can be iterated over yielding the lines in a stream. IOBase also supports the :keyword:`with` statement. In this example, fp is closed after the suite of the with statement is complete: with open('spam.txt', 'r') as fp: fp.write('Spam and eggs!') 26:6@6 G6!8W8888/9EM666@lC77I77774CjDDEWE ;K;;;<F::O::9e99G<<B}tan(x) Return the tangent of x (measured in radians).\gs ' nxp    !"# $WIFSIGNALED(status) -> bool Return True if the process returning 'status' was terminated by a signal.?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDJ-DyCxD(,* E52TEqىE/'E!1Eꌠ9Y>)F$_FnFF"F|FMraB3G yhGiWCG*GJH\)c=H7]rHaxHyֲHL}YI\CkFI3T|I\'Isȡ1I:~^Jd~QJvaJ0}GJ>nllJ$KAjZK=P1PKMZ>dKW`M}Kmn/LDcL^LpuLafirM?O8MrbnMG9Mz)M:Ft NdȋBN=ֺ.wN 9iNCNuOILLO֯OO[пOE!P/'%UP_QP6PbDP{U[*QmUx`Q*4VQz5߼QlX R.4R9mr"iRY) kRعeR$N(Sa򮌮>S }W-sSO\]ScbuSp] T%L9hGT.B}T}Ô%IT\nTsqUFQU`RUxӫU?+dpU5=%VN=@[Vҟ&VG0JV=:YVf$0W&sdWW)>W]3sMXk5!a9XBioX)8ӣX*4X5AHxY(-\CYr%4xYv/AYiY?ZOMZ20HwZ~$|7Z-[bZXC}"[;/V[ ;C-[SJ[= \[M"4+\0IΕ2a\|AH\[R\ysKp]WPM4]mH=j]Į]-f]u8W]am ^|M$D@^`-Ut^x^WUH^P.5_[ypH_r]~_':__ k_EW`RVR`'.N`(:W"`Yv5`bind(address) Bind the socket to a local address. For IP sockets, the address is a pair (host, port); the host must refer to the local host. For raw packet sockets the address is a tuple (ifname, proto [,pkttype [,hatype]])H)- `7-'9E28m-Return the digest value as a string of binary data.lookup(name) Look up character by name. If a character with the given name is found, return the corresponding Unicode character. If not found, KeyError is raised.Abstract classes can override this to customize issubclass(). This is invoked early on by abc.ABCMeta.__subclasscheck__(). It should return True, False or NotImplemented. If it returns NotImplemented, the normal algorithm is used. Otherwise, it overrides the normal algorithm (and the outcome is cached). B.islower() -> bool Return True if all cased characters in B are lowercase and there is at least one cased character in B, False otherwise.i'R#asinh(x) Return the hyperbolic arc sine (measured in radians) of x.----help--version-J is reserved for Jython -X is reserved for implementation-specific arguments Unknown option: -%c Argument expected for the -%c option S.__sizeof__() -> size of S in memory, in bytes times() -> (utime, stime, cutime, cstime, elapsed_time) Return a tuple of floating point numbers indicating process times.0 00" 0& % PdRTUVW\ 1 3t%4O 56[]78009:00;< 0 0=>0 0?@ 0 0AB00CDYZ[\]^    005 2  ; 0%%%%%&&%%%%%%2!> ?IJMNKL_`a "f"g"`""R"a"bcdef<")"*"" """33+"."5"4"@&B&A& &!!!!!!!!%"#"<<0 ! !ijk333333333YQ[Q^Q]QaQcQUt|%%%%%%%%%%%%%%%<%4%,%$%%%%%% %%%%m%n%p%o%P%^%j%a%%%%%q%r%s%`!a!b!c!d!e!f!g!h!i!!0"0#0$0%0&0'0(0)0ASDSES!"#$%&'()*+,-./0123456789:ABCDEFGHIJKLMNOPQRSTUVWXYZ1111 1 1 1 1 1111111111111111111 1!1"1#1$1%1&1'1(1)1NYNNNCN]NNNN?QeQkQQRRRSAS\SS N NN N+N8NQENHN_N^NNN@QRRCSSSWXY'YsYP[Q[S[[\"\8\q\]]]]]]r^^ __MbNN N-N0N9NKN9\NNNNNNNNNNNNNNNCQAQgQmQnQlQQQRRRRRRS9SHSGSES^SSSSSX)Y+Y*Y-YT[\$\:\o\]{^^___b6bKbNb/eeeeeefg(g kbkykkkkl4lkp*r6r;rGrYr[rrsNNNNN;NMNONNNNNNNNNNNNNEQDQQQQQQQ RRRSSSSNJSISaS`SoSnSSSSSSSSSSSSSSSSSSSSSVVY.Y1YtYvYU[[<\]]]^^s^|^____ bSbTbRbQbee.g,g*g+g-gckkll8lAl@l>lrssttuu(u)u0u1u2u3uu}vvvvwww:yytzzNNRNSNiNNNNNN OO OO OOOONNNNNNO OIQGQFQHQhQqQQQRRRRRRS!S SpSqS TT T TTT TTT TTTTTTVVV3W0W(W-W,W/W)WYY7Y8YYxYY}YyYYYW[X[[[[[[\y\]^v^t^____b b bbcb[bXb6eeeeeff g=g4g1g5g!kdk{kl]lWlYl_l`lPlUlal[lMlNlpp_r]r~vzs||6 3 nr~k@Lc!2NNMOOOGOWO^O4O[OUO0OPOQO=O:O8OCOTOT&TNT'TFTCT3THTBTT)TJT9T;T8T.T5T6T TWPWOW;WX>YYYYYYYYYYYYY][\[Z[[[[[[,\@\A\?\>\\\\\] ^^^^^__d_b_w_y_________bbbbbbvbbmbb|b~bybsbbobbnbbbbb9e;e8eef_gNgOgPgQg\gVg^gIgFg`gSgWgekkBl^llllllljlzllpllhlll}llrl~ltllvlllllvp|p}pxpbrar`rrrs,u+u7u8uvvwyyyvz|Uo҉7FUdpʎƏŏď]IƑ̑2.1*,&NVNsNNNNNNoOOOsOOlOOOOOpOuOOiO{OO~OOOzOTQRQUQiQwQvQxQQQ;R8R7R:R0R.R6RARRRRSTSSSQSfSwSxSySSSSsTuTTxTTT{TwTTTT|TTqTvTTTbThTT}TTVWwWjWiWaWfWdW|WYIYGYHYDYTYYYYYYYYYYYYYYYYY_[d[c[[[[[[[\H\E\F\\\\\\\\^^^^^^x^^^^^^^&_'_)____|______``/`5``*``!`'`)`+``bb?b>b@bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb>eeeeff fffffff ff g gmgggqggsgwggggogpggg~gguggg|gjgrg#kfkgkkllllllllllllllllllllllllllllllllllppppp,r-r8rHrgrirrrrrrsssss=uuuuvvvvww>y@yAyyyzzyzz|T NqRhˎΏԏяǑёw@?;DBR^NNNOOOOOOOOOOOOOOOOOOOOOOWQQQQNRCRJRMRLRKRGRRRRR SWS{SSSTTTTTTTTTTTTTTTTTTTTTTVWWWWWWWWUYQYOYNYPYYYYYYZYYYYZYi[[[[[[\N\O\M\K\\\]^%^^}^^^^_-_e________`` `%``(`M`p`h`b`F`C`l`k`j`d`Abbc cbbcbbcbbbbbbcc?eEeeee%f-f f'f/ff(f1f$ffgggggggggggggggggggggggggjkkkkkkll m2m*mAm%m m1mmm;m=m>m6mml9m'm8m)m.m5mm+mppppppppp0rrrortrrrrsssssssu-uOuLuNuKuuuuuuxvvvvvvvvwvv w wvvwwxx x xFyIyHyGyyyyyyzzzz}|}}} }}}}8 6րڀÀĀ̀ۀ΀ހ݀"ۂ ҂ׂ܂Ԃтނӂ߂Py{zMkԉts͎̎ʐΐÐKJ͑PKLMbi˗ۘߘXNN P P#PO&P%PO)PPPc/cUcBcFcOcIc:cPc=c*c+c(cMcLcHeIeeeeBfIfOfCfRfLfEfAffggg!h8hHhFhSh9hBhTh)hhhLhQh=hgPh@hSSfFUjUfUDU^UaUCUJU1UVUOUUU/UdU8U.U\U,UcU3UAUWUW W WWX XXWWWX5XWW YbY6ZAZIZfZjZ@ZwUUUUUU~UUUU W/X*X4X$X0X1X!XX XXX`YwZZZZZZs[q[[[[[ \ \1\L]P]4]G]]E^=^@^C^~^^^^^<_m____`````a#a`a```ha`a` aaabIbcccccccccccccccvccccRdcc^efebeceeeenfpftfvfoffzf~fwfffgghhhhhihhhhhhhhhh iiihhnih>k:k=kkkkk.l/l,l/n8nTn!n2ngnJn n%n#nn[nXn$nVnnn-n&non4nMn:n,nCnn>nnnnNncnDnrnin_nqq&q0q!q6qnqqLrrr6s%s4s)s:t*t3t"t%t5t6t4t/tt&t(t%u&ukujuuuuuuuu{v|vvvvvOww]xlxox zz zzzzzzzzI{V{F{P{R{T{M{K{O{Q{||^}P}h}U}+}n}r}a}f}b}p}s}U RUTKQN9F>LSt Ń W ̃ʃ8܃ԃ߃[߆نԆۆІކWˆ;`U^a4a'a aa7a!b"bd>dd*d-d=d,dddd d6ddddleeeffffffffgimiZiwi`iTiui0iiJihiki^iSiyii]ici[iGkrkkkkknnnnnnnnnnnnnnnnnnnnnnNqYqiqdqIqgq\qlqfqLqeq^qFqhqVq:rRr7sEs?s>sotZtUt_t^tAt?tYt[t\tvuxuvuvuuuuuuvv[wkwfw^wcwywjwlw\wewhwbwwxxxxxx|xxxxzyyy,yzz zzzzzzw{{`{n{g{|||}y}}}}[}nijrVXqpxenskyzfGw=1ufkIl[<5acimF^\_ Y߈Ԉو܈؈݈ʈՈ҈krsfip|cqmbnly{>hbʌnjȌČ̌Ōߍ捲 KJSBTAljiɑ7W8=@>[KdQ4IME9?Z͖˖ɖʖVtv  霂 PPPPPPPPPPPPbQQRR1SSUVVVUVV V VVUVVVVUWWuX~XXXXyXX}XX%Y"Y$YjYiYZZZZZZZu[[[[[[[[[[ \b\]][^c^U^W^T^^^ _F_p__Ga?aKawabaca_aZaXaua*bdXdTddxd_dzdQdgd4dmd{dreeeefffiiiiiiiiiiiiiiiiiiiIkLk3l3oonon)o>o o,ooo"onno1o8o2o#oo+o/oo*ononnnqq}qqqq>rrrDsPsdtctjtptmtuu'v v v vvvvw}wwawxxxxxxyyy.z1zzzzz{{{u{{{{{{{{|||}}}}}}}}}}}}}}}}}}}p^ZPKɄƄĄ˄ӄфʄ?;"%4U7)jӌьҌk`X\cY^b][uxwtx{|̖Җ| AB󜼞;JQQPPPQQ QQQRRRRRRS.V;V9V2V?V4V)VSVNVWVtV6V/V0VXXXXXXXXmY [Z [Z [[[[[[d\e\]]b^_^a^^^^^^^H_q___vagana]aUaa|apaka~aaaaaaaaaa.bidodyddddddddddddddddddduewexeffff#jjijjji!jj jijjijPkNkkkk?o|ooQofoToomo[oxonoozopodooXonoo`o_oqqqqVrrNsWsittt~ttu v)vv$v&v!v"vvvvwwwwwxxxxxxxx?z~F~7~2~C~+~=~1~E~A~4~9~H~5~?~/~DqrposƁÁɁ q~gч҇Ƈȇˇ;6D8= A?sIKHJD>BE?}9M(uJeK~l[pZTʕ˕̕ȕƕ֖ӗF5;?Ϟޞܞݞ۞>KSVVXX8[]_a3bdddedddef&gjjjjjjjj_kxkk p popoppqqqqwsusttuVvXvRvwwwwyyazbz`zzz+|'|*||#|!||T~U~^~Z~a~R~Y~Hwv́ρ υͅЅɅ(9,+PYcfd_UIMБԕ֕ЕՕܖٖۖޖ$MOLNS>?=.ONMʛɛțQ]`,3QVXXX[^aaaaeeffjjjjpp(pppppr rXrrxszstttuu_vavwyykziz>|?|8|=|7|@|k~m~y~i~j~s~؁݅Յ `_V^A\XIZNOFY |rvlztTNѓߓÓȓܓݓ͓֓ؓדܕ*'aܗ^X[EI ֛ۛarjlRVVVVVX@[C[}[[]aaeeef'gj>p0p2pr{stbvev&y*y,y+yzzL|C|M|||}~|~~Lځf  dplfo_k ˑ0ĘRQ+075 y/_ca7Q8QVVVYl\]aaeeefjkjkLprrttivwP|~~-#"!jltw}_.35:82+892geWEC@>ϚTQ-%\fg×kUUMҚI1>;ӝם4ljV]b#e+e*efktzd|c|e|~~~8?1c`dho\Z[WӚԚњTWV坟VX,e^pqvrvwP69bwjBHDƗp_"X_|}wr^kcpl|n|;rpq^֚#̞dpwwɗbe~ő}~|wxT(rj1r|0000A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000#$%&'()*+,-./012345Q6789:;<=>?@ABCDEFGHIJKLMNO`$a$b$c$d$e$f$g$h$i$t$u$v$w$x$y$z${$|$}$BN\NQSSN NGNNV n\s_NQN.NNNNNQRlSS WY,Y\]ekkl?r1Ng9g8g;g:g?gOgORO_OAOXO-O3O?OaOQQRR!RRR ScSrSSS0T7T*TTTETTT%TT=TOTAT(T$TGTVVVAWEWLWIWKWRWY@YYYYYYYYYYY[[(\*\\\\\\\\\\\] ^^^^^^^__x_v_______________`_:bbbbbbbqb{bzbpbbbwb}brbtb7eeeeeeEgGgYgUgLgHg]gMgZgKgkllxlglkllllqlolillmllllflslel{lltpzpcrrrrrrrrsssss:u9uuuv=y4xɏ0(/-3NO|OO}OOOvOtOOOwOLOOjOOyOOxOOOOOOOOkOnOQQQ5R2R3RFR1RR S SuuuvvvvvwwwwwwBy?yyxz{zzu||5 ‚ÂpomnVҏˏӏ͏֏Տ׏9=<:COOOOOOOOOOOOOOOOOOODRIRRR=S|SSSSSTTTTTT TTTTTTTpTTTTrTTTWWWWWWWWWWWWWWWX YSYYYYZYYYYYYYYYYYYYYYYY[L\\\\\\\\\\\\\\\\\\\\\]!^"^#^ ^$^^^^^^^_._V__7`9`T`r`^`E`S`G`I`[`L`@`B`_`$`D`X`f`n`BbCbb c cbccbbc cbbcccbcbbAeCeee6f!f2f5ff&f"f3f+f:ff4f9f.fgggggggggggggggggggggggggggggggggggggggggg(kkkkkkk l!l(m4m-mm9/%3-DQ%V?A&"BN*ZMZ9ZLZpZiZGZQZVZBZ\Zr[n[[[Y\] ]]] ] ](] ]&]%]]0]]#]].]>^4^^^^^^6_8____`````````````````````2ceccc}ccccccccocccnccuccmcc|cc;ccxcccccpcSeeefaf[fYf\fbfgyhhhhmhnhhhViohhhhuhthhhwhh|hkhrhhhqh~hhhhhhhxh{hhhh}h6k3k7k8kkkkkk*lmmmmtnmmmmmmnmmmmmmmmmmmmmmmmmmmmmmmmmmmp qpqp qpqpqppqqqpp qqq~r{r|rrsssss ssrssssssttsttsss t tstducuuuuuuuuvvv9w/w-w1w2w4w3w=w%w;w5wHxRxIxMxJxLx&xExPxdygyiyjycykyayyyyyyzzz5{G{4{%{0{"{${3{{*{{1{+{-{/{2{8{{#{||||5}=}8}6}:}E},})}A}G}>}?}J};}(}cGCH%-,!'"83:42tzstu}~vYV†ņȆ̆ÆR։ىՉ0',9;\]}}{y؎ގݎ܎׎$  !ԐVXZSUz|mkqoj嘗PPPPPPPPPPhPPPPP_QQSSSSUUUUwUEVUUUUUUUUU}UUUUUUU W)X7XXX'X#X(XWHX%XXX3X?X6X.X9X8X-X,X;XaYZZZzZZZxZZ|ZZZZZ7ZZZZZZZ{Z}ZZZZZZ[[[[[[[ \0\7]C]k]A]K]?]5]Q]N]U]3]:]R]=]1]Y]B]9]I]8]<]2]6]@]E]D^A^X____``````a` aaa`a````aaaa`a aJbccccccccdcccccccadccccccccccccccc2egejede\eheeeeeeeee|flf{ffqfyfjfrfg ihih*ihhhihhhhhiihhihipihihhihhhhh i iihhhhhhhihhi%ih9k;k?k?efQOPԀCJROG=M:<=?u;σ#ƃȃヿ݃؃˃΃փɃ ރƒՃǃуÃă׃ۃ؆ӆچ݆܆׆цHVU׈Ɉ݉ډۉNM9Y@WXDERHQJLO_؍Ӎ͍Ǎ֍܍ύՍٍȍ׍ō-4/,ad_b` %& '${~–ȖÖlpnNNNPPPPPPPPPPPPPPPPPQzRxR{R|RUUUUUUUUUUUUUUUUUUUUUUUWSXhXdXOXMXIXoXUXNX]XYXeX[X=XcXqXXZZZZZZZZZZZZZZZZZZZZ[[[\3\q]c]J]e]r]l]^]h]g]b]]O^N^J^M^K^^^^^^@___`IaJa+aEa6a2a.aFa/aOa)a@a bh#b%b$bcccdd d d$d3dCdddd9d7d"d#d d&d0d(dAd5d/d dd@d%d'd dcd.d!ddoeeeffffffffxf gfi_i8iNibiqi?iEiji9iBiWiYiziHiIi5ili3i=ieihxi4iii@ioiDiviXiAitiLi;iKi7i\iOiQi2iRi/i{iF 2*-<:15B&'8$0눝艫=hiՌό׌   # "$!zrysvzy}~-X}z~{Η͗ٙǙ>?`a_PQ0QPQQPP Q QP QRRRRHVBVLV5VAVJVIVFVXVZV@V3V=V,V>V8V*V:VWXXXXXXXXXXZZZZZ[Z[Z[[[[g\]]]]]]]]]]]]i^]^`^\^}^^^I__aayaaaaaaaaaaaaaafaa-bndpddddddddddddhdddvezeye{eeefffffffjjjiijii jiiijji'jiijii@jjii jii jjj%jji&jjijQkkkkkllklAo&o~oooooooboOooZoovolooUoroRoPoWooo]ooaoko}ogooSooiooocowojo{oqqqqqqqqqqqqqqqqqrrXsRs^s_s`s]s[sasZsYsbsttttt}ttt|tytuu~u%vvvvv#vv(vvvvvvwwwwxxxxxxxxxxxyyyyyyvk9zzzz{{{{{{{{{||||}}}}}}~}}}}}}}vdgOSRPNQ$;)  '+ *(.1& 0 /bVcdwsXT[RaZQ^mjPN_]olzn\eO{ubgiZ   ϊƊӊъԊՊ׊Ŋ؊Êي>Mߌٌڌ݌猠 #%$.&',$ #spogk/+)*2&.ВÒĒْϒߒؒגݒ̒’ʒȒΒ͒ՒɒޒђӒƒ|ӖZЗϗ&)( 'ܙ͙ϙәԙΙəؙ֙˙י̙FCgtqfvuphdlӞQQQQQQ4SSpV`VnVsVfVcVmVrV^VwVWWXXXXXXXX[[[![[[[[([[ [[[]]]]]]]]]]]]]g^h^f^o^^^^^^K__aaaaaaaaaaaaddddddddddd3ee|eeffffffffff#g4jfjIjgj2jhj>j]jmjvj[jQj(jZj;j?jAjjjdjPjOjTjojij`j[qNnuUg`f]Telcedy&0-.'1")#/,݊ߊȊފln3>8@E6<=A0?6.52974vy{356'z8<#F- ˒%4$)95* ͕Ԗ 5/2$')癹3|~{z}% )"՞֞=&Q%Q"Q$Q Q)QRVVVVVV~VVVVXXXX-[%[2[#[,['[&[/[.[{[[[]l^j^__aaaaaaaaaddddddeeeefjjjjjjjjjjjjjjjjjjjjjjj[kk looooooooooooooqqqqqqqssnsostttttttttuuuuuCvHvIvGvvvwwwwwwwwwxxyxxxyxxyyy\z[zVzXzTzZzzzz||{|{{|{ |{| |||{{|{{| ||-~<~B~3~H8~*~I~@~G~)~L~0~;~6~D~:~E~},ā́ʁŁǁ[Z\{w|zxWyvhŇɇLJ̇ćʇއ53<>AR7B " OprqooNMSPLGC@~8dVG|X\vIPQ`mLjyWUROqw{a^cgNYǕɕÕŕ ՗ԗADJIEC%+,*32/-10H3Ag6./180EBC>7@=-Ȟڞ$#"T1Q-Q.QVVVVVVpY<[i\j\]m^n^aaaaaaaaaadeddeedeefffjjjjjjjjjjj^kk lp p pppppopo&poo prqqrqvsttttttttuu\vdvYvPvSvWvZvvvvwwx yyy yyyyyy_z|)|| ||-||&|(|"|%|0|\~P~V~c~X~b~_~Q~`~W~S~uсҁЁ_^ƅŅDžą˅΅ȅŅ҅$iۇ߇ԇ܇Ӈ؇㇤ׇه݇SKOLFPQI*'#305G/<>1%7&6.$;=:Bu\b`WV^eg[Za]iTFGHK(:;>ҕӕѕזږ]ߖؖݖ#"%חٗ֗ؗPQRA<:  ܚ)5JLKǛƛÛӛě\SOJ[KYVLWRT_XZߞ%+*)(LU4Q5QRRSVVVVVVXXXY=[>[?[]p^_aee e e eeeeefjjjjjjjjjjjjj`kk lp'p pp+p!p"p#p)pp$pp*p r rrrrrrrrrttttu`vwwwwyy!yyyyygzhz3|<|9|,|;|||v~u~x~p~w~o~z~r~t~h~KJxׁՁdacمڅׅ؅߅܅хޅ  bZ[Wa\X]YPHJ@SVTKUQBRWCwv mxsjo{ŽRQOPS@?ޓǓϓ“ړГ̓ٓʓԓՓēΓғ}ڕە)+,(&ݗޗߗ\Y]WHGC%$" '#š  7ޛԛכܛٛ՛ڛwqx}ktupis{oyh-@AMVWX7SVVVXE[]]^^__aeeeeefffjjjjjjjj02.3vtsEdcbU]W^ėŗVY RXPJMKUYLNžО876COqpnoVVN[m\-effk_pap]p`p#rttw8yyyj|~mC875K‘khiFCGǗ^՚Ycgfb^` FtuvV.eekkkkbp&rrww9yi|k||~~~~FGHyz|{nmoqsIr_hnm  Gx{zyWfpo|<Ñtxvu`tsqu hpep|j>=?ɎKst̘adfg$Hbk'rLih.)rKyuvkzipjp~Idecompress(string[, wbits[, bufsize]]) -- Return decompressed string. Optional arg wbits is the window buffer size. Optional arg bufsize is the initial output buffer size.UUUUUU?H)/"qgrqqESqq7tw vxb4bWeBJbecb fsph:pqrHpri:pqrIprl:pqrLprqpesQqs?mpf9rHtdUrtC implementation and optimization of the Python pickle module.pread(fd, count, offset) -> string Read from a file descriptor.dict.fromkeys(S[,v]) -> New dict with keys from S and values equal to v. v defaults to None.ǟ)̟)џ)inet_ntop(af, packed_ip) -> string formatted IP address Convert a packed IP address of the given family to string format.D.pop(k[,d]) -> v, remove specified key and return the corresponding value. If key is not found, d is returned if given, otherwise KeyError is raisedget_threshold() -> (threshold0, threshold1, threshold2) Return the current collection thresholds 5"1 ! fileno() -> integer Return the integer file descriptor of the socket.NMTOKENgetrefcount(object) -> integer Return the reference count of object. The count returned is generally one higher than you might expect, because it includes the (temporary) reference as an argument to getrefcount().6 E̗6>64$eL՟$@E|x-?,@S/Ԏ3> h!Elk#\ʠ_multibytecodec__create_codecencoding name must be a string.no such codec is supported.multibytecodec.__map_*getcodecmultibytecodec.__map_*multibytecodec.__map_*map data must be a Capsule.multibytecodec.__map_*_codecs_tw__map_big5big5hkscsbig5hkscs_bmpbig5hkscs_nonbmpbig5hkscs_codecs_hkp-p-socketpair([family[, type[, proto]]]) -> (socket object, socket object) Create a pair of socket objects from the sockets returned by the platform socketpair() function. The arguments are the same as for socket() except the default family is AF_UNIX if defined on the platform; otherwise, the default is AF_INET.L.count(value) -> integer -- return number of occurrences of valued55·5Q5R5Q5;L5z555`d505B55)5 555555555555555555555555555555555555555555555555555555556666 6 6 6666666666!6#6%6'6)6+6-6/616365666,d86 )860k96$bind %dbind *localcopy() -- Return a copy of the decompression object.This module defines an object type which can efficiently represent an array of basic values: characters, integers, floating point numbers. Arrays are sequence types and behave very much like lists, except that the type of objects stored in them is constrained. The type is specified at object creation time by using a type code, which is a single character. The following type codes are defined: Type code C Type Minimum size in bytes 'c' character 1 'b' signed integer 1 'B' unsigned integer 1 'u' Unicode character 2 'h' signed integer 2 'H' unsigned integer 2 'i' signed integer 2 'I' unsigned integer 2 'l' signed integer 4 'L' unsigned integer 4 'f' floating point 4 'd' floating point 8 The constructor is: array(typecode [, initializer]) -- create a new array [IDŽQattrgetter(attr, ...) --> attrgetter object Return a callable object that fetches the given attribute(s) from its operand. After f = attrgetter('name'), the call f(r) returns r.name. After g = attrgetter('name', 'date'), the call g(r) returns (r.name, r.date). After h = attrgetter('name.first', 'name.last'), the call h(r) returns (r.name.first, r.name.last).g!{cAc;dread([s]) -- Read s characters, or the rest of the string;f8z!/8/Jz z:argument %d to map() must support iteration4Wrƅoٵy~"K"""""k"[q""""A""" "T,"l"v"""" "L"T""L"": "o%&a)O-[7+dup(old, new) -> new Duplicate file descriptor; system chooses if new==-1.Data container common to multiple tee objects.4find(s, sub [,start [,end]]) -> in Return the lowest index in s where substring sub is found, such that sub is contained within s[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.xrange()l;xrange() requires 1-3 int argumentsll|l;xrange() requires 1-3 int argumentsxrange() arg 3 must not be zeroxrange() result has too many itemsxrange object index out of rangexrange(%ld)xrange(%ld, %ld)xrange(%ld, %ld, %ld)(O(lll))__reversed____reduce__xrange__length_hint__rangeiterator../Objects/rangeobject.c../Objects/rangeobject.cUUUUUU?abort() -> does not return! Abort the interpreter immediately. This 'dumps core' or otherwise fails in the hardest way possible on the hosting operating system.?v--8'P.P.48')))B.index(sub [,start [,end]]) -> int Like B.find() but raise ValueError when the subsection is not found.long(x=0) -> long long(x, base=10) -> long Convert a number or string to a long integer, or return 0L if no arguments are given. If x is floating point, the conversion truncates towards zero. If x is not a number or if base is given, then x must be a string or Unicode object representing an integer literal in the given base. The literal can be preceded by '+' or '-' and be surrounded by whitespace. The base defaults to 10. Valid bases are 0 and 2-36. Base 0 means to interpret the base from the string as an integer literal. >>> int('0b100', base=0) 4LRead until newline or EOF. Returns an empty string if EOF is hit immediately. /dev/ptyclonectime(seconds) -> string Convert a time in seconds since the Epoch to a string in local time. This is equivalent to asctime(localtime(seconds)). When the time tuple is not present, current time as returned by localtime() is used.("lQ/Parse(data[, isfinal]) Parse XML data. `isfinal' should be true at end of input.1wj64#8;v ͽ|`APrivate method returning an estimate of len(list(it)).D"H"L"P"T"X"\"H->6O-g+V-BE.WEXITSTATUS(status) -> integer Return the process return code from 'status'.$3q$>@S.startswith(prefix[, start[, end]]) -> bool Return True if S starts with the specified prefix, False otherwise. With optional start, test S beginning at that position. With optional end, stop comparing S at that position. prefix can also be a tuple of strings to try.000% & 0 %"<<"    000 0 0 0 0 00000`"d"e""4"2 3 !+!B&@& ""#""a"R"; &&%%%%%%%%%%%!!!!!0j"k""=""5"+","" """""*")"'"("!!""^.""" !0 %%%%d&`&a&e&g&c&"%%%%%%%%%%%h&&&&& ! !!!!!m&i&j&l&22!3"!33!!   !"#$%&'()*+,-./0123456789:;=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]112131415161718191:1;1<1=1>1?1@1A1B1C1D1E1F1G1H1I1J1K1L1M1N1O1P1Q1R1S1T1U1V1W1X1Y1Z1[1\1]1^1_1`1a1b1c1d1e1f1g1h1i1j1k1l1m1n1o1p1q1r1s1t1u1v1w1x1y1z1{1|1}1~11111111111111111p!q!r!s!t!u!v!w!x!y!`!a!b!c!d!e!f!g!h!i!%% %%%%%,%$%4%<%%%%%%%#%3%+%;%K% %/%(%7%?%%0%%%8%B%%%%%%%% %%%!%"%&%'%)%*%-%.%1%2%5%6%9%:%=%>%@%A%C%D%E%F%G%H%I%J%333!3333333333333333333333333333333333333333333333333333&!3333333333333333333333&2?ARfJ`2a2b2c2d2e2f2g2h2i2j2k2l2m2n2o2p2q2r2s2t2u2v2w2x2y2z2{2$$$$$$$$$$$$$$$$$$$$$$$$$$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$S!T![!\!]!^!'138@BSgKI222222222 2 2 2 2 222222222222222$$$$$$$$$$$$$$$$$$$$$$$$$$t$u$v$w$x$y$z${$|$}$~$$$$$t  A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 !"#$%&'()*+,-./012345Q6789:;<=>?@ABCDEFGHIJKLMNO  $,-/0189<@KMTX\pqtwxzĬȬ̬լ׬  ),-458DEGIMOPTXaclĻȻлӻ $%')-0148@ACDEILMP]ļͼϼмѼռؼܼ $,@HILPXYdhԽսؽܽ DEHLNTUWYZ[`adhjpqstu{|}оѾԾ׾ؾ @ADHPQUſ̿ͿпԿܿ߿DEHLTUWXY`dfhpų̴̵̸̘̙̜̠̩̫̬̭̼ $(,9\`dlmoqx͈͔͕ͤͥͧͩ͘͜Ͱ  !$(0135XY\_`ahikmtux|΄΅·ΉΐΑΔΘΠΡΣΤΥάέ $,-/018TUX\degipqtxπυόϡϨϰ-458aha9eiouvv{˄U[QW|(PSE\]bncdd np[yݍ}E~NNeP]^aWiqTGu+^NPpg@h QRRjwԞR/`HPacdkLp/tt{PŃܕ(.R]`bOIQ!SX^f8mprsP{[fSckVNPJXX*`'abiA[}_NPTU []]*eNe!hKjrvw^}N߆NʐUNEN]NNOwQR@SSSTVuWW[]^abQeggiPkkkBlnxprstwwvz}  ߂b3dҙEם W@\ʃTzو͎XH\cz[_yzz&P8RRwSWbrc km7wSWshvՕ:gjpom̎Kwfxk<S-WNYcisExzz|us5RGWGu`{̃XjKQKRRbhuiPRRae9hi~tK{냲9яI NYdfj4tyy~_ & OS%`qbrl}f}NbQwOOvQQUhV;WWWYGYY[\]]~^_beegg^ghh_j:k#l}llms&t*tttxuuxxAyGyHyzy{}}-OHw!$Qe}vO TbThёU:Q Za bbfVq OczcWS!g`isn"7u#$% }&'rVZ()*+,CN-gQHYg.sYt^dy_l`b{c[[R/tY)_`012Yt345678љ9:;<=>?@ABCoDE`FGfHI?\JKLMNOPQZ%{g}RSTUVWXY<\l?SnY69NNFOUWXV_eejkMnwz|}ˆ2[dozsuTVUMWadfm[nmoouCANJZlSuT{]UXXXb^bdhvu|NWnW'Y \\6^_4bds۞[_`PR0RW5XWX\`\\]^_`ccdChhjm!nnoqvywy;zHSMvܗkpXrrhscwy{~X`feeflqqZmNzNQQR TaqgPhhm|ouwzc\Qe\gguzsZF-o\Ao _]Yjq{vI{'0Ua[iv?\mpsa}=]j^NuSkk>pr-LRP]d,ekoC|~ͅdb؁^gjmrtotސO ]_ QceuNPiQQhj|||oҊϑO7QRBT^na>bejo*y܅#bjΞRfwkp+ybBab#e#oIqt}o&#JQRR mpˆ^eko>|usN6OV_\]`s-{F4HaOoyR`ddj^oprv\2ouxy}Ƀ֊X_'g'pt`|~!Q(pbrxŒڌNP[^eqBvwJ|'XAZb\jmo;v/}7~8KRegiAmnp t`tYu$vkx,^mQ.bxO+P]m}*_DahaRQQ^iz}uO)RSTUe\`Nghlmrrttbul|yψ̑БɛT~oqtWgm3t,xz {|idjtuxxT[U^ oNMS)Z]N_ba=ciffn+ocpw,;E;Ub+gl jzNY__g}T+WYZ['fghkdqu㌁EL@_[lsvv QMQQRhlw w}}bnQ T}Tff'invw„iOQRY=^Uaxdydfg!jkk_rarAt8ww((glgrvfwFzkl"Y&goSXY^c4fsg:n+szׂ(R]aa bbdeYifkk!qs]uF~j'aX؞PR;TOUevl } }^RlirsTZ>\K]L__*ghcieee fginx!}+*2 POcW_bcogCnqv̀ڀ)Mj/OpO^g"h}v~vDa^ jiqqjudA~CܘOO{pQ^h>lNllr{l:tPRXdjtVvx9e^S_%RwINPuQ[\w^f:fghpuuyz' O!X1X[nfekmzn}os+u܈\OPS\S[_ gyy/9;,gvNOIY\\\gchpq+t+~"Ғ NNOPVRoR&TTW+YfZZ[u[[^fvbweenmn6r&{?|6PQ@tܑDٙSR)TtVXTYnY_anbf~lqv||}g[O__b)] gh|xC~lNPS*SQSYbZ^`aIbybegikkkklh5tuxxyy|}>船l^ۘ;V*[l_ejk\mop]rsӌ;a7lXMNNNN:Oy@y`yy{}r} фdž߈P^܌fߙJRigjP*Rq\ceUls#uu{x0wNdk^q NkIghnkco NPPQFUUV@[\\8^^^^`QhajXn=r@rrvey{saތ^XtUlaz"}rrru%um{XX]^^_U`bcMefffhhr^tn{n}}r͞ YmY-^`fsfgPlm_owxƄˑ+NPHQU [[Gb~ee2n}qtDtttlvy}U~z9ux%MhSQ\Til)m+n ;-gaRfk~ ]emqnWY['``bf_f)ssvwl{VreNRrkmz9{0}oS/VQX[\\]@bcd-fhlmnppq&uuuv{{+| }9},m4 a7Ol\_gm|~k[] d\ᘇs[`~gm 7RpQpxpבOSUVWXZ[\\%^a bKbcd6exe9jk4lm1oqrxstt&vawyWzz|}}a~)1ڄꅖ8Bl֖ӚS~XYp[[mZoq!tt]__B`ehoiSjk5mmsvwM{}#@cbĊ bSe]']i]_thob6rNXNPRGSbfi~^OS6VYZ8\N\M\^_C`e/fBfggsw:ÿ́fiUzW[_o`b ik\nq{UXߘ8OOO{T Z[T3TUbXXgYZ[`aVeedfhZlopqRs}{2K\lDss:netviz~ @QXdtupv͖T&ntzzنxIZ[[hicmst,tx}UL.f_egjls-PZjkwYl]]%sOuPQ/X-YYY[]bdddfHjqdtzzG~^~p YR~a2ktm~%OPQRWX[^Baimgnnqbt(u,us8Ʉ ޓNQOvP*QSSS[[$\aae[rs@tvPyyy}Յ^GꑅRg_e1f/h\q6z NRjkoqSK1NqĖCQSTWWWZZ[(`?acl9mrnn0r?sWtтE`bXg^MOIPPqS WYZ \paf-n2rKt}Àf?_[U˗OsNOQjQ/UUz[[|^}^^``a ac8e gggaibil'm8no6s7s\t1uRv}8Ոۊ0BJ>zIɑn XkAQkY9\dosbph}Wi`GakYNTm-pclQaOPQ[aadikuwdcpNN O7YY]_[_!`>rspuuy 3Q 7pvNNRpSTVY[__nnj}5mwNZO~OXen8NXYYA`zOÌeQDSNiRU[N:RTYYP[W[\[c`Hanpnqstux+}(Ʌnj̖\ORVe(f|pp5r}Lrq[hkzov\f[o{*|6ܖNN S4XXXlY\3^^5_cfVgjj k?oFrPstz|x߁灊l#υ݈wQT(W[MbPg=hh=nn}p!~ KN-r{͊GONO2QTY^bugnijlnr*su{5}W[Ζ_R TZ[XduenrvMz{M|>~{+ʌd_iѓCOzOPhQxQMRjRaX|X`Y\U\^`0bhkloNq t0u8uQurvL{{{{~n>I?"+ZkR*bbYmdvz{v}`S\^8op|ޞczdvNNN\PuPHTY[@^^^_`:c?eteevfxfghijck@lmmn^nppss:u[wxy z}z|}Gꊞ-Jؑf̒ V\6RR|U$X^_`chomy,{́Dd=LJOFQQR2V_k_cdeAfffghhionogqq*rt:wVyZyy zz||D}p~T m;Ֆe|ÓX[ \RSbs'P[_`kahm.t.zB}}1~k*5~POPW]^+cj;NOOOZPYĀjThTUOY[]^]f1gg*hl2mJnopsuL|},}}ۆ;p31NRDЙz|OQQW[\Yf=jZmno qouz"!u˖-NNF͑}SjkiAlzXafbpuuR~IKNST0W@W_ccod/eezfggbk`ll,ow%xIyWy}󁝂rvz7zT~wUUuX/c"dIfKfmhik%mnshtt[uuvwwy ~~/:ь뎰2csOSYZ^Nhtuyz̍폟egWWo}/Ɩ_aoNOPSUo]]!kdkx{IʎnIc>d@wz/jdoqttz|~|~ }L9R[d-g.}PSyXXaYaaez P!PuR1UUXY`Sbb6gUi5@ݙ,PSSDU|WXbdkfgoo"t8t8QTVfWH_aNkXpp}jY+cw=TX-di[^oniLQS*Y `Kakpll{΀ԂƍdodeNQTW_avhuR{q}Xi*9xPWYYb*]ayr֕aWFZ]bddwgl>m,r6t4xwۍ$RBWgHrt*kQSLciOU`WelmLrrzm_opaOOPAbGr{}MjWs^g U T[c^^ _e=[HOS SSTTW^`bbUclfmu2xހ/ނa E^ffprO}Rj_SaSgjothyhyǘĘCTzSiJ|_buvB9S<__lsbuuF{ON< NUOSY^0flUtwfPXx[P[h``eWl"oopUPӗrRDQ+TTcUUjm}fwyTTv䆤ԕ\N OYZ]R`bmgAhl/n8* NUPTWZYi[[awiwm#pr犂홸R8hPx^OgGLNTVs WSVX[1aj{sҎGkWUYrkiO\&_a[flpsss)wMwC}b}#~7R IoQ[tz@ZOTS>Y\>cymrϒ0NDQRWb_lnpPppqsitJanQW_`gafYJNNN|TXX}Y\'_6bHb fgfkimmVnnooo]pr%tZttv\y|~ဦkN_twje`bwZZfm>n?tB_`{T_^ll*mp}y ;ST[:jkpuuyyqAt d+exxkz8NUPY[{^`cakefShneqt}i%;mn>sAʕQL^_M``0aLaCfDfil_nnboLqtv{'|RWQÞ/SV^_b``affgjmoppjsj~4ԆČRrs[kjTV][Heefhmm;ruMOPST bool Return whether the object has an attribute with the given name. (This is done by calling getattr(object, name) and catching exceptions.)fromstring(string) Appends items from the string, interpreting it as an array of machine values,as if it had been read from a file using the fromfile() method).count(s, sub[, start[, end]]) -> int Return the number of occurrences of substring sub in string s[start:end]. Optional arguments start and end are interpreted as in slice notation.$A$B$7B$^B$B$B$B$B$!Cǟ$Cnew_module(name) -> module Create a new module. Do not enter it in sys.modules. The module name must include the full package name, if any.80FE$$,] M18%(pI/O operation on closed fileclosedTrue if the file is closedgetvallength too large|n:read|i:readline|n:readlines|n:truncaten|i:seeklength too largenew position too largeout of memorys*:writeflushgetvalueisattyreadreadlinereadlinesresetseektelltruncateclosewritewritelinessoftspaceflag indicating that a space needs to be printed; used by printcStringIO.StringOout of memoryflushgetvalueisattyreadreadlinereadlinesresetseektelltruncateclosecStringIO.StringI(O)s*:StringIOStringIOStringIOcStringIOcStringIO.cStringIO_CAPIcStringIO_CAPIInputTypeOutputTypecan't read %s: %rCERTIFICATEcan't parse %scan't read %s: %rCERTIFICATEfloat.__format__(format_spec) -> string Formats the float according to format_spec.)) !1Aa  0@`R9S9S9S9S9&S9-S96S9KS9RS9cS9jS9|S9S9S9S9S9S9S9T9T93T9 string Return S right-justified in a string of length width. Padding is done using the specified fill character (default is a space)gethostname() -> string Return the current host name.6,E6r$Lseekseekiitruncate__IOBase_closedI/O operation on closed file.__IOBase_closedI/O operation on closed file.__IOBase_closed__IOBase_closedFile or stream is not seekable.File or stream is not readable.File or stream is not writable.fileno|O&:readlinepeekpeekipeek() should have returned a bytes object, not '%.200s'readnread() should have returned a bytes object, not '%.200s'|O&:readlinesextendOO:writelinesseektelltruncateflushcloseseekablereadablewritable_checkClosed_checkSeekable_checkReadable_checkWritablefilenoisatty__enter____exit__readlinereadlineswritelinesclosed_io._IOBase|n:readreadallreadiread() should return bytesreadreadall_io._RawIOBase1.2.3mkfifo(filename [, mode=0666]) Create a FIFO (a POSIX named pipe).int.bit_length() -> int Number of bits necessary to represent self in binary. >>> bin(37) '0b100101' >>> (37).bit_length() 6|)b,ghex(number) -> string Return the hexadecimal representation of an integer or long integer.localS.swapcase() -> string Return a copy of the string S with uppercase characters converted to lowercase and vice versa.x1{|x1}~x1S.index(sub [,start [,end]]) -> int Like S.find() but raise ValueError when the substring is not found.match(string[, pos[, endpos]]) --> match object or None. Matches zero or more characters at the beginning of the stringx.__getitem__(y) <==> x[y]D.copy() -> a shallow copy of D.pause() Wait until a signal arrives.|W/A)W/'W//W/^|.W/C$4W/ܪ)W/ $;W/x/W/?H'W/l,-W/c|3?/!E#ۀH)9!<!] \ ܄)Base class for buffered IO objects. The main difference with RawIOBase is that the read() method supports omitting the size argument, and does not have a default implementation that defers to readinto(). In addition, read(), readinto() and write() may raise BlockingIOError if the underlying raw stream is in non-blocking mode and not ready; unlike their raw counterparts, they will never return None. A typical implementation should not inherit from a RawIOBase implementation, but wrap one. GC object already tracked../Objects/cellobject.c../Objects/cellobject.ccell comparisons not supported in 3.xCell is emptycell_contentscellreadline([size]) -> string Return the next line from the file, as a string, retaining newline. A non-negative size argument will limit the maximum number of bytes to return (an incomplete line may be returned then). Return an empty string at EOF. read(size: int) -> bytes. read at most size bytes, returned as bytes. Only makes one system call, so less data may be returned than requested In non-blocking mode, returns None if no data is available. On end-of-file, returns ''.InfinityNaN0load(file) Read one value from the open file and return it. If no valid value is read (e.g. because the data has a different Python version’s incompatible marshal format), raise EOFError, ValueError or TypeError. The file must be an open file object opened in binary mode ('rb' or 'r+b'). Note: If an object containing an unsupported type was marshalled with dump(), load() will substitute None for the unmarshallable type....Read until EOF, using multiple read() call.))isatty() -> true or false. True if the file is connected to a tty device.$i"$)$2$;$D$K$ R$ X$4]$5b$ k$p$v$&$$$6$B.isalpha() -> bool Return True if all characters in B are alphabetic and there is at least one character in B, False otherwise.  S.join(iterable) -> unicode Return a string which is the concatenation of the strings in the iterable. The separator between elements is S.S.__sizeof__() -> size of S in memory, in bytessendall(data[, flags]) Send a data string to the socket. For the optional flags argument, see the Unix manual. This calls send() repeatedly until all data is sent. If an error occurs, it's impossible to tell how much data has been sent.3!~31|@3!~3!s3!vN3!X3!q`3!i3$o3!~F3!~3!~3!~z3!~63!~3!~3!~j3!~&3!~3!~3!~Z3!~3!~Ҷ3!~3!~J3!~3!~¹3!~~3!~:3!~3!~3!~n3!~*3!~3!~3!~^3!~3!~3!~3!~N3!~ 3!~3!~3!~>3!~3!~3!~r3!~.3!y3!~3!~X3!~3!~3!~3!~H3!~3!~3!~|3!~83!~3!~3!~l3!~(3!~3!~3!~\3!~3!~3!~3!~L3!~3!~3!~3!~<3!~3!~3!~p3!~,3!~3!~3!~flush() -> string Finish the compression process and return what is left in internal buffers. You must not use the compressor object after calling this method. isatty(): always returns 0buffer(object [, offset[, size]]) Create a new buffer object which references the given object. The buffer will reference a slice of the target object from the start of the object (or at the specified offset). The slice will extend to the end of the target object (or with the specified size).open(filename, omode) -> fd Open a file (for low level IO).М$l8#Ed-xh"-$-B+d,$ Q!ƨE4o:__call__weak object has gone away__name____new__cannot create weak reference to '%s' object__init__weakrefweakly-referenced object no longer exists__unicode____unicode__weakproxyweakcallableproxycannot create weak reference to '%s' objectcannot create weak reference to '%s' object../Objects/weakrefobject.c../Objects/weakrefobject.cdefaultdict(default_factory) --> dict with default factory The default factory is called without arguments to produce a new value when a key is not present, in __getitem__ only. A defaultdict compares equal to a dict with the same items. Error 0Too bigAccess deniedTry againBad file numberIn useNo childrenDeadlockFile existsBad addressFile too largeInterrupted system callInvalid argumentI/O errorIs a directoryToo many open filesToo many linksName too longFile table overflowNo such deviceNo such file or directoryExec format errorNot enough locksNot enough memoryNo space left on deviceNo such system callNot a directoryDirectory not emptyInappropriate ioctlNo such device or addressPermission deniedBroken pipeRead-only file systemIllegal seekNo such processCross-device linkNot a socketProtocol not supportedConnection refusedAddress family not supportedNo buffersOP not supportedAddress in useDestination address requiredMessage sizeProtocol option not supportedSocket option not supportedProtocol family not supportedAddress not availableNetwork downNetwork unreachableNetwork resetConnection abortedConnectedNot connectedShut downToo many referencesTimed outHost downHost unreachableUnknown errorOperation canceledOperation in progressDomain errorRange errorUnknown errorB.istitle() -> bool Return True if B is a titlecased string and there is at least one character in B, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.sAacosh(x) Return the hyperbolic arc cosine (measured in radians) of x.S.rfind(sub [,start [,end]]) -> int Return the highest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.6,E6r?9L  0@`  0@` ((((( H tAc8Open file and return a stream. Raise IOError upon failure. file is either a text or byte string giving the name (and the path if the file isn't in the current working directory) of the file to be opened or an integer file descriptor of the file to be wrapped. (If a file descriptor is given, it is closed when the returned I/O object is closed, unless closefd is set to False.) mode is an optional string that specifies the mode in which the file is opened. It defaults to 'r' which means open for reading in text mode. Other common values are 'w' for writing (truncating the file if it already exists), and 'a' for appending (which on some Unix systems, means that all writes append to the end of the file regardless of the current seek position). In text mode, if encoding is not specified the encoding used is platform dependent. (For reading and writing raw bytes use binary mode and leave encoding unspecified.) The available modes are: ========= =============================================================== Character Meaning --------- --------------------------------------------------------------- 'r' open for reading (default) 'w' open for writing, truncating the file first 'a' open for writing, appending to the end of the file if it exists 'b' binary mode 't' text mode (default) '+' open a disk file for updating (reading and writing) 'U' universal newline mode (for backwards compatibility; unneeded for new code) ========= =============================================================== The default mode is 'rt' (open for reading text). For binary random access, the mode 'w+b' opens and truncates the file to 0 bytes, while 'r+b' opens the file without truncation. Python distinguishes between files opened in binary and text modes, even when the underlying operating system doesn't. Files opened in binary mode (appending 'b' to the mode argument) return contents as bytes objects without any decoding. In text mode (the default, or when 't' is appended to the mode argument), the contents of the file are returned as strings, the bytes having been first decoded using a platform-dependent encoding or using the specified encoding if given. buffering is an optional integer used to set the buffering policy. Pass 0 to switch buffering off (only allowed in binary mode), 1 to select line buffering (only usable in text mode), and an integer > 1 to indicate the size of a fixed-size chunk buffer. When no buffering argument is given, the default buffering policy works as follows: * Binary files are buffered in fixed-size chunks; the size of the buffer is chosen using a heuristic trying to determine the underlying device's "block size" and falling back on `io.DEFAULT_BUFFER_SIZE`. On many systems, the buffer will typically be 4096 or 8192 bytes long. * "Interactive" text files (files for which isatty() returns True) use line buffering. Other text files use the policy described above for binary files. encoding is the name of the encoding used to decode or encode the file. This should only be used in text mode. The default encoding is platform dependent, but any encoding supported by Python can be passed. See the codecs module for the list of supported encodings. errors is an optional string that specifies how encoding errors are to be handled---this argument should not be used in binary mode. Pass 'strict' to raise a ValueError exception if there is an encoding error (the default of None has the same effect), or pass 'ignore' to ignore errors. (Note that ignoring encoding errors can lead to data loss.) See the documentation for codecs.register for a list of the permitted encoding error strings. newline controls how universal newlines works (it only applies to text mode). It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If closefd is False, the underlying file descriptor will be kept open when the file is closed. This does not work when a file name is given and must be True in that case. open() returns a file object whose type depends on the mode, and through which the standard file operations such as reading and writing are performed. When open() is used to open a file in a text mode ('w', 'r', 'wt', 'rt', etc.), it returns a TextIOWrapper. When used to open a file in a binary mode, the returned class varies: in read binary mode, it returns a BufferedReader; in write binary and append binary modes, it returns a BufferedWriter, and in read/write mode, it returns a BufferedRandom. It is also possible to use a string or bytearray as a file for both reading and writing. For strings StringIO can be used like a file opened in a text mode, and for bytes a BytesIO can be used like a file opened in a binary mode.  .(  @;E,F. ]  $s 1$" D rfork: %r tls find_key: small circular list(!)tls find_key: circular list(!)remove(x) Remove the first occurrence of x in the array.d8d8 csv_writer = csv.writer(fileobj [, dialect='excel'] [optional keyword args]) for row in sequence: csv_writer.writerow(row) [or] csv_writer = csv.writer(fileobj [, dialect='excel'] [optional keyword args]) csv_writer.writerows(rows) The "fileobj" argument can be any object that supports the file API. };};};};};S.splitlines(keepends=False) -> list of strings Return a list of the lines in S, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.readable() -> bool. Returns True if the IO object can be read.Y`BXJY`AouFou?CH)% j04y3A|#=seek(position) -- set the current position seek(position, mode) -- mode 0: absolute; 1: relative; 2: relative to EOFcomplex.__format__() -> str Converts to a string according to format_spec.tanh(x) Return the hyperbolic tangent of x.Returns underlying file descriptor if one exists. An IOError is raised if the IO object does not use a file descriptor.  A0Q U <+1!;!<3 334.3('3yY+sysconf(name) -> integer Return an integer-valued system configuration variable.D.itervalues() -> an iterator over the values of Dtrunc(x:Real) -> Integral Truncates x to the nearest Integral toward 0. Uses the __trunc__ magic method.Y`JY`operator.isCallable() is not supported in 3.x. Use hasattr(obj, '__call__').operator.sequenceIncludes() is not supported in 3.x. Use operator.contains().op_addop_subop_mulop_divop_floordivop_truedivop_modop_lshiftop_rshiftop_and_op_xorop_or_op_iaddop_isubop_imulop_idivop_ifloordivop_itruedivop_imodop_ilshiftop_irshiftop_iandop_ixorop_iorop_concatOi:op_repeatop_iconcatOi:op_irepeatop_containssequenceIncludesindexOfcountOfop_getitemop_delitemop_setitemop_ltop_leop_eqop_neop_gtop_gepowipowis_is_notOnn:getsliceOnnO:setsliceOnn:delsliceisCallableisCallable(a) -- Same as callable(a).isNumberTypeisNumberType(a) -- Return True if a has a numeric type, False otherwise.isSequenceTypeisSequenceType(a) -- Return True if a has a sequence type, False otherwise.truthtruth(a) -- Return True if a is true, False otherwise.containscontains(a, b) -- Same as b in a (note reversed operands).__contains__contains(a, b) -- Same as b in a (note reversed operands).sequenceIncludessequenceIncludes(a, b) -- Same as b in a (note reversed operands; deprecated).indexOfindexOf(a, b) -- Return the first index of b in a.countOfcountOf(a, b) -- Return the number of times b occurs in a.isMappingTypeisMappingType(a) -- Return True if a has a mapping type, False otherwise.is_is_(a, b) -- Same as a is b.is_notis_not(a, b) -- Same as a is not b.indexindex(a) -- Same as a.__index__()__index__index(a) -- Same as a.__index__()addadd(a, b) -- Same as a + b.__add__add(a, b) -- Same as a + b.subsub(a, b) -- Same as a - b.__sub__sub(a, b) -- Same as a - b.mulmul(a, b) -- Same as a * b.__mul__mul(a, b) -- Same as a * b.divdiv(a, b) -- Same as a / b when __future__.division is not in effect.__div__div(a, b) -- Same as a / b when __future__.division is not in effect.floordivfloordiv(a, b) -- Same as a // b.__floordiv__floordiv(a, b) -- Same as a // b.truedivtruediv(a, b) -- Same as a / b when __future__.division is in effect.__truediv__truediv(a, b) -- Same as a / b when __future__.division is in effect.modmod(a, b) -- Same as a % b.__mod__mod(a, b) -- Same as a % b.negneg(a) -- Same as -a.__neg__neg(a) -- Same as -a.pospos(a) -- Same as +a.__pos__pos(a) -- Same as +a.absabs(a) -- Same as abs(a).__abs__abs(a) -- Same as abs(a).invinv(a) -- Same as ~a.__inv__inv(a) -- Same as ~a.invertinvert(a) -- Same as ~a.__invert__invert(a) -- Same as ~a.lshiftlshift(a, b) -- Same as a << b.__lshift__lshift(a, b) -- Same as a << b.rshiftrshift(a, b) -- Same as a >> b.__rshift__rshift(a, b) -- Same as a >> b.not_not_(a) -- Same as not a.__not__not_(a) -- Same as not a.and_and_(a, b) -- Same as a & b.__and__and_(a, b) -- Same as a & b.xorxor(a, b) -- Same as a ^ b.__xor__xor(a, b) -- Same as a ^ b.or_or_(a, b) -- Same as a | b.__or__or_(a, b) -- Same as a | b.iadda = iadd(a, b) -- Same as a += b.__iadd__a = iadd(a, b) -- Same as a += b.isuba = isub(a, b) -- Same as a -= b.__isub__a = isub(a, b) -- Same as a -= b.imula = imul(a, b) -- Same as a *= b.__imul__a = imul(a, b) -- Same as a *= b.idiva = idiv(a, b) -- Same as a /= b when __future__.division is not in effect.__idiv__a = idiv(a, b) -- Same as a /= b when __future__.division is not in effect.ifloordiva = ifloordiv(a, b) -- Same as a //= b.__ifloordiv__a = ifloordiv(a, b) -- Same as a //= b.itruediva = itruediv(a, b) -- Same as a /= b when __future__.division is in effect.__itruediv__a = itruediv(a, b) -- Same as a /= b when __future__.division is in effect.imoda = imod(a, b) -- Same as a %= b.__imod__a = imod(a, b) -- Same as a %= b.ilshifta = ilshift(a, b) -- Same as a <<= b.__ilshift__a = ilshift(a, b) -- Same as a <<= b.irshifta = irshift(a, b) -- Same as a >>= b.__irshift__a = irshift(a, b) -- Same as a >>= b.ianda = iand(a, b) -- Same as a &= b.__iand__a = iand(a, b) -- Same as a &= b.ixora = ixor(a, b) -- Same as a ^= b.__ixor__a = ixor(a, b) -- Same as a ^= b.iora = ior(a, b) -- Same as a |= b.__ior__a = ior(a, b) -- Same as a |= b.concatconcat(a, b) -- Same as a + b, for a and b sequences.__concat__concat(a, b) -- Same as a + b, for a and b sequences.repeatrepeat(a, b) -- Return a * b, where a is a sequence, and b is an integer.__repeat__repeat(a, b) -- Return a * b, where a is a sequence, and b is an integer.iconcata = iconcat(a, b) -- Same as a += b, for a and b sequences.__iconcat__a = iconcat(a, b) -- Same as a += b, for a and b sequences.irepeata = irepeat(a, b) -- Same as a *= b, where a is a sequence, and b is an integer.__irepeat__a = irepeat(a, b) -- Same as a *= b, where a is a sequence, and b is an integer.getitemgetitem(a, b) -- Same as a[b].__getitem__getitem(a, b) -- Same as a[b].setitemsetitem(a, b, c) -- Same as a[b] = c.__setitem__setitem(a, b, c) -- Same as a[b] = c.delitemdelitem(a, b) -- Same as del a[b].__delitem__delitem(a, b) -- Same as del a[b].powpow(a, b) -- Same as a ** b.__pow__pow(a, b) -- Same as a ** b.ipowa = ipow(a, b) -- Same as a **= b.__ipow__a = ipow(a, b) -- Same as a **= b.getslicegetslice(a, b, c) -- Same as a[b:c].__getslice__getslice(a, b, c) -- Same as a[b:c].setslicesetslice(a, b, c, d) -- Same as a[b:c] = d.__setslice__setslice(a, b, c, d) -- Same as a[b:c] = d.delslicedelslice(a, b, c) -- Same as del a[b:c].__delslice__delslice(a, b, c) -- Same as del a[b:c].ltlt(a, b) -- Same as ab.__gt__gt(a, b) -- Same as a>b.gege(a, b) -- Same as a>=b.__ge__ge(a, b) -- Same as a>=b.itemgetter()itemgetteritemgetteroperator.itemgetterattrgetter()attrgetterattribute name must be a stringattrgetteroperator.attrgettermethodcaller needs at least one argument, the method namemethodcalleroperator.methodcalleroperatoritemgetterattrgettermethodcallerSYSTEMflush( [length] ) -- Return a string containing any remaining decompressed data. length, if given, is the initial size of the output buffer. The decompressor object can no longer be used after this call.6 j/6G 86*1$61d%6' x-6#^4 6'U"6 M632%6S2b'f8 f8!f8&f8OPQRSTUVWXYZ[\]^_`abc!<@"<@$<@$<@P&<@'<@L)<@*<+<X,<-<b.</</<0<R1<\1<2<2<3<L4<5<5<PReturn state information for pickling.@@ r1DW!$r19jVfrexp(x) Return the mantissa and exponent of x, as pair (m, e). m is a float and e is an int, such that x = m * 2.**e. If x is 0, m and e are both 0. Else 0.5 <= abs(m) < 1.0.g!n!?Q?kﴑ[?Private method returning an estimate of len(list(it)).s:lookupO|ss:encodeO|ss:decodeOns#|z:escape_decodeS|z:escape_encodeO|z:unicode_internal_decodes*|zi:utf_7_decodes*|zi:utf_8_decodes*|zi:utf_16_decodes*|zi:utf_16_le_decodes*|zi:utf_16_be_decodes*|zii:utf_16_ex_decodeOnis*|zi:utf_32_decodes*|zi:utf_32_le_decodes*|zi:utf_32_be_decodes*|zii:utf_32_ex_decodeOnis*|z:unicode_escape_decodes*|z:raw_unicode_escape_decodes*|z:latin_1_decodes*|z:ascii_decodes*|zO:charmap_decodes#|z:readbuffer_encodet#|z:charbuffer_encodeO|z:unicode_internal_encodeO|z:utf_7_encodeO|z:utf_8_encodeO|zi:utf_16_encodeO|z:utf_16_le_encodeO|z:utf_16_be_encodeO|zi:utf_32_encodeO|z:utf_32_le_encodeO|z:utf_32_be_encodeO|z:unicode_escape_encodeO|z:raw_unicode_escape_encodeO|z:latin_1_encodeO|z:ascii_encodeO|zO:charmap_encodeU:charmap_buildsO:register_errors:lookup_errorregisterlookupencodedecodeescape_encodeescape_decodeutf_8_encodeutf_8_decodeutf_7_encodeutf_7_decodeutf_16_encodeutf_16_le_encodeutf_16_be_encodeutf_16_decodeutf_16_le_decodeutf_16_be_decodeutf_16_ex_decodeutf_32_encodeutf_32_le_encodeutf_32_be_encodeutf_32_decodeutf_32_le_decodeutf_32_be_decodeutf_32_ex_decodeunicode_escape_encodeunicode_escape_decodeunicode_internal_encodeunicode_internal_decoderaw_unicode_escape_encoderaw_unicode_escape_decodelatin_1_encodelatin_1_decodeascii_encodeascii_decodecharmap_encodecharmap_decodecharmap_buildreadbuffer_encodecharbuffer_encoderegister_errorlookup_error_codecsUnknown format code '%c' for object of type '%.200s'Cannot specify ',' with '%c'.Too many decimal digits in format stringFormat specifier missing precisionInvalid conversion specification.,.Sign not allowed in string format specifierAlternate form (#) not allowed in string format specifier'=' alignment not allowed in string format specifierPrecision not allowed in integer format specifierSign not allowed with integer format specifier 'c'Thousands separators not allowed with integer format specifier 'c'%c arg not in range(0x110000) (wide Python build)Alternate form (#) not allowed in float format specifierAlternate form (#) not allowed in complex format specifierZero padding is not allowed in complex format specifier'=' alignment flag is not allowed in complex format specifierH)4/oV{z]6%48nyyhx{ASqq;writable() -> bool. Returns True if the IO object can be written.UTF-16copy() -- Return a copy of the compression object./env/seek(pos, whence=0) -> int. Change stream position. Seek to byte offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos may be negative; 2 End of stream - pos usually negative. Returns the new absolute position.Compiled struct objectrecv(buffersize[, flags]) -> data Receive up to buffersize bytes from the socket. For the optional flags argument, see the Unix manual. When no data is available, block until at least one byte is available or until the remote end is closed. When the remote end is closed and all data is read, return the empty string.S.indices(len) -> (start, stop, stride) Assuming a sequence of length len, calculate the start and stop indices, and the stride length of the extended slice described by S. Out of bounds indices are clipped in a manner consistent with the handling of normal slices.This module provides mechanisms to use signal handlers in Python. Functions: alarm() -- cause SIGALRM after a specified time [Unix only] setitimer() -- cause a signal (described below) after a specified float time and the timer may restart then [Unix only] getitimer() -- get current value of timer [Unix only] signal() -- set the action for a given signal getsignal() -- get the signal action for a given signal pause() -- wait until a signal arrives [Unix only] default_int_handler() -- default SIGINT handler signal constants: SIG_DFL -- used to refer to the system default handler SIG_IGN -- used to ignore the signal NSIG -- number of defined signals SIGINT, SIGTERM, etc. -- signal numbers itimer constants: ITIMER_REAL -- decrements in real time, and delivers SIGALRM upon expiration ITIMER_VIRTUAL -- decrements only when the process is executing, and delivers SIGVTALRM upon expiration ITIMER_PROF -- decrements both when the process is executing and when the system is executing on behalf of the process. Coupled with ITIMER_VIRTUAL, this timer is usually used to profile the time spent by the application in user and kernel space. SIGPROF is delivered upon expiration. *** IMPORTANT NOTICE *** A signal handler function is called with two arguments: the first is the signal number, the second is the interrupted stack frame.B6,EV6r$L/A04A0(isO)empty mode stringuniversal newline mode can only be used with modes starting with 'r'mode string must begin with one of 'r', 'w', 'a' or 'U', not '%.200s'file() constructor not accessible in restricted modeinvalid mode ('%.50s') or filename(isO)close() called during concurrent operation on the same file object.PyFileObject locking error in destructor (refcnt <= 0 at close).I/O operation on closed fileFile not open for %sMixing iteration and read methods would lose dataclose failed in file object destructor: ?<%s file u'%s', mode '%s' at %p>closedopen<%s file %s, mode '%s' at %p>closedopenO|i:seekinteger argument expected, got floatwritingtruncatereading|l:readrequested number of bytes is more than a Python string can holdreadingw*line is longer than a Python string can holdline is longer than a Python string can hold../Objects/fileobject.creadingreadline(i)object.readline() returned non-stringEOF when reading a lineEOF when reading a linereading|i:readlinereading|l:readlinesline is longer than a Python string can holdwritings*Ostrictwritingwritelines() requires an iterable argumentwritelines() argument must be a sequence of stringsf.xreadlines() not supported in 3.x, try 'for line in f' insteadclosereadlinereadwritefilenoseektruncatetellreadintoreadlinesxreadlineswritelinesflushcloseisatty__enter____exit__modefile mode ('r', 'U', 'w', 'a', possibly with 'b' or '+' added)namefile nameencodingfile encodingerrorsUnicode error handler (ss) (ss) (ss) (sss) Unknown newlines value 0x%x file.softspace not supported in 3.xfile.softspace not supported in 3.xcan't delete softspace attributeclosedTrue if the file is closednewlinesend-of-line convention used in this filesoftspaceflag indicating that a space needs to be printed; used by printreadingnamemodebufferingret|si:fileO|si:filefilesoftspacesoftspacewriteobject with NULL filestrictwritenull file for PyFile_WriteStringfilenofileno() returned a non-integerargument must be an int, or have a fileno() method.file descriptor cannot be a negative integer (%i)  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~`!LwE!wwt .` /.x0.{##.++.u\w4F.%\. m#l.$S.istitle() -> bool Return True if S is a titlecased string and there is at least one character in S, i.e. upper- and titlecase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise.sys.version_info Version information as a named tuple.1)1)1)1)1)1) 1)1)release_lock() -> None Release the interpreter's import lock. On platforms without threads, this function does nothing. 0   yy  9 Oaa 88 A ~+*](*?*?* =EG** ** ** .. 22 33 66 55 11 // -- )) )) ++ ** )) && '' %% TT&%@?   P 0 ` }y}  A JJ VV dd pp ~~ A A A    }y}( excepthook(exctype, value, traceback) -> None Handle an exception by displaying it with a traceback on sys.stderr. F6s2N6Z6BZ2Compressor([compresslevel=9]) -> compressor object Create a new compressor object. This object may be used to compress data sequentially. If you want to compress data in one shot, use the compress() function instead. The compresslevel parameter, if given, must be a number between 1 and 9. tee(iterable, n=2) --> tuple of n independent iterators.PyErr_Restore: traceback !== NULL bad argument type for built-in operationError(isO)(is)%s:%d: bad argument to internal functionbad argument to internal functionPyErr_NewException: name must be module.class__module____module__sOO__doc__stderrException __module__exceptions.: in ignored linenofilenametextoffsetmsgmsgprint_file_and_lineprint_file_and_linerbHeap queues [explanation by Fran�ois Pinard] Heaps are arrays for which a[k] <= a[2*k+1] and a[k] <= a[2*k+2] for all k, counting elements from 0. For the sake of comparison, non-existing elements are considered to be infinite. The interesting property of a heap is that a[0] is always its smallest element. The strange invariant above is meant to be an efficient memory representation for a tournament. The numbers below are `k', not a[k]: 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 In the tree above, each cell `k' is topping `2*k+1' and `2*k+2'. In an usual binary tournament we see in sports, each cell is the winner over the two cells it tops, and we can trace the winner down the tree to see all opponents s/he had. However, in many computer applications of such tournaments, we do not need to trace the history of a winner. To be more memory efficient, when a winner is promoted, we try to replace it by something else at a lower level, and the rule becomes that a cell and the two cells it tops contain three different items, but the top cell "wins" over the two topped cells. If this heap invariant is protected at all time, index 0 is clearly the overall winner. The simplest algorithmic way to remove it and find the "next" winner is to move some loser (let's say cell 30 in the diagram above) into the 0 position, and then percolate this new 0 down the tree, exchanging values, until the invariant is re-established. This is clearly logarithmic on the total number of items in the tree. By iterating over all items, you get an O(n ln n) sort. A nice feature of this sort is that you can efficiently insert new items while the sort is going on, provided that the inserted items are not "better" than the last 0'th element you extracted. This is especially useful in simulation contexts, where the tree holds all incoming events, and the "win" condition means the smallest scheduled time. When an event schedule other events for execution, they are scheduled into the future, so they can easily go into the heap. So, a heap is a good structure for implementing schedulers (this is what I used for my MIDI sequencer :-). Various structures for implementing schedulers have been extensively studied, and heaps are good for this, as they are reasonably speedy, the speed is almost constant, and the worst case is not much different than the average case. However, there are other representations which are more efficient overall, yet the worst cases might be terrible. Heaps are also very useful in big disk sorts. You most probably all know that a big sort implies producing "runs" (which are pre-sorted sequences, which size is usually related to the amount of CPU memory), followed by a merging passes for these runs, which merging is often very cleverly organised[1]. It is very important that the initial sort produces the longest runs possible. Tournaments are a good way to that. If, using all the memory available to hold a tournament, you replace and percolate items that happen to fit the current run, you'll produce runs which are twice the size of the memory for random input, and much better for input fuzzily ordered. Moreover, if you output the 0'th item on disk and get an input which may not fit in the current tournament (because the value "wins" over the last output value), it cannot fit in the heap, so the size of the heap decreases. The freed memory could be cleverly reused immediately for progressively building a second heap, which grows at exactly the same rate the first heap is melting. When the first heap completely vanishes, you switch heaps and start a new run. Clever and quite effective! In a word, heaps are useful memory structures to know. I use them in a few applications, and I think it is good to keep a `heap' module around. :-) -------------------- [1] The disk balancing algorithms which are current, nowadays, are more annoying than clever, and this is a consequence of the seeking capabilities of the disks. On devices which cannot seek, like big tape drives, the story was quite different, and one had to be very clever to ensure (far in advance) that each tape movement will be the most effective possible (that is, will best participate at "progressing" the merge). Some tapes were even able to read backwards, and this was also used to avoid the rewinding time. Believe me, real good tape sorts were quite spectacular to watch! From all times, sorting has always been a Great Art! :-) join(list [,sep]) -> string joinfields(list [,sep]) -> string Return a string composed of the words in list, with intervening occurrences of sep. Sep defaults to a single space. (join and joinfields are synonymous)truncate([size: int]) -> None. Truncate the file to at most size bytes. Size defaults to the current file position, as returned by tell().The current file position is changed to the value of size.L6,Eb6r~7Ltime([hour[, minute[, second[, microsecond[, tzinfo]]]]]) --> a time object All arguments are optional. tzinfo may be None, or an instance of a tzinfo subclass. The remaining arguments may be ints or longs. open(filename, flag [, mode=0777]) -> fd Open a file (for low level IO).3-groups([default=None]) -> tuple. Return a tuple containing all the subgroups of the match, from 1. The default argument is used for groups that did not participate in the matchReturn the intersection of two or more sets as a new set. (i.e. elements that are common to all of the sets.)@readall() -> bytes. read all data from the file, returned as bytes. In non-blocking mode, returns as much as is immediately available, or None if no data is available. On end-of-file, returns ''.Clear the internal cache.md4md5sha1sha224sha256sha384sha512%.2uxs*:updateupdatedigesthexdigestcopynamealgorithm name.digest_sizeblock_sizedigestsize<%s HASH object @ %p>_hashlib.HASHunsupported hash typenamestringO|s*:newsname must be a string|s*:md4|s*:md5|s*:sha1|s*:sha224|s*:sha256|s*:sha384|s*:sha512newopenssl_md4Returns a md4 hash object; optionally initialized with a stringopenssl_md5Returns a md5 hash object; optionally initialized with a stringopenssl_sha1Returns a sha1 hash object; optionally initialized with a stringopenssl_sha224Returns a sha224 hash object; optionally initialized with a stringopenssl_sha256Returns a sha256 hash object; optionally initialized with a stringopenssl_sha384Returns a sha384 hash object; optionally initialized with a stringopenssl_sha512Returns a sha512 hash object; optionally initialized with a string_hashlibmd4md4md4md5md5md5sha1sha1sha1sha224sha224sha224sha256sha256sha256sha384sha384sha384sha512sha512sha512S.replace(old, new[, count]) -> unicode Return a copy of S with all occurrences of substring old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.FGDXӡPѡҡšDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrsDzǴǵǶǷǸǹǺǼǽǾǿVXELK¡JK¢ԡۡܡڡݡء١wxz{|}utsrq~Zbcdefghiponmlkjvy@BCqrmnuvyzijEefâĢŢƢǢȢɢʢˢƦƧƨƩƪƫƬƭƮƯưƱƲƳƴƵƶƷƸƹƺƻƼƽƾƿƣ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ǡǢǣǤǥǦǧǨǩǪǫǬǭǮǯǰtuvwxyz{|}~UVPQRTWSO@BCEVTWUFɣOMɢBA@CèXPcꦱYDd@D[G\EGFĨAAE^]ŨKöܲFƨGH_QɭǨȨE`ɨʨFGHRɱTSɵJKLMIPjfiQahNOHegɮ饱ɶɸɯfBgD[`hdG]Cb^ZeEH@FcAi\_aبШ˨ըΨ֨˼ި٨˵ۨϨԨ˴ӨרҨͨܨݨڨ˲Ѩ̨VJIQ]KYPXT[NWMURZO\SLH׭ѭ֭ĭͭڭέǭܭӭп̭˭ϭ[ƭխԭʭɭҭí­Эŭ٭ۭحȭcW\bԲUԶYRԴVԹgQfXԱSO]PNZ`aԷ[^M_dLTeԼȳ^Wų_UXijYdz]SRɳʳƳ˳Q\ZTóVʶĶͶƶǶŶ˶̶ɶܼȶζܹಹஹହ෹హ൹觾詾訾vwux_lkIaSRJIKߨ^YZ°\[`]^JK@LݭNTUAj`_ðUaޭ߭VBMNkha@LZİͳBɿYWXMNb¤ZkFDEGClmnPOSQRchdgfebѳŰikjlưγϳгжѶ϶ABỹZ@ABDCO\[HUVTWoplkijǰnʰmɰȰԳӳҳҶնֶԶӶCDEyUcäVĤŤ]^Iqm̰˰cbPƤ_ͰCl`KJXo׶EἹǤаΰϰQd͢ʤɤȤcbmnճRˤedrWgfLMsYZoD̤tuppdֳeFόFXhѰSeΤͤϤqOfjytonuslzmixwvkrq{pSYU[XNQTPWZORV\~{g|[]up}_ahxtv\mvsdnowljkq^rfczbei`yOPIKMLEADIRCFHQMSJGB@NHKxt}rCΣOΥyEBwͦJ|LΩs~{@ΡFGzvuDND@BCACFB@GѡEDAw䰧߰|۰v{zᰥsְٰ~ӰڰtԤݰux}ްܰװұذyణհ԰qrj׳ڳuxسq޳䳽n۳v{ofsmyݳ߳ܳzlrthwٳgip޶ܶ߶ڶݶض۶_ٶ͹ȹUQK¹TΌNPSĹ˹ŹIƹǹL̹JOùHɹMRʹGMGDGSTJBLRFIHHCEKAkONP䲾@EB鶾AC輾軾D@QF鷾{}~z|P`VQAY@XWZmonŦI}|_^]ywzxTHIEF밫|ϹιIHGkgYnobfdcea`}{ʬ~|Y[Z@XWV\AUTZX^UY[]WVQRέS\PSRWNQPTXGJOUIJVMHLԯԽԴԼԾԹԲԦذԵԳﰻԶKةإ}رخKѫ~ذد]йcչ_fW׹ѹ\U[dҹֹZ`eVԹ^bhXaӹgYYKWVMRNQ\[JPZOLXMOJLNþP¾IKSRabcB[hФ_عiSZB`YLi~pgh]ڹ۹ٹjѤӤҤ[ԤqijaC_`^ZabMNOݹܹj]ľklonqpmkʹʸʳʮʻʷʭʺʫgoOHpSDKfEdLPcQJMriTRnlIkGFjhqmeNoθgcsblξpοVvdfmqurknhëjitκe«\b[`PU_\aQ[TRcSWXZY]^d@CDBA@ؽBGCضADغطؼEصB@CD@FAABEnzpvkyx|u޹tm߹{orwqlsUaXWZ\_VT][Y_^c^`b`WVUXQRZSž\[TYƾT\]ClmnդrssUutVī]eEGF}Ǿ^prsvtuwʻWXvxzw{yȫūǫɫƫfwhgc_`bdafeJIHGKFIKHJHIJ~칡fged]Ⱦd_oxʫigNMLLMɾp\֤ty|KqפNLrؤuɧY~Z}Ϋxͫ˫̫jhkij^PQOhiaĨK٤swvzħ§çhb]̣ec\ilg`̥f̦ad[_ķ^j̢ΤΪΣΥ}{ΩyЫΨ|zϫ~έonlknposqpѮrmlmqrSRTXAZV^[UCWB\]YD@QROOPSVNPUTCRDMQegkhcbljjmdikfaf`e^hdic_gjbrDE`rqt{ʵ_uŧtWvwxڤѫSy]ɫx|Ƨn̬m̩o̪ҫԫΰαβδӫtsvubFac`UEVWTZ\E[YXqompnlmklnnz~}FۤիXyzȧɧǧβ֫ιζκ׫yuwwxxvGJKHgfdeIhZ[\]_aHGY`^psrtqtuossqprofFGUʧث{ܤ˧٫|I}ݤޤɢ̧qrsp̸ګzzyiLjM]buvʾtstkJUΧͧ۫{mCnl^vLϧЧwv̻uݫܫޫ߫}|{OorpNuqPtsa_`KdLcwxwu@HIߤ{ҧԧɤӧѧxyا֧էק̢~̮̩©̭㫬éȩƩ|̥ͩ䫦ɩ{ʩ˩ǩ̩z̫ĩ}̡̤ũΡΤ~}|쫡򫢮~뫦﫥ΧvѦѨSլѣxQRѯѭѧywzU^d|e`ժVբ~TbeIcء]a{dYbWXէ[ի_դ\fcZ}ko@QmDqeFSilGHNsTJOC^UrAP]pNMtEjBKMRgLPh\phlnk[j_Z@qXimOfgAWYVo}GF|ECDzn᣼{HyBz~y~ξx娼̾嬼xv}w;姼孼|{˾zо~Ѿ|y{ӾҾ}ϾVgjihaJbAt|ɳڧ٧ϩΩѭur`atvuI宼ԾW¹ѩЩҩѰvQ~}ɷɪɩߧөާۧݧܧ᩾̷ܩ侀̴̺̼̿詸٩⩶שة֩ԩߩթ䩵کݩީ۩A@ѱCBEβDѿfѺѼ}սѾѿѸѵѶѹѻѻî®ѷg˱ʱyurզպwը̱ɱ{jȱiսs±hxqDZtդƱRoոñxnl~հıw|յpűmzvTSkdzjYgw}kn|\ml~Uyi_٥phq٭fec]٤VW{yXox`[٩a^p|ݱݶݪliz{bknoݸjd}ݺݨݩ~ݴݫݵݭehfݰݬSmgcݮQLKObR导T尼NPUJ嵼Zٲ¼M峼üؾپ߾־ݾ۾վܾ׾޾ھY­X^\]Zk[BEFDGlCNdMLKceuũrٯFGĮŮӱϱֱձαѱԱбvͱuxٰswtqVļżƼHyƮرױz{rW礸Hٱ|ٵs_IǮȮ۱ܱݱڱ}~پYXJIO^J餹@PMSKNQLORЮɮ̮Ϯʮήˮͮ߱խޱծ౩٨ݦټ١yvwu{ݻxtz\Z[ȼǼʼɼ澻辳徶`nKmQRfPŪTѮҰ̳|뤳BAҮӮԮ´zagɵɴCGBE@AA@FDWCMNFXHSIVQOJPDRUELTGK[\iVLbJ[EeRADQa`FX_`cZKSfYamVXCjc]@lgIkPHd\T^bGZYO_UWh]NMB^WU߮ծݮ֮ڮۮخ׮ٮܮյչսհղճ鱺շջޮִѴҴδĴǴƴ״ɴŴд̴ٰٵٯ˴ݱϴʴٴʹôٴ٬ȴټپ٪ӴմٹԴݦݨݬݡݯݣݰݪ~شݿݥݢݭJH^FX}_B]GUd][@ZoQamI^KYgDkaMCWh`eSfEPLN`_nObTcljAVibR\ͼؼռѼμּ׼ԼټӼмϼ̼Ҽ˼EAHIDJ@GCFBchibfegdQNWVTOrPqSpXRMoLVUUhYZTXSWvVYd۴ܴڴݲpceqdۼڼKjYwBZ[nk\eofp޴ݴfghܼLlZ_qgߴijݼ޼`CHrhsijBAC@@AAB@ݷkM[¥]a~ɻIJ^tklDBråƥťĥD@ŦƦ¦ĦɼEæ[YLQSLMUROQVZXZKM\TWEG^UNJYVHICOP[]PNS\WR]FTKXDjzqKbeBmovhfguGpnsJuycIMO@lk}rux|AF~wi_d`N{taL|ϡwϪϬtv{Iҭϭ{sd~xzϥ}}pϨzmϪxoϫ^H|wvnϬϩyϡqϢrϦy~LCU[WJMFGJV_E@NBOYDhHHEfZgaSb\ecITAG`FQCiPKKX]eRPG[UGDgdXcNOIE@QYBD^F\SHFJhb_]faR`AEWVTLKCMAZIMDJCUVHDBSKQWAGEBCOLT@FGFEPNR@a`F޽_IJǷh·^CȷRHKc޸jbW̷˷ŷi޹ULYeͷTMķ÷PZdGQ޼[ɷN޿ESgVlXfƷO޺ʷD]\⭺}⢺n⯺wmⱺqsuS殺}o⣺u~||vtzwxz~pyx{t⪺⤺sr⥺{y߼vDNMYKOFRTC^W[`UILH_aV\JE嫺AZB@XQP]GI@AHCOBDFEDJGFEB@ANCQSYWZRVU[TXPqopmnsrx_ey\vsgwt^abcf]udh`]j`kh_\^bedg[icfiaxyŭWeƣlǦA^_b_`aXZURTVͣSP͡WQͥYϱϵϵwxyPLnv{QlrkuqMOzjmst|pNmNPLXJWiH[RlSVZOTjkYMI[QUKHIeOYbXL`^_Jc\ZK]aMdpwyޡڷkҷz׷η}m~lܷxϷԷqٷ|ovrnѷطַӷ۷зuշN{st⵺gdpjlfnmkqhocebriJQUSKILMHUVGVQOLPNRRMNOPKTSWXT\b`^a]_wtuvlmzkji{ljkyRݷnb}ϹfP޷|gɦBȦedc`[Ϻϻҡ~S]^o\_RpQkjhilڦޥީާ޹⺺stYZr}qpnolǥCDfbaˬegcfgd_;]deab\ͯ^ͮc`ϽϿϼҥXWUҩTVg֣Ҫbfenyhcmtsadurq`ipwTvsVuoqtrUxS߷ެުᷮ⻺ޯvu~}{zwxy|_\]W[a`^decyx~mnmzȥYvjɥEljkhhimkgjf͵ilh¬ŬϿĬìҫҶҹҺҬҸҵҳҷ_]һҲ^Z\xmklstp{uroynwzqy[xwv|~`ڢZڥ[abX}{ڣz_|ڤڪY^\]W鷷跻޳޺޸޹޵޴⾺@bAifegfZcX\[dhYmzjhknlgBEu@oFD{ACGvtsnŲʥnͼҽ}]{ų˥o`ҿ~ºi^_ropqIH|w̥ƬͥңcdΥϥFjiǬϬХѥҥӥklnmrpqˬɬʬȬ`dcba{z֤feڧBjså|ԥsúopt͸ϬЬͬά̬hinlkjemfg֢֭|~֤֣}kjhlmgiگǺƺźȺECHIFGĺDlksmro`qabpntwuvMN}O~LPJxoKp~}ѬnoեʦGqmҬӬԬoqpJxQqp֥uprKtRrץ׬ج֬լqrs֯ڱsɺʺLducySsإnxwͼvͽy۬ڬ߬ެ٬ܬݬuvwtֲֳִֵַ֭֮֬ھںڻڽtCκFDEAB@̺ͺ˺NQOMP}~vzywfgex{|h@{A|z~}U¥¢T{yztwuvf٥ڥoxuGB|xۥz|~}{Ϳ|zҢyҥ}~{ֵֶַֺvڸwxNQMLHOPJKкԺѺӺIҺTXVϺSURYWjlikFECDVGZW[]\XY~}z}yq{|~rtsܥrªҧҦҬֻּּֿRSTA׺պֺCB@mHI_^áVݥrqpĪêҲ־}|z{yAZX@W\[YIHDغGFٺ^_[]Z\pErqnoJ`¨©ãޥHsƪŪ@ҷ~D]^CBJۺںKLa`sK¬uߥAҸڣEܺMݺvĥ˦ǪBC@BӹDGEFCҺHAƲòDzŲ²IJȲڧڥڬګڭaPSGLFcJHbONKMIR_Q]XNPUTWRQߺSY[VOi޺\bce`hdfgvjtxQyw{zONLPMucagedjkhib­«flðêîïóxwyŢXYm~̦EFDGHIIOMӻKLNJɲ˲ʲگVdTeUfa^`_ka|}WSXTVRUz{A@ͦtȪLJKZǯSYïRXV¯įUӽTȯůɯƯQPWϲֲӲٲزԲвѲҲײͲղ̲ڲڴlڳڶڻβh]_ae[Yj`d\XWbZ^kifgcrjxtxeubwfvpcqshgdlimynokpyurvltswqnzrm{o~꨿ꣿꦿꤿ_Yia]dg\e`Zhc^b[fntwµovq·msurpøô÷õ~}ĭBŹ@BAlΦoʯڲjCIɪuM`[_]˯^\@ijnohkgm@pz|}üDźϦ˪ʪONb̯aܲ۲BCAsmlnrq~꪿yxýüðЦPeίdcͯݲ޲߲Dop~CAB{|}桽歿꫿kz{lѦҦ̪ϯQӦARS@BԦTѯfӯЯүA@qզs˪CUhԯgկCBDFGEtuEDpomnq|¾Ť֦wµvFצئ٦vwwtvyu{zxxѪϪΪӪժҪ֪ͬЪ|Ԫͪ[GH]WZcaIgLd\YIbDeV_FK`OMXJ^NEfگد֯jޯۯlݯkinHomׯٯܯ߯NEGHPLJMQFOKIȵQOʵJۡɵNKŵ˵PǵMGƵL̵ĵõwu{sߢxr{}v~|~yxy}͵|tzLHMJKIAD稽C秽@榽B걿꯿txzwvusry¡}~ôijECDڦתRN{ۦSܦPTUVOݦتhpWۤP|µަ٪RεQEߦϵR঱iQrqWTVSUXYZۦߨSJFIKHG괿F}}X[AJKMNLˣ{ˡ|zy}~~jܪͷ۪ߪͿݪڪ͸ઽ쯻ުb\daqt]kV`cewUYWRo~svХf}^xФuy|mУ{lp_ZSXTgnХ[zAv}~x|ӵӤtsr\ۦz{ӡuӯӶӰӧӢwy^`ey]houbi@wrnj\aYfcsdzlkZ_pvA[gmxqtl`׵}۪ۧյhۣiwsߵt]赡u۬pnzԵrۭkdocaеjۨصݵٵ~ڵvfҵ^ۢ۫e൰qmѵ|xֵܵ޵ӵyg{bۦ_Uߵߩ߱߿߲߰߶߶߱۵߸߯߾߲߫ߴߺߪߧ߭߮`X[YZ]aU^WVTc\b_stgfb紽vu_c]pawZXdni綽Om[RU{\SQNe篽`h穽x|竽WkoTy粽L絽rVjP^Y筽l}zqMI@CEAG븿LFUOF귿JT뿿QDHBVSP빿W뽿MKNS@ERDAMOQIPBRJGUHTKLVCN~³°ĩĦĬīļJKIGHLEFGOhӷ@B|{굸~XZYWЧikjӿAFӽCӻHӾӹGDӺEBLK׫HF~שקפ׬׭ׯװ}Eס׮GIDMJ߽۱쵶ﵺ۸۵ۼ۷۹ۻߺ¸øĸ㻸jeghmilfd߲½k翽绽缽羽繽纽罽da븽kge`oĿ\hi_^lb]cn[mj¿ÿfY]Zag\pj_kfm^`nXldch[bieo¥įBEACDQON@PFMžZn妪GlNŸýĽſЭmIJNMKLPUTRS׻׽׷׾O׵״Q͸ϸǸθʸȸɸ˸Ƹ̸tBAv@nprqsoƽʽŽǽȽɽup|ʿwyȿquxƿɿ{stzrvǿrqwstuxvIKHJRHIKJPnWVиCFED̿˿y{zTS[oCA@BѸDIGH}|}LULqrpTRQXPYVSWUO_Y^`Z[X]\DFEICB@GAH߸ڸոָҸ޸׸ܸӸԸPMEJQٸGOKNLݸFظLx{NM}ϽOK䦻y۸|z~wJֽҽٽڽ˽սԽνͽӽнؽ̽׽۽ҿ~ͿӿϿٿԿпڿۿؿѽοܿտѿֿ׿~AO@BCĴij@NMPQAV[XWZYCB@A@MNgmRPDDZaTSܽݽvƨbHVUWQR䨻ݿ޽޿FE\[IYZX߿Gst]^hfcgedJLQSRUOKMTPN[TSU߽併࿴HIJRBS\ŬEBji\]꽺vu_XWV_b`ae^fcd఻VLNKMTowlk`[^Yl]\_Zhonpmrikgjqs[aYbX]c`_^W\ZAC@EBFDEA@CBDROSQPTľCEVDUa`^]bcF_\QPOpnƭ`UyxcabmnCAEFLHJBIKDGb@acuwv{xtyz|gfde䳻MNIJKLH@GFGHIXYWVZXYWFdeHGd@|GŰdA[д|У~{}zjgnilhekmfpzv~w|roq}uxty{sMeOgiNfjhGO~PEJCBMLKIN}DFHRCASDBQPOEŶUoRSQT˧ˬ˨˷˹мйп׺qprע׷lVWTܣnSYXk\R[PZUmQRnqim»ljpkhoYHJVWUQGZTFIXKLM]\[\ZfŻut@Asפ_a]`o^psUTSsuƻûŻĻtra^_M`[\JK]LOPNR_Q^]HIC]qoƼVĽqBxvzDywCԨBث@תCצAmljbqeovnyuciwhxzkrswutfrvtsdgpaWYeZ\f[db^c`Xg]_xǻz̻лȻɻ~ѻͻ|˻ʻyλ{wvϻ}RZUgPOVeTqcdNXtysowuhb}W~xmkfn{jzSv|rlQpYiDACB@@CEEBAD`YTc[eU_aWX]bjgk^Zhj\dfiSVscqalhrbetmpid`okugnBf@DACafOhIdjNJK`gMeL_cb^implnoijgkhųKMLNJDSRT_U^VruthsrpqwDxܥv{EFج}zyܣ|{~{hһջ׻ֻӻԻ[\MKIJFFNHLGnlmwxEGFPmlkXVYW¨˿˭@ЮЭEԢF~|}IصHKرJثGا}ܬ|~ܡܤjkiػڻٻGHOIoAGLضܦܯnomۻlܻPJptqusyBܧܳsprqݻ]^_`QNKPSLROMwvx~}z{|HISnQRoŵqEGFWCtQRDañSŲMuv޻߻cbdVUTTA@}{~|y@zJKpOPHiCBäqrWDXAçLMTQNصܷz|wx{yge[fYZU[YXVZWEJFIHGDBECèF@ĨAħQNOPrVUtsI`X仾hGíBĬuRStsuHO~}i\kjla_^]`\K^]_NLMRKQTSPOJHICDXWUTYvwWvVwaYPUﻭ`WVLòहࣹnqsrtpmocfdcihgbbaedZ^[]\Y_b`a@XcMïEFĴ`^]ca\Z[_bx~y[šZ}|Y{Xz}~{x|yzRSJvjkƴzluejmfdkNfde\ŤżbIhvwnqpoghfegOüPGgihTUVKcƶxiJ{ƬrzyiSRQ^Ũ]ũL|{}xvwsytru|j{z~jmltosqpnkCBDAuXWUTJKIHloVmsqkvjrnut`_ŴűŬpZ\_[`YW]X^MZ\[yxwzst}~okplmnz{~|vy}EF¦wYZ[MxOPNL}{|x~zwyabŽdſcŻindgkreosjcmlqphbfNOa]^`_ba|{x|}PQGQSRecT³tdHu¶rqLJKI\fvwd}uܶxRe~쪹]gy^ĸ|{zM}fN~hŽĻijTSgjihseÿtJJWY[_`cdghklopstwx{|ơǡʡˡȡɡ\MOQRST}~̡͡ΡޡߡLMNICH]^ϡAСDAGFաס֡HIϢТѢҢӢԢբ֢עآ٢ڢۢܢݢޢߢBġ@ABCaUbNáwait4(pid, options) -> (pid, status, rusage) Wait for completion of a given child process.get_referents(*objs) -> list Return the list of objects that are directly referred to by objs.?K8K8$I$I?]t-$hEMh#;Jhfdegrees(x) Convert angle x from radians to degrees.float.__setformat__(typestr, fmt) -> None You probably don't want to use this function. It exists mainly to be used in Python's test suite. typestr must be 'double' or 'float'. fmt must be one of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian', and in addition can only be one of the latter two if it appears to match the underlying C reality. Overrides the automatic determination of C-level floating point type. This affects how floats are converted to and from binary strings.S.upper() -> string Return a copy of the string S converted to uppercase.D|!$1`PEY8vBX~H+'h2\ ?4(?4,k"p"w"~""ParseFile(file) Parse XML data from file-like object.timestamp out of range for platform time_td:sleeptm_yearyear, for example, 1993tm_monmonth of year, range [1, 12]tm_mdayday of month, range [1, 31]tm_hourhours, range [0, 23]tm_minminutes, range [0, 59]tm_secseconds, range [0, 61])tm_wdayday of week, range [0, 6], Monday is 0tm_ydayday of year, range [1, 366]tm_isdst1 if summer time is in effect, 0 if not, and -1 if unknowntime.struct_timeThe time value as returned by gmtime(), localtime(), and strptime(), and accepted by asctime(), mktime() and strftime(). May be considered as a sequence of 9 integers. Note that several fields' values are not the same as those defined by the C language standard for struct tm. For example, the value of the field tm_year is the actual year, not year - 1900. See individual fields' descriptions for details.|O:gmtime|O:localtime(iiiiiiiii)accept2dyearyear >= 1900 requiredyear out of ranges|O:strftimemonth out of rangeday of month out of rangehour out of rangeminute out of rangeseconds out of rangeday of week out of rangeday of year out of range_strptime_strptime_timeOasctimeinvalid timectimeunconvertible timemktime argument out of rangeGMT0/env/timezone daylighttimezonealtzonetimezonealtzonetzname(zz)timeclocksleepgmtimelocaltimeasctimectimemktimestrftimestrptimetimePYTHONY2Kaccept2dyearstruct_timeB.insert(index, int) -> None Insert a single item into the bytearray before the given index.L1""N1B{1Tn1:rj1)`1ll1~~1)nj1]]l13l1IQ1ffcompressobj([level]) -- Return a compressor object. Optional arg level is the compression level, in 0-9.Efficient binary patching.INCLUDE/bin/rcFunctional tools for creating and using iterators. Infinite iterators: count([n]) --> n, n+1, n+2, ... cycle(p) --> p0, p1, ... plast, p0, p1, ... repeat(elem [,n]) --> elem, elem, elem, ... endlessly or up to n times Iterators terminating on the shortest input sequence: chain(p, q, ...) --> p0, p1, ... plast, q0, q1, ... compress(data, selectors) --> (d[0] if s[0]), (d[1] if s[1]), ... dropwhile(pred, seq) --> seq[n], seq[n+1], starting when pred fails groupby(iterable[, keyfunc]) --> sub-iterators grouped by value of keyfunc(v) ifilter(pred, seq) --> elements of seq where pred(elem) is True ifilterfalse(pred, seq) --> elements of seq where pred(elem) is False islice(seq, [start,] stop [, step]) --> elements from seq[start:stop:step] imap(fun, p, q, ...) --> fun(p0, q0), fun(p1, q1), ... starmap(fun, seq) --> fun(*seq[0]), fun(*seq[1]), ... tee(it, n=2) --> (it1, it2 , ... itn) splits one iterator into n takewhile(pred, seq) --> seq[0], seq[1], until pred fails izip(p, q, ...) --> (p[0], q[0]), (p[1], q[1]), ... izip_longest(p, q, ...) --> (p[0], q[0]), (p[1], q[1]), ... Combinatoric generators: product(p, q, ... [repeat=1]) --> cartesian product permutations(p[, r]) combinations(p, r) combinations_with_replacement(p, r) H)-SWHA e+ " @Iterator wrapped to make it copyableS.decode([encoding[,errors]]) -> string or unicode Decodes S using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle UnicodeDecodeErrors.Abstract base class for time zone info objects.EMFEU1:s$" H)D. U&."/@+%O/@'1 unicode Return a copy of the string S, where all characters have been mapped through the given translation table, which must be a mapping of Unicode ordinals to Unicode ordinals, Unicode strings or None. Unmapped characters are left untouched. Characters mapped to None are deleted.localtime([seconds]) -> (tm_year,tm_mon,tm_mday,tm_hour,tm_min, tm_sec,tm_wday,tm_yday,tm_isdst) Convert seconds since the Epoch to a time tuple expressing local time. When 'seconds' is not passed in, convert the current time instead.lstrip(s) -> string Return a copy of the string s with leading whitespace removed.|" |"|"|",|"?|"P|"e|"k|"p|"z|"|"|"patch cannot be decodedinvalid patchinvalid patchOO:mpatchls#patch cannot be decodedlpatchesapply a series of patches patchedsizecalculed patched size mpatchmpatch.mpatchErrorCopyright 1995-1996 by Virginia Polytechnic Institute & State University, Blacksburg, Virginia, USA, and Fred L. Drake, Jr., Reston, Virginia, USA. Portions copyright 1991-1995 by Stichting Mathematisch Centrum, Amsterdam, The Netherlands.9RFߑ?detachreadreadlinewritedetachreadreadlinewriteencodingnewlineserrors_io._TextIOBasedecodertranslateerrorsOi|O:IncrementalNewlineDecoderstrictdecoder should return a string result, not '%.200s'IncrementalNewlineDecoder.__init__ not calledinputfinalO|i:IncrementalNewlineDecoder(OK)NK(OK)setstate((OK)) ss ss ss sss decodegetstatesetstateresetnewlines_io.IncrementalNewlineDecoderasciiiso8859-1utf-8utf-16-beutf-16-leutf-16utf-32-beutf-32-leutf-32bufferencodingerrorsnewlineline_bufferingO|zzzi:fileioillegal newline value: %slocalegetpreferredencodingasciicould not determine default encodingstrict readableOiwritablenamerawseekableunderlying buffer has been detachedI/O operation on uninitialized objectunderlying buffer has been detachedI/O operation on uninitialized objectU:writeI/O operation on closed file.not writablereplacess resetnot readable(OO)underlying read1() should have returned a bytes object, not '%.200s'decoder getstate() should have returned a bytes object, not '%.200s'NNunderlying buffer has been detachedI/O operation on uninitialized object|O&:readI/O operation on closed file.not readablereadI/O operation on closed file.underlying buffer has been detachedI/O operation on uninitialized object|O:readlineinteger argument expected, got '%.200s'setstate((si))underlying buffer has been detachedI/O operation on uninitialized objectO|i:seekI/O operation on closed file.underlying stream is not seekablecan't do nonzero cur-relative seekstellcan't do nonzero end-relative seeksflushresetseekiiinvalid whence (%d, should be 0, 1 or 2)negative seek position %sreadiunderlying read() should have returned a bytes object, not '%.200s'iNdecodeOican't restore logical file positionisunderlying buffer has been detachedI/O operation on uninitialized objectI/O operation on closed file.underlying stream is not seekabletelling position disabled by next() callflushtell(iO)decodes#(s#i)decodesican't reconstruct logical file positionsetstate(O)setstate(O)underlying buffer has been detachedI/O operation on uninitialized object|O:truncateunderlying buffer has been detachedI/O operation on uninitialized objectname<_io.TextIOWrapper encoding=%s><_io.TextIOWrapper name=%s encoding=%s>underlying buffer has been detachedI/O operation on uninitialized objectfilenounderlying buffer has been detachedI/O operation on uninitialized objectseekableunderlying buffer has been detachedI/O operation on uninitialized objectreadableunderlying buffer has been detachedI/O operation on uninitialized objectwritableunderlying buffer has been detachedI/O operation on uninitialized objectisattyunderlying buffer has been detachedI/O operation on uninitialized objectI/O operation on closed file.flushunderlying buffer has been detachedI/O operation on uninitialized objectflushcloseunderlying buffer has been detachedI/O operation on uninitialized objectreadline() should have returned an str object, not '%.200s'underlying buffer has been detachedI/O operation on uninitialized objectnameunderlying buffer has been detachedI/O operation on uninitialized objectunderlying buffer has been detachedI/O operation on uninitialized objectunderlying buffer has been detachedI/O operation on uninitialized objectunderlying buffer has been detachedI/O operation on uninitialized objectunderlying buffer has been detachedI/O operation on uninitialized objecta strictly positive integer is requireddetachwritereadreadlineflushclosefilenoseekablereadablewritableisattyseektelltruncateencodingbufferline_bufferingnameclosednewlineserrors_CHUNK_SIZE_io.TextIOWrapperH)8L'),h* "(H.3E,D "&$y1#P-:pwd.struct_passwd: Results from getpw*() routines. This object may be accessed either as a tuple of (pw_name,pw_passwd,pw_uid,pw_gid,pw_gecos,pw_dir,pw_shell) or via the object attributes as named in the above tuple.xreadlines() -> returns self. For backward compatibility. File objects now include the performance optimizations previously implemented in the xreadlines module.tcpiludpicmpicmpv6!ipinfo ip=%s sys dom!ipinfo sys domdom=sys=/net/cs%s!%s!%s!fasttimeout*::0.0.0.0tcp/clonenet127.1::1*netneticmpicmpv6*0int(x=0) -> int or long int(x, base=10) -> int or long Convert a number or string to an integer, or return 0 if no arguments are given. If x is floating point, the conversion truncates towards zero. If x is outside the integer range, the function returns a long instead. If x is not a number or if base is given, then x must be a string or Unicode object representing an integer literal in the given base. The literal can be preceded by '+' or '-' and be surrounded by whitespace. The base defaults to 10. Valid bases are 0 and 2-36. Base 0 means to interpret the base from the string as an integer literal. >>> int('0b100', base=0) 4B.rpartition(sep) -> (head, sep, tail) Searches for the separator sep in B, starting at the end of B, and returns the part before it, the separator itself, and the part after it. If the separator is not found, returns two empty bytearray objects and B.A hash represents the object used to calculate a checksum of a string of information. Methods: update() -- updates the current digest with an additional string digest() -- return the current digest value hexdigest() -- return the current digest as a string of hexadecimal digits copy() -- return a copy of the current hash object Attributes: name -- the hash algorithm being used by this object digest_size -- number of bytes in this hashes output  S.lower() -> unicode Return a copy of the string S converted to lowercase.?6,E(6r$LS.zfill(width) -> string Pad a numeric string S with zeros on the left, to fill a field of the specified width. The string S is never truncated.flush() -> None. Flush the internal I/O buffer.pow(x, y) Return x**y (x to the power of y).sin(x) Return the sine of x (measured in radians).US-ASCIIexported buffer does not have any shape information associated to itGC object already trackedcannot make memory view because object does not have the buffer interfaceobjectO:memoryviewobject does not have the buffer interfaceGC object already trackedwritable contiguous buffer requested for a non-contiguousobject.GC object already trackedformatitemsizeshapestridessuboffsetsreadonlyndimBtolist() only supports byte viewstolist() only supports one-dimensional objectstobytestolistinvalid indexing of 0-dim memoryindex out of boundsinvalid indexing of 0-dim memorycannot index memory using "%.200s"cannot modify read-only memorycannot delete memoryindex out of boundscannot index memory using "%.200s"mismatching item sizes for "%.200s" and "%.200s"cannot modify size of memoryview objectmemoryviewH)8:Q<read([size]) -> string Read at most size uncompressed bytes, returned as a string. If the size argument is negative or omitted, read until EOF is reached. t9-,R|9-9-P9-     'continue' not supported inside 'finally' clause!4 ܖ!~T$dup2(old_fd, new_fd) Duplicate file descriptor.BqJqPr_warnings provides basic warning filtering support. It is a helper module to speed up interpreter start-up.strptime(string, format) -> struct_time Parse a string to a time tuple according to a format specification. See the library reference manual for formatting codes (same as strftime()).o6,E6r$L]#}4;]#p8]#()]#r\6]#%41]#$]#/]#Z}H-]#;]#`s <]#z$-]#|09)]#mt-]#yP~$]#AL)-]#0/]#!]#}`;]#.^#! ^#|$^#OH-^#.8^#A-#^#nz(3(^#r{A).^#u$6^#ww ;A^#^]-K^#+write(fd, string) -> byteswritten Write a string to a file descriptor.Heap queue algorithm (a.k.a. priority queue). Heaps are arrays for which a[k] <= a[2*k+1] and a[k] <= a[2*k+2] for all k, counting elements from 0. For the sake of comparison, non-existing elements are considered to be infinite. The interesting property of a heap is that a[0] is always its smallest element. Usage: heap = [] # creates an empty heap heappush(heap, item) # pushes a new item on the heap item = heappop(heap) # pops the smallest item from the heap item = heap[0] # smallest item on the heap without popping it heapify(x) # transforms list into a heap, in-place, in linear time item = heapreplace(heap, item) # pops and returns smallest item, and adds # new item; the heap size is unchanged Our API differs from textbook heap algorithms as follows: - We use 0-based indexing. This makes the relationship between the index for a node and the indexes for its children slightly less obvious, but is more suitable since Python uses 0-based indexing. - Our heappop() method returns the smallest item, not the largest. These two make it possible to view the heap as a regular Python list without surprises: heap[0] is the smallest item, and heap.sort() maintains the heap invariant! (! EP8@H)r$ J::!E';P/m9   _clear_type_cache() -> None Clear the internal type lookup cache.$?$$&$$C6 $$)&$9$#@$V$4c$$&$"""0'4"t)"c/"ԭ1"N)"28'"Wt0+"."" "WD""A8)"'"1%"%-/"y;9".C"tZ2O"'["xИ)m"4!? Remove all elements from this set.     bad marshal data (long size out of range)bad marshal data (unnormalized long data)bad marshal data (digit out of range in long)recursion limit exceededEOF read where object expectedEOF read where object expectedEOF read where object expectedEOF read where object expectedEOF read where object expectedEOF read where object expectedEOF read where object expectedbad marshal data (string size out of range)EOF read where object expectedbad marshal data (string ref out of range)bad marshal data (unicode size out of range)EOF read where object expectedbad marshal data (tuple size out of range)NULL object in marshal data for tuplebad marshal data (list size out of range)NULL object in marshal data for listbad marshal data (set size out of range)NULL object in marshal data for setcannot unmarshal code objects in restricted execution modebad marshal data (unknown type code)XXX readobject called with exception set NULL object in marshal data for objectunmarshallable objectobject too deeply nested to marshaltoo much marshall data for a stringOO|i:dumpmarshal.dump() 2nd arg must be filemarshal.load() arg must be fileO|i:dumpss#:loadsdumploaddumpsloadsmarshalversion`"d"h"l"p"t"x"|"""""ENTITY_exit(status) Exit to the system with specified status, without normal exit processing.;;; ; ;;;;; ;ȱ;ɱ;ͱ; ӱ; ۱; ;;;;(;666666'6 .6?6$D6S6(g69B.?' Q^"""h xψXR`|ZT%f%W%`%l%c%Z%i%]%R%d%U%^%j%a%X%g%[%S%e%V%_%k%b%Y%h%\%Q%P%m%n%p%o%% pathconf(path, name) -> integer Return the configuration limit name for the file or directory path. If there is no limit, return -1.U8U8;ʚ D8&|!J8d;S8# .X8= /a80%f8rD_#o8D8t8k4!z8z38/82!88=l6,E6r@;Lmirrored(unichr) Returns the mirrored property assigned to the Unicode character unichr as integer. Returns 1 if the character has been identified as a "mirrored" character in bidirectional text, 0 otherwise.@release() (release_lock() is an obsolete synonym) Release the lock, allowing another thread that is blocked waiting for the lock to acquire the lock. The lock must be in the locked state, but it needn't be locked by the same thread that unlocks it.divmod(x, y) -> (quotient, remainder) Return the tuple ((x-x%y)/y, x%y). Invariant: div*y + mod == x.dump(value, file[, version]) Write the value on the open file. The value must be a supported type. The file must be an open file object such as sys.stdout or returned by open() or os.popen(). It must be opened in binary mode ('wb' or 'w+b'). If the value has (or contains an object that has) an unsupported type, a ValueError exception is raised — but garbage data will also be written to the file. The object will not be properly read back by load() New in version 2.4: The version argument indicates the data format that dump should use.Return True if two sets have a null intersection.internal error msg too large%s: %s%.200s #define == %d but sizeof(%.200s) == %dtest_list_api: reverse screwed uptest_dict_iteration: dict iteration went wrong hashinheritancetestertest_lazy_hash_inheritance: failed to create objecttest_lazy_hash_inheritance: type initialised too soontest_lazy_hash_inheritance: could not hash objecttest_lazy_hash_inheritance: type not initialised by hash()test_lazy_hash_inheritance: unexpected hash functiontest_broken_memoryview: expected error in bf_getbuffermemoryviewtestertest_broken_memoryview: failed to create objecttest_broken_memoryview: memoryview() didn't raise an Exceptiontest_long_apiunsigned unexpected null resultunsigned unexpected -1 resultunsigned output != inputsigned unexpected null resultsigned unexpected -1 resultsigned output != inputunexpected NULL from PyLong_FromLongunexpected NULL from PyNumber_NegativePyLong_AsUnsignedXXX(-1) didn't complainPyLong_AsUnsignedXXX(-1) raised something other than OverflowErrorunexpected NULL from PyLong_FromLongunexpected NULL from PyNumber_LshiftPyLong_AsUnsignedXXX(2**NBITS) didn't complainPyLong_AsUnsignedXXX(2**NBITS) raised something other than OverflowErrorunexpected NULL from PyNumber_RshiftPyLong_AsXXX(2**(NBITS-1)) didn't complainPyLong_AsXXX(2**(NBITS-1)) raised something other than OverflowErrorunexpected NULL from PyNumber_Negativeunexpected NULL from PyNumber_SubtractPyLong_AsXXX(-2**(NBITS-1)-1) didn't complainPyLong_AsXXX(-2**(NBITS-1)-1) raised something other than OverflowErrortest_longlong_apiunsigned unexpected null resultunsigned unexpected -1 resultunsigned output != inputsigned unexpected null resultsigned unexpected -1 resultsigned output != inputunexpected NULL from PyLong_FromLongunexpected NULL from PyNumber_NegativePyLong_AsUnsignedXXX(-1) didn't complainPyLong_AsUnsignedXXX(-1) raised something other than OverflowErrorunexpected NULL from PyLong_FromLongunexpected NULL from PyNumber_LshiftPyLong_AsUnsignedXXX(2**NBITS) didn't complainPyLong_AsUnsignedXXX(2**NBITS) raised something other than OverflowErrorunexpected NULL from PyNumber_RshiftPyLong_AsXXX(2**(NBITS-1)) didn't complainPyLong_AsXXX(2**(NBITS-1)) raised something other than OverflowErrorunexpected NULL from PyNumber_Negativeunexpected NULL from PyNumber_SubtractPyLong_AsXXX(-2**(NBITS-1)-1) didn't complainPyLong_AsXXX(-2**(NBITS-1)-1) raised something other than OverflowErrorFFFFFFFFFFFFFFFFFFFFFFFFtest_long_and_overflowreturn value was not set to -1test_long_and_overflowoverflow was not set to 1test_long_and_overflowreturn value was not set to -1test_long_and_overflowoverflow was not set to 1-FFFFFFFFFFFFFFFFFFFFFFFFtest_long_and_overflowreturn value was not set to -1test_long_and_overflowoverflow was not set to -1test_long_and_overflowreturn value was not set to -1test_long_and_overflowoverflow was not set to -1FFtest_long_and_overflowexpected return value 0xFFtest_long_and_overflowoverflow was not cleared-FFtest_long_and_overflowexpected return value 0xFFtest_long_and_overflowoverflow was set incorrectlytest_long_and_overflowexpected return value LONG_MAXtest_long_and_overflowoverflow was not clearedtest_long_and_overflowexpected return value LONG_MINtest_long_and_overflowoverflow was not clearedFFFFFFFFFFFFFFFFFFFFFFFFtest_long_long_and_overflowreturn value was not set to -1test_long_long_and_overflowoverflow was not set to 1test_long_long_and_overflowreturn value was not set to -1test_long_long_and_overflowoverflow was not set to 1-FFFFFFFFFFFFFFFFFFFFFFFFtest_long_long_and_overflowreturn value was not set to -1test_long_long_and_overflowoverflow was not set to -1test_long_long_and_overflowreturn value was not set to -1test_long_long_and_overflowoverflow was not set to -1FFtest_long_long_and_overflowexpected return value 0xFFtest_long_long_and_overflowoverflow was not cleared-FFtest_long_long_and_overflowexpected return value 0xFFtest_long_long_and_overflowoverflow was set incorrectlytest_long_long_and_overflowexpected return value PY_LLONG_MAXtest_long_long_and_overflowoverflow was not clearedtest_long_long_and_overflowexpected return value PY_LLONG_MINtest_long_long_and_overflowoverflow was not clearedL:test_L_codetest_L_codeL code returned wrong value for long 42L:test_L_codetest_L_codeL code returned wrong value for int 42i(ii)iiiarg1arg2arg3arg4arg5(ii)i|(i(ii))(iii)iiiiiiiiiiibBhHIkilnLKFFFFFFFFFFFFFFFFFFFFFFFFtest_k_codePyInt_AsUnsignedLongMask() returned wrong value for long 0xFFF...FFFk:test_k_codetest_k_codek code returned wrong value for long 0xFFF...FFF-FFFFFFFF000000000000000042test_k_codePyInt_AsUnsignedLongMask() returned wrong value for long 0xFFF...FFFk:test_k_codetest_k_codek code returned wrong value for long -0xFFF..000042testtestasciiu:test_u_codetest_u_codeu code returned wrong value for u'test'u#:test_u_codetest_u_codeu# code returned wrong values for u'test'􊯍test_widecharwide string and utf8 string have different lengthtest_widecharwide string and utf8 string are differentsu#|s|:test_empty_argparse|:test_empty_argparses|s:test_incrementalencoders|s:test_incrementaldecodertest_long_numbitswrong result for _PyLong_NumBitstest_long_numbitswrong result for _PyLong_SignOi:raise_exceptionan exception class is requiredPyDateTime_CAPI somehow initializeddatetime.datetime_CAPIO:test_thread_state'%s' object is not callableO%d1%d failed at 1%ld1%ld failed at 1%zd1%zd failed at 1%u1%u failed at 1%lu1%lu failed at 1%zu1%zu failed at 1%llu1%llu failed at 1%lld1%lld failed at 1test_string_from_formatcapsule namecapsule pointercapsule contextcontext did not match in destructor!destructor did not match in destructor! (woah!)name did not match in destructor!pointer did not match in destructor!_socket.CAPI_socketCAPI_curses._C_API_curses_C_APIdatetime.datetime_CAPIdatetimedatetime_CAPIdestructor not called!destructor not called!ignoreddestructor not called!the wrong namePyCapsule_GetPointer should have failed but did not!PyCapsule_GetPointer should not have returned the internal pointer!PyCapsule_GetPointer should have returned NULL pointer but did not!destructor called when it should not have been!%s module: "%s" attribute: "%s"PyCapsule_GetPointer returned NULL unexpectedly!weebles wobble but they don't fall down%s module: "%s" attribute: "%s"PyCapsule_GetPointer should have failed but did not!%s module: "%s" attribute: "%s"PyCapsule_GetPointer should not have returned its internal pointer!%s module: "%s" attribute: "%s"PyCapsule_GetPointer should have returned NULL pointer but did not!test_capsuleOO:traceback_printssi:code_newemptynamedocbasedicts|sOO:make_exception_with_docOnraise_exceptiontest_configtest_datetime_capitest_list_apitest_dict_iterationtest_lazy_hash_inheritancetest_broken_memoryviewtest_long_apitest_long_and_overflowtest_long_numbitstest_k_codetest_empty_argparsetest_null_stringstest_string_from_formattest_with_docstringThis is a pretty normal docstring.getargs_tuplegetargs_keywordsgetargs_bgetargs_Bgetargs_hgetargs_Hgetargs_Igetargs_kgetargs_igetargs_lgetargs_ngetargs_Lgetargs_Ktest_longlong_apitest_long_long_and_overflowtest_L_codecodec_incrementalencodercodec_incrementaldecodertest_u_codetest_widecharunicode_encodedecimal_test_thread_state_pending_threadfunctest_capsuletraceback_printcode_newemptymake_exception_with_docsequence_delitemT_BOOLT_BYTET_UBYTET_SHORTT_USHORTT_INTT_UINTT_LONGT_ULONGT_FLOATT_DOUBLET_STRING_INPLACET_LONGLONGT_ULONGLONGT_BOOLT_BYTET_UBYTET_SHORTT_USHORTT_INTT_UINTT_LONGT_ULONGT_FLOATT_DOUBLET_STRING_INPLACET_LONGLONGT_ULONGLONG|bbBhHiIlkfds#LKstring too longtest_structmembersTypeType containing all structmember types_testcapi_test_structmembersTypeCHAR_MAXCHAR_MINUCHAR_MAXSHRT_MAXSHRT_MINUSHRT_MAXINT_MAXINT_MINUINT_MAXLONG_MAXLONG_MINULONG_MAXFLT_MAXFLT_MINDBL_MAXDBL_MINLLONG_MAXLLONG_MINULLONG_MAXPY_SSIZE_T_MAXPY_SSIZE_T_MINSIZEOF_PYGC_HEAD_testcapi.errorerrorrsapuballocrsaprivalloc?w*ܒZ*|7(data, oldcrc = 0) -> newcrc. Compute CRC-32 incrementallytcgetpgrp(fd) -> pgid Return the process group associated with the terminal given by a fd.Thu Jan 01 00:00:00 1970 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/env/timezoneGMTgetpid() -> pid Return the current process idumask(new_mask) -> old_mask Set the current numeric umask and return the previous umask.BZ2Decompressor() -> decompressor object Create a new decompressor object. This object may be used to decompress data sequentially. If you want to decompress data in one shot, use the decompress() function instead. H)-ŝsA46-8m0_?x.__contains__(y) <==> y in x.@cos(x) Return the cosine of x (measured in radians)._multibytecodec__create_codecencoding name must be a string.no such codec is supported.multibytecodec.__map_*getcodecmultibytecodec.__map_*big5cp950extbig5cp950_codecs_tw6 E+6>.eLopen(name[, mode[, buffering]]) -> file object Open a file using the file() type, returns a file object. This is the preferred way to open a file. See file.__doc__ for further information.-DT!?S.encode([encoding[,errors]]) -> object Encodes S using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeEncodeError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that is able to handle UnicodeEncodeErrors.~"!!    RSTUVWXYZ[\^_&2A?JRf'138B@IKSg  " $0*.(469=;CGEPLTXVZ\`^dblpjrnhtxvy}{   !%+/)57:><DHFQMUYW[]a_ecmqksoiuwz~|NNN NNN#N$N(N+N.N/N0N5N@NANDNGNQNZN\NcNhNiNtNuNyNNNNNNNNNNNNNNNNNNNNNNNOOOO O OOOOOO.O1O`O3O5O7O9O;O>O@OBOHOIOKOLOROTOVOXO_OcOjOlOnOqOwOxOyOzO}O~OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPPP P PPPPPPPPPP"P'P.P0P2P3P5P@PAPBPEPFPJPLPNPQPRPSPWPYP_P`PbPcPfPgPjPmPpPqP;PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQQQ Q Q QQPQQQQQQQ#Q'Q(Q,Q-Q/Q1Q3Q4Q5Q8Q9QBQJQOQSQUQWQXQ_QdQfQ~QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRRRRRRRR"R(R1R2R5RSBSLSKSYS[SaScSeSlSmSrSyS~SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTTT!T'T(T*T/T1T4T5TCTDTGTMTOT^TbTdTfTgTiTkTmTnTtTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTUUUU U U UUU*U+U2U5U6U;UW?WEWFWLWMWRWbWeWgWhWkWmWnWoWpWqWsWtWuWwWyWzW{W|W~WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWXXX XW X XXXX X&X'X-X2X9X?XIXLXMXOXPXUX_XaXdXgXhXxX|XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYY Y YYYYAY!Y#Y$Y(Y/Y0Y3Y5Y6Y?YCYFYRYSYYY[Y]Y^Y_YaYcYkYmYoYrYuYvYyY{Y|YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYZZ Z ZZZZZ#Z$Z'Z(Z*Z-Z0ZDZEZGZHZLZPZUZ^ZcZeZgZmZwZzZ{Z~ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ[[[[4[[[[![%[-[8[A[K[L[R[V[^[h[n[o[|[}[~[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[ \\\\#\&\)\+\,\.\0\2\5\6\Y\Z\\\b\c\g\h\i\m\p\t\u\z\{\|\}\\\\\\\\\\\\\\\\\\\\\\\\\\]] ]]+]#]$]&]']1]4]9]=]?]B]C]F]H]U]Q]Y]J]_]`]a]b]d]j]m]p]y]z]~]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]^^ ^^^^^^ ^.^(^2^5^>^K^P^I^Q^V^X^[^\^^^h^j^k^l^m^n^p^^^^^^^^^^^^^^^^^^^^^^^^^^^________!_"_#_$_(_+_,_._0_4_6_;_=_?_@_D_E_G_M_P_T_X_[_`_c_d_g_o_r_t_u_x_z_}_~_________________________________________` ` ```````$`-`3`5`@`G`H`I`L`Q`T`V`W`]`a`g`q`~```````````````````````````````````````````aa a aaaaaaaaaaa"a*a+a0a1a5a6a7a9aAaEaFaIa^a`alaraxa{a|aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbb b"b#b'b)b+b9b=bBbCbDbFbLbPbQbRbTbVbZb\bdbmbobsbzb}bbbbbbbbbbbbbbbbbbbbbbbcc c c ccccc)c*c-c5c6c9cgEgGgHgLgTgUg]gfglgngtgvg{gggggggggggggggggggggggggggggggggggRhhhhh(h'h,h-h/h0h1h3h;h?hDhEhJhLhUhWhXh[hkhnhohphqhrhuhyhzh{h|hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhi i iiiiii1i3i5i8i;iBiEiIiNiWi[icidieifihiiilipiqirizi{iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiijjjjjjjj j$j(j0j2j4j7j;j>j?jEjFjIjJjNjPjQjRjUjVj[jdjgjjjqjsj~jjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjkkkk kkkkkkk$k(k+k,k/k5k6k;k?kFkJkMkRkVkXk]k`kgkkknkpkuk}k~kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkklll l llllll&l'l(l,l.l3l5l6l:l;l?lJlKlMlOlRlTlYl[l\lklmloltlvlxlyl{lllllllllllllllllllllllllllllllllmm mmmmmm&m'm(mgl.m/m1m9mu?u@uCuGuHuNuPuRuWu^u_uauouquyuzu{u|u}u~uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuvvvvvv v vvvvvvvvvvv#v%v&v)v-v2v3v5v8v9v:vwBwEwFwJwMwNwOwRwVwWw\w^w_w`wbwdwgwjwlwpwrwswtwzw}wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxx x xxxx!x"x#x-x.x0x5x7xCxDxGxHxLxNxRx\x^x`xaxcxdxhxjxnxzx~xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxyxxxxxy yyyyyy y%y'y)y-y1y4y5y;y=y?yDyEyFyJyKyOyQyTyXy[y\ygyiykyryyy{y|y~yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzz z z zzzzz!z'z+z-z/z0z4z5z8z9z:zDzEzGzHzLzUzVzYz\z]z_z`zezgzjzmzuzxz~zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{#{'{){*{+{-{.{/{0{1{4{={?{@{A{G{N{U{`{d{f{i{j{m{o{r{s{w{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{||||| | | ||||| |%|&|(|,|1|3|4|6|9|:|F|J|U|Q|R|S|Y|Z|[|\|]|^|a|c|g|i|m|n|p|r|y|||}||||||||||||||||||||||||||||||||}}} }}}}}}}}#}&}*}-}1}<}=}>}@}A}G}H}M}Q}S}W}Y}Z}\}]}e}g}j}p}x}z}{}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~}}}}}}}}}}}~~~~~~~ ~'~(~,~-~/~3~6~?~D~E~G~N~P~R~X~_~a~b~e~k~n~o~s~x~~~~~~~~~~~~~~<;=>?CDGORS[\]acdefmq}~  $&,.04579:<>@D`dfmquȀ̀πҀԀՀ׀؀  $',05:@CEMX]adeoqr{ȇɇʇ·Շևهڇ܇߇ (-.025:@BEFIORWZ[\abcknpsuz{|}ԉՉ։׉؉ "$&+,/57=>@CEGIMNSVWX\]aeguvwyz{~ÊƊȊɊʊъӊԊՊ׊݊ߊ  -07EGIKOQSTWX[]Ycdfhimsuv{~ŌƌɌˌό֌Ռٌ݌ eilnōƍǍȍʍ΍эԍՍ׍ٍ  !"#&'136789=@AKMNOT[\]^abilmopqyz{ÎĎǎώюԎ܎ !#%'(,-.4567:@ACGOQRSTUX]^eƏʏˏ͏ЏҏӏՏ ()/*,-347?CDL[]bfglpty̐ÐĐŐǐȐՐאِؐܐݐߐҐ  %"#')./14679:<=CGHOSWYZ[adgmtyz{‘Ñőӑԑבّڑޑ #$%&(./035689:<>@BCFGJMNOQXY\]`aeghinopuvwxy{|}’ÒŒƒǒȒ˒̒͒ΒВӒՒגْؒܒݒߒ !$%')*3467GHIPQRUWXZ^degijmopqstvz}ēœƓǓɓʓ˓͓̓ӓٓܓޓߓ ./1234;?=CEHJLUY\_achkmnoqrxy~ƕȕɕ˕Еѕҕӕٕڕݕޕߕ"$%&,13789:<=ARTVWXant{|~ʖҖ]ؖږݖޖߖ !"#(13ACJNOUWXZ[cgjnsvwx{}ėŗǗɗʗ̗͗ΗЗїԗחؗٗݗޗۗ   #&+./0235%>DGJQRSVWYZbcefjl˜ŘȘ̘"&'+123459:;<@AFGHMNTXY[\^_`Ùəәԙٙڙܙޙ  "#$'-.3568GADJKLNQTV]ÚƚȚΚКҚ՚֚ךۚܚ  &+-34579:=HKLUVW[^acefhjklmnsuwxyǛțΛЛכ؛ݛߛ "#&'()*1567=ACDEIJNOPSTVX[]^_cij\khnpruw{ /0234: bool Return True if all characters in S are digits and there is at least one character in S, False otherwise.??x){)uJ0@getservbyname(servicename[, protocolname]) -> integer Return a port number from a service name and protocol name. The optional protocol name, if given, should be 'tcp' or 'udp', otherwise any protocol will match.Private method returning an estimate of len(list(it)).H)D$H$#'partial(func, *args, **keywords) - new function with partial application of the given arguments and keywords. null argument to internal routine__length_hint__sequence index must be integer, not '%.200s''%.200s' object has no attribute '__getitem__'sequence index must be integer, not '%.200s''%.200s' object does not support item assignmentsequence index must be integer, not '%.200s''%.200s' object does not support item deletionexpected a character buffer objectexpected a single-segment buffer objectexpected a readable buffer objectexpected a single-segment buffer objectexpected a writeable buffer objectexpected a single-segment buffer object'%100s' does not have the buffer interfaceboth destination and source must have the buffer interfacedestination is too small to receive data from sourceObject is not writable.Bformat expects arg 2 to be string or unicode, not %.100s__format__object.__format__ with a non-empty format string is deprecated__format____format__Type %.100s doesn't define __format__%.100s.__format__ must return string or unicode, not %.100sunsupported operand type(s) for %.100s: '%.100s' and '%.100s'unsupported operand type(s) for ** or pow(): '%.100s' and '%.100s'unsupported operand type(s) for pow(): '%.100s', '%.100s', '%.100s'|^&<<>>-/divmod()+can't multiply sequence by non-int of type '%.200s'*///%** or pow()|=^=&=<<=>>=-=/=//=/=+=*=%=**=**=bad operand type for unary -: '%.200s'bad operand type for unary +: '%.200s'bad operand type for unary ~: '%.200s'bad operand type for abs(): '%.200s'null byte in argument for int()__index__ returned non-(int,long) (type %.200s)'%.200s' object cannot be interpreted as an indexcannot fit '%.200s' into an index-sized integer__int____trunc____int__ returned non-int (type %.200s)__trunc__ returned non-Integral (type %.200s)int() argument must be a string or a number, not '%.200s'null byte in argument for long()__trunc____long__ returned non-long (type %.200s)__trunc__ returned non-Integral (type %.200s)long() argument must be a string or a number, not '%.200s'__float__ returned non-float (type %.200s)PyNumber_ToBase: index not int or long__getitem__object of type '%.200s' has no len()'%.200s' object can't be concatenated'%.200s' object can't be repeated'%.200s' object can't be concatenated'%.200s' object can't be repeated'%.200s' object does not support indexing'%.200s' object is unsliceable'%.200s' object does not support item assignment'%.200s' object doesn't support item deletion'%.200s' object doesn't support slice assignment'%.200s' object doesn't support slice deletionargument of type '%.200s' is not iterablecount exceeds C integer sizeindex exceeds C integer sizesequence.index(x): x not in sequence__getitem__object of type '%.200s' has no len() while calling a Python objectNULL result without error in PyObject_Call'%.200s' object is not callableattribute of type '%.200s' is not callableattribute of type '%.200s' is not callable__bases____class__isinstance() arg 2 must be a class, type, or tuple of classes and types in __instancecheck____instancecheck__ in __instancecheck__issubclass() arg 1 must be a classissubclass() arg 2 must be a class or tuple of classes in __subclasscheck____subclasscheck__ in __subclasscheck__'%.200s' object is not iterableiter() returned non-iterator of type '%.100s'encodingCDATA @H)21@PQLy3w$1A&)XgYW(((;Gsum(sequence[, start]) -> value Returns the sum of a sequence of numbers (NOT strings) plus the value of parameter 'start' (which defaults to 0). When the sequence is empty, returns start.H)I!}OE$3&PR MT.__sizeof__() -- size of T in memory, in bytesinet_aton(string) -> packed 32-bit IP representation Convert an IP address in string format (123.45.67.89) to the 32-bit packed binary format used in low-level network functions.H)0/:O.p3:#-S1: ?s- [H)9B.?xxsubtype is an example module showing how to subtype builtin types from C. test_descr.py in the standard test suite requires it in order to complete. If you don't care about the examples, and don't intend to run the Python test suite, you can recompile Python without Modules/xxsubtype.c.iter(collection) -> iterator iter(callable, sentinel) -> iterator Get an iterator from an object. In the first form, the argument must supply its own iterator, or be a sequence. In the second form, the callable is called until it returns the sentinel.unnamed fieldtuple index out of rangetuple index out of rangestructseq index must be integersequencedictO|O:structseqconstructor requires a sequence%.500s() takes a dict as second arg, if any%.500s() takes an at least %zd-sequence (%zd-sequence given)%.500s() takes an at most %zd-sequence (%zd-sequence given)%.500s() takes a %zd-sequence (%zd-sequence given)...(O(OO))__reduce__f)m)j$%v$H))dJ) a6dx$EPb-:`2 _count() -> integer Return the number of currently running Python threads, excluding the main thread. The returned number comprises all threads created through `start_new_thread()` as well as `threading.Thread`, and not yet finished. This function is meant for internal and specialized purposes only. In most applications `threading.enumerate()` should be used instead.enable() -> None Enable automatic garbage collection. !@@c'#T n'8!T y'4-T 'ln2T ' .T 'x9T '.T 'asin(x) Return the arc sine (measured in radians) of x.Ainterrupt_main() Raise a KeyboardInterrupt in the main thread. A subthread can use this function to interrupt the main thread.™!q/uF4yF4S.splitlines(keepends=False) -> list of strings Return a list of the lines in S, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.^F4bF4gF4numeric(unichr[, default]) Returns the numeric value assigned to the Unicode character unichr as float. If no such value is defined, default is returned, or, if not given, ValueError is raised.. 8o2. |.. D#. |1.b X'. 1. 8-. l".~ >#.f 4x$.3  !$. ?9. ,6.Y $. 3group([group1, ...]) -> str or tuple. Return subgroup(s) of the match by indices or names. For 0 returns the entire match.`(?infinitynanPyOS_ascii_strtod and PyOS_ascii_atof are deprecated. Use PyOS_string_to_double instead.PyOS_string_to_doublecould not convert string to float: %.200scould not convert string to float: %.200svalue too large to convert to float: %.200seE0.0e%+.02d'l%PyOS_ascii_formatd is deprecated, use PyOS_double_to_string insteadinfnaneINFNANEERR../Python/pystrtod.c%+.02d../Python/pystrtod.c../Python/pystrtod.cRemove all elements of another set from this set.close(fd) -> None Close a file descriptor (for low level IO).?X?AmBD.__contains__(k) -> True if D has a key k, else FalseReturn the name of the generator's associated code object."@@Extend the right side of the deque with elements from the iterable =n 415?7c7 index bisect_right(a, x[, lo[, hi]]) -> index Return the index where to insert item x in list a, assuming a is sorted. The return value i is such that all e in a[:i] have e <= x, and all e in a[i:] have e > x. So if x already appears in the list, i points just beyond the rightmost x already there Optional args lo (default 0) and hi (default len(a)) bound the slice of a to be searched. a$o$$ $$$Return a shallow copy of a deque.??@@8@^@@@@&AKAAA2A(;L4BuwsBuwB7Bs6Ch0{CZAC Ƶ;(DlYaRwNDioctl(fd, opt[, arg[, mutate_flag]]) Perform the requested operation on file descriptor fd. The operation is defined by opt and is operating system dependent. Typically these codes are retrieved from the fcntl or termios library modules. The argument arg is optional, and defaults to 0; it may be an int or a buffer containing character data (most likely a string or an array). If the argument is a mutable buffer (such as an array) and if the mutate_flag argument (which is only allowed in this case) is true then the buffer is (in effect) passed to the operating system and changes made by the OS will be reflected in the contents of the buffer after the call has returned. The return value is the integer returned by the ioctl system call. If the argument is a mutable buffer and the mutable_flag argument is not passed or is false, the behavior is as if a string had been passed. This behavior will change in future releases of Python. If the argument is an immutable buffer (most likely a string) then a copy of the buffer is passed to the operating system and the return value is a string of the same length containing whatever the operating system put in the buffer. The length of the arg buffer in this case is not allowed to exceed 1024 bytes. If the arg given is an integer or if none is specified, the result value is an integer corresponding to the return value of the ioctl call in the C code.?turnon_sigfpeturnoff_sigfpeOperation not implemented Operation not implemented Unprotected floating point exceptionfpectlfpectl.errorerror:1u8C1ut6L1uزW/W/T <i[ <v <. < < < < <m1m1m1m1  !"#$%&'()*+,-./01234 #'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ADGJMPRTVXZ\^`behknqtvxz|~  !$'*-0369<?BEHKNQTWZ]`cfilorux{~  #&),/258;>ACFILORUX[^adgjmpsvy|   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfilorux{~  #&),/258;>ADGJMPSVY\_behknqtwz}  "%(+.147:=@CFILORUX[^adgjmpsvy|         ! $ ' * - 0 3 6 9 < ? B E H K N Q T W Z ] ` c f i l o r u x { ~          # & ) , / 2 5 8 ; > A D G J M P S V Y \ _ b e h k n q t w y | ~         ! $ ' * - 0 3 6 9 < ? B E G J M O R U X [ ^ a d g j l o q t w z }           # & ) , / 2 7 9 ; = ? A C E G I K M O Q S U W Y [ ] _ a c e g i k m o q s u w y { }        " & * . 2 6 : > A C F J M O R V [ ^ ` c g i k m o q t x { }   !$'*-03579;=?ACEGILORUX[^adgjnrvz~  $(,048<@DHLPTX\`dhlptvxz|~   !#%')+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuwy{}   !#%')+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuwy{}  #&),/258;>ADGJMPSVY\_behkmoqsuwy{}   !#%')+-/13579;=?ACGKOSW[_cgkosw{  !%)-159=AEIMQUY]aegikmqtwz}   "$&(*,.02468:<>@BDFHJLNPRTWZ]`cfilorux{~  #',04:?CGKPUY]`dinqw~ "&+/26:>CGKOUZ]cfkptx| "'*-0369<?CHKNQTWZ]aeimpsvy| "%(+.147:=ADGKORW[^adgkorux{~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|~   "$&(*,.02468:<>@BDFHJLNPRTVXZ\^`bdfhjlnprtvxz|  !#%')+-/13579;=?ACEGIKMOQSUWY[]_acegikmoqsuwy{}    #&),/258;>ADGIKMORUX[^adgjmpsvy|         ! $ ' * - 0 3 6 9 < ? B E H K N Q T W Z ] ` c f i m q u y } !!! !!!!!!! !#!&!)!,!/!2!5!8!;!>!A!D!G!J!M!P!S!V!Y!\!_!b!e!h!k!n!q!t!w!z!}!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!""" " """""""""%"("+"/"3"7":"="@"C"F"I"L"O"R"U"X"["^"a"d"g"j"m"p"s"v"y"|""""""""""""""""""""""""""""""""""""""""""""### # ######"#&#*#.#2#6#:#>#B#F#J#N#R#V#Z#^#b#f#j#n#r#v#z#~#################################$$ $$$$$$"$&$*$.$2$6$:$>$B$F$J$N$R$V$Z$^$b$f$j$n$r$v$z$~$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$%% %%%%,%5%:%<%>%@%B%D%F%H%J%L%N%P%R%T%V%X%Z%\%^%`%b%d%f%h%j%l%n%p%r%t%v%x%z%|%~%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%&&&&& & &&&&&&&&&& &"&$&&&(&*&,&.&0&2&4&6&8&:&<&>&@&B&D&F&H&J&L&N&P&R&T&V&X&Z&\&^&`&b&d&f&h&j&l&n&p&r&t&v&x&z&|&~&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&''''' ' '''''''''' '"'$'&'('*','.'0'2'4'6'8':'<'>'@'B'D'F'H'J'L'N'P'R'T'V'X'Z'\'^'`'b'd'f'h'j'l'n'p'r't'v'x'z'|'~'''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''((((( ( (((((((((( ("($(&(((*(,(.(0(2(4(6(8(:(<(>(@(B(D(F(H(J(L(N(P(R(T(V(X(Z(\(^(`(b(d(f(h(j(l(n(p(r(t(v(x(z(|(~((((((((((((((((((((((((((((((((((((((((((((((((((((((((())))) ) )))))))))) )")$)&)()*),).)0)2)4)6)8):)<)>)@)B)D)F)H)J)L)N)P)R)T)V)X)Z)\)^)`)b)d)f)h)j)l)n)p)r)t)v)x)z)|)~)))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))))***** * ********** *"*$*&*(***,*.*0*2*4*6*8*:*<*>*@*B*D*F*H*J*L*N*P*R*T*V*X*Z*\*^*`*b*d*f*h*j*l*n*p*r*t*v*x*z*|*~*****************************************************************+++++ + ++++++++++ +"+$+&+(+*+,+.+0+2+4+6+8+:+<+>+@+B+D+F+H+J+L+N+P+R+T+V+X+Z+\+^+`+b+d+f+h+j+l+n+p+r+t+v+x+z+|+~+++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++,,,,, , ,,,,,,,,,, ,",$,&,(,*,,,.,0,2,4,6,8,:,<,>,@,B,D,F,H,J,L,N,P,R,T,V,X,Z,\,^,`,b,d,f,h,j,l,n,p,r,t,v,x,z,|,~,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,----- - ---------- -"-$-&-(-*-,-.-0-2-4-6-8-:-<->-@-B-D-F-H-J-L-N-P-R-T-V-X-Z-\-^-`-b-d-f-h-j-l-n-p-r-t-v-x-z-|-~-----------------------------------------------------------------..... . .......... .".$.&.(.*.,...0.2.4.6.8.:.<.>.@.B.D.F.H.J.L.N.P.R.T.V.X.Z.\.^.`.b.d.f.h.j.l.n.p.r.t.v.x.z.|.~.................................................................///// / ////////// /"/$/&/(/*/,/./0/2/4/6/8/://@/B/D/F/H/J/L/N/P/R/T/V/X/Z/\/^/`/b/d/f/h/j/l/n/p/r/t/v/x/z/|/~/////////////////////////////////////////////////////////////////00000 0 0000000000 0"0$0&0(0*0,0.00020406080:0<0>0@0B0D0F0H0J0L0N0P0R0T0V0X0Z0\0^0`0b0d0f0h0j0l0n0p0r0t0v0x0z0|0~00000000000000000000000000000000000000000000011 1 11111!1%1)1-111315181;1=1?1A1C1E1H1K1N1Q1U1X1[1]1_1a1c1e1g1i1k1m1o1q1s1u1w1y1{1}1111111111111111111111111111111111111111111111111111111112222 2 2 2222222222!2#2%2'2)2+2-2/21232527292;2=2?2A2C2E2G2I2K2M2O2Q2S2U2W2Y2[2]2_2a2c2e2g2i2k2m2o2q2s2u2w2y2{2}2222222222222222222222222222222222222222222222222222222222222222223333 3 3 3333333333!3#3%3'3)3+3-3/31333537393;3=3?3A3C3E3G3I3K3M3O3Q3S3U3W3Y3[3]3_3a3c3e3g3i3k3m3o3q3s3u3w3y3{3}3333333333333333333333333333333333333333333333333333333333333333334444 4 4 4444444444!4#4%4'4)4+4-4/41434547494;4=4?4A4C4E4G4I4K4M4O4Q4S4U4W4Y4[4]4_4a4c4e4g4i4k4m4o4q4s4u4w4y4{4}4444444444444444444444444444444444444444444444444444444444444444445555 5 5 5555555555!5#5%5'5)5+5-5/51535557595;5=5?5A5C5E5G5I5K5M5O5Q5S5U5W5Y5[5]5_5a5c5e5g5i5k5m5o5q5s5u5w5y5{5}55555555555555555555555555555555555555555555555555555555555555555getaddrinfo(host, port [, family, socktype, proto, flags]) -> list of (family, socktype, proto, canonname, sockaddr) Resolve host and port into addrinfo struct. deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly __exit__(*excinfo) -> None. Closes the file.F4mmF4EG4;nKG4G4doG4H4oH4SH4[H47L48eAL40@@C=ST=L= O= OU=CN=H E=B.__sizeof__() -> int Returns the size of B in memory, in bytes("*",""ؘ">>ژ"Gs4"6"P""ss"NN"nʛ"VV̛"__Λ"7""LaJ"# "G"w\""""""""""d|i:acquirerelease unlocked lockacquire_lockacquirerelease_lockreleaselocked_locklocked__enter____exit__thread.lockcan't allocate lock_thread._localdummyThread-local dummyCouldn't get thread-state dictionary_localdummy_destroyedInitialization arguments are not supportedthread.local.%pCouldn't get thread-state dictionary'%.50s' object attribute '__dict__' is read-onlythread._localThread-local dataUnhandled exception in thread started by stderr start_new_threadfirst arg must be callable2nd arg must be a tupleoptional 3rd arg must be a dictionarycan't start new threadno current thread ident|n:stack_sizesize must be 0 or a positive valuesize not valid: %zd bytessetting stack size not supportedstart_new_threadstart_newallocate_lockallocateexit_threadexitinterrupt_mainget_ident_countstack_sizethreadthread.errorerrorLockType_local__dict__&-$1$1;$1$1H$11.2.3incorrect header checkunknown compression methodinvalid window sizeunknown compression methodunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checkseek(offset [, whence]) -> None Move to new file position. Argument offset is a byte count. Optional argument whence defaults to 0 (offset from start of file, offset should be >= 0); other values are 1 (move relative to current position, positive or negative), and 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file). Note that seeking of bz2 files is emulated, and depending on the parameters the operation may be extremely slow. /proc/%d/noteid%dcapitalize(s) -> string Return a copy of the string s with only its first character capitalized.n_fieldsB.swapcase() -> copy of B Return a copy of B with uppercase ASCII characters converted to lowercase ASCII and vice versa.))$/0>compress(string[, level]) -- Returned compressed string. Optional arg level is the compression level, in 0-9.vI@Update a set with the intersection of itself and another.Add an element to the right side of the deque.k-%8;''?6$u6 ' :      !"#$%&'!"#$%&'()*+ ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, -./0-111233333acos(x) Return the arc cosine (measured in radians) of x.!f2xIMPLIED )HHw1-)$2)H#=) ?0J)S1U)g3^)O`m-i)=l3t)c"%)(k-)- "'),4>DQ]flqy &./5;CIOTZ`hoqtx3 '08@EMX\cflptuz~B $-6;?FNRVY^cgoarwz "(25o9>DHMSX[bdfnx{~R "(-16;@DINSX\bkosx} #). "',28=AFKPUYaejoty}27<AEJO TY &,28>DJOU[agmsy  #(,159>BEIW[_bgkosx}    ! % ) - 2 7 < @ C G N U [ ` e k q v y {    " + 0 4 9 > B N U [ a h n q x |      # ' , 0 5 ; @ D Q H M S X \ a f j p u {  P       # 0 4 8 < @ D G K O T X ] b g k n q w {        $ ( 2 6 : ? D N $S W Z ` g k mo v } - + 2 #(. 3? FIMPTbfimrvz:l #(-38>CHMSX]bgmrx}X !%-6<ADHLV`hov|%4CRap$3BQ`o~#2AP_n} 2"&)/3;AFMTZ_flpu  "',17=CIOU[agmsy~ &,28>(CGKNUX`ejaobsy\t  ,ty7~;?HQW\`fkrv 9    %+1469AIQTYl\^chmrw| $*05:?DINT\`eimqvz)5AMZgnt{ "'+T19BFLQV[af|kou{G!( MRW\b  g%7(06<EJP_p  *3=KZckpt} $,3>BEKOU\ahov}l #(047=DHKPTZbhmsx|    " ' {, / 4 8 m> B H N S Y ^ pd j o t | v !| ! !!!'!2!9!?!H!P!W!]!c!h!l!q!w!~!!!!!!!!!!!!!!!!!!!!!"""""$"("/"5"H<" C"H"L"R"]"g"p"|"""""""""""""""""""""""####"#)#/#5#8#?#N#^#m#r#z#########################$$ $$$$$"$&$-$3$;$A$K$P$U$Y$a$9i$n$r$v$y$$$$$$$$$$$$$$$$$$$$$$$$$%% %%%%%$%)%.%3%8%=%C%H%M%R%W%\%b%g%l%r%w%}%%%%%%%%%%%%%%%%%%%%%%%%%%%&& &&&(&/&6&?&H&Q&Z&c&l&v&&&&&&&&&&&&&&' '''('2';'E'O'Y'c'm'w''''''''''''''( (((((!(((.(3(7(<(@(D(J(O(X(](`(f(n(u(y(}(((((((((((((((((() )))))')+).)5)?)H)O)S)Y)^)c)g)p)u){))))))))))))))))**** *$*&*+*1*9*@*I*R*[*d*m*v****************+++!+*+3+8+<+B+H+O+T+Y+`+e+j+n+t+|+++++++++++++++++++,, ,,,,,$,),.,3,8,<,A,F,K,Q,W,\,`,e,j,o,t,y,~,,,,,,,,,,--$-/-:-F-Q-\-m-x--- ----------------H#-. ....&.-.3.<.D.K.S.Y.`.h.m., t.w.*,{........./,4,............d // /// /&/+///5/:/=/D/J/P/U/\/b/g/n/r/x///////////////////////0 000!0+040<0C0M0W0_0b0B,g0G,,o0|000,0000000111 &1*121=1D1J1R1V1\1_1i1q1x1111111111111111L,R,X,1111X1111112 22222#2)2.23292>2C2H2N2S2X2^2d2i2p2w2|2222222222222222233!323D3Q3W3\3a3g3l3q3u3y3~33333333333333333333333334 444 4'4.444:4?4D4J4O4U4Z4`4f4m4s4x4}44444444444444444444445 555"5)5/54585>5C5H5M5 Q5U5Y5]5a5d5k5s5f,z55555555((555555555k,6666$6)626:6F6P6Z6d6m6y6666666666666 77 7,787D7P7\7h7t777777777777888&828>8J8V8b8n8z888888888888 99!9,989D9P9\9h9t999999999999:::':2:>:J:V:b:o:|::::::::::: ;;$;1;>;K;W;d;q;~;;;;;;;;;;; <<&<3<@<M<Z<g<s<<<<<<<<<<<===(=5=B=O=\=i=v===========>>>(>5>B>O>\>i>v>>>>>>>>>>>???+?8?D?Q?^?k?x???????????@@ @-@:@G@T@`@m@z@@@@@@@@@@@AA"A/ABKBXBeBrBBBBBBBBBBBC CC&C1C9C@CFCJCPCVC^CdCiC]mCtC|CCC!!CCCCCCCCCCCCCCCCCD DDD"D)D-D2D8D@DDDu,MDSDWD]DdDoDwD}DDDDDDDDDDDDDDDDDDDDDEEEEE EN$E*E1E:E?EGESEXE\E_EeEkEpEtEwEEE!Eh&EEEEEEEEEEEEEEEEEEEEEEF FFFFF"F'F,F1F6FGBGFGKGOGRG_GdGmGFrGuG- 2 yGGGGGGGGGGGGGGGGGGGGGGGGGGGHH G HHFH$HG+H0HG8H=HBHGHKHPHSHWH]HbHfHlHrHwH{HHHHHHHHHHHH-I0HHHHHHHHHII!I/I9IEIKIZIrIIIIIIIIIJJ&J:JLJXJfJtJJJJJJJJ-JKK K%K*K/K5K:K >KDKHKKKOKWK]KGaKlKrKxKKKKKKKKKKKKKKK]KKL LL!L)L0L6L;LG?LHLLLQLZLbLlLuL{LLGGLLL-LLLLLLLLLLM M MMMM M(MH,M2M8M=MBMFMNMTMZM bMgMlMpMtM{MMMMMMMMMMMMMMMMMMMMMMMMMMNN NNNN N%N+N0N5N:N?NDNINONTNYN^NcNhNmNrNxN~NNNNNNNNNNNNNNNNNNNNNNNNNNNNNO O OOOO$O)O.O2O6OBOKOTOZO^ObOlOuO}OOOOOOOOOOOOOOOOOOOOOOPP P PPPPPP$P(P,P0P5P:P?PCPFPKPQPVP\PaPePiPmPrPvP{PPPPPPPPPPPPPPPPPPPPPPPPPPPQmQ Q QQQQQ!Q$Q)Q.Q2Q5Q:Q>QCQGQ-LQOQRQVQZQcQjQoQvQzQ~QQQQQQQQQQQQQQQfQQRR RRR!R0RYEYKYVYhYoYwY{YYYYYYYYYYYwYYZZZZ#Z+Z0Z4Z7Z:ZBZJZSZ]ZfZlZzZ ZZZZZZZZZZZZZ[[[ [)[0[8[?[H[L[T[[[b[m[|[[[[[.+[[[[[[[[[=L[[[[[[[[\\ \\\\ \)\0\5\9\?\WD\M\U\^\f\q\z\\\\\\-\\\\\\\\\\\\\\\] ]]" ]](]3];]B]K]S]Z]a]n]y]]]]]; ]]P]]]] ]]]]< ]]]]]^^ ^^T^j^^%^*^1^7^;^?^B^E^L^R^DHW^h w3[^^^f^i^s^^^^^^^^^^^^^^^^^^^^^^^^^__ _____%_+_1_6_;_@_F_K_P_U_[_`_f_k_p_u_z__________________________` ````!`'`,`2`7`<`A`F`L`H Q`O V W V`\ f \```e`j`p`u`z`~``````````````````````````aa aaaaa$a)a.a2a7acBcGcLcPcUcZc_ccchcmcrcvczc/~cccccccccccccccccmHsHcccc dddd!dSCD)d-d2d8d=dCdHdNdSdV WdZd`dfdldsdyddddddddddddddddddddddddee eeee!e'e+e0e5e:e?eCeHeMeReXe^edeiemereve~e eeXeeeaeeeeeeeeeeeeeeef fff f-f;fFfRf^flfyfff)-ffffffWfffffffffWk0fffff3dfgg9d ggg>dg#g)gDd.g3g9g>gCgIgOgXZTgXg]gbgggogsgxg}gggggIdOdg gggggggggggggggggggh hh{$h h%h+h0h 5h:h?hDhIhHNhShXh]hchhhlhqhvh{hhhhh H hhhhhhhhhhhhhhhhhhhhhhii iiii!i%i+i/i6i3mAmEmImLmRm\mamgmkmpm}mfTmmJ6emmmmmmmmmmmmmmmmmJ nn(n4nBnJJNnZn hnmnrnvn}nnnnnDGnnnnnnnnnnnnnnnnnnnnnno ooooo$o)o.o3o7o:o@oDoLoSo[oeokoqouo~ooodooooooooooooooooooop] pppp$p)p/p3p:p@psTIpNpVp^pepipmpqpvpzp~ppppDpppppppppppppppppppJ)pq qqq$q+q2q9q@qGqLqRqcqkqsqzq|~qqlqqqqqqq\ /qqqqqqqqqqr rHGrrr(r1rwDwIwPwWw[wewrw{wwwwwwwwwwwww3wwwZwb\wwwwx xxxxxW[#x,x2x7x;xCxTIxPxVx[x`xdxjxoxux|xxx/xqxxxxxxxxxxxxxxxxxxy3dd yddddyddyy$y+y/y3y;y?yDyHyOyTyXy]ycyhynysywy{yyyyyyyyyyyyyy//yyyyyyyyyyyyyzz zzzzU)#z'z*z.z2z5z9ze)M\kzŅԅ.=L[jyĆӆ-<KZixÇ҇,;JYhwˆш +:IXgvЉ߉ *9HWfuϊފ )8GVet΋݋ (7FUds͌܌ '6ETcr̍ۍ&5DSbqˎڎ%4CRapʏُ$3BQ`o~ɐؐ#2AP_n}ȑב"1@O^m|ǒ֒!0?N]l{ƓՓ />M\kzŔԔ.=L[jyĕӕ-<KZixÖҖ,;JYhw—ї +:IXgvИߘ *9HWfuϙޙ )8GVetΚݚ (7FUds͛ܛ '6ETcr̜ۜ&5DSbq˝ڝ%4CRapʞٞ$3BQ`o~ɟ؟#2AP_n}Ƞנ"1@O^m|ǡ֡!0?N]l{Ƣբ!1AQaqѣ!1AQaqѤ!1AQaqѥ!1AQaqѦ!1AQaqѧ!1AQaqѨ!1AQaqѩ!1AQaqѪ!1AQaqѫ!1AQaqѬ!1AQaqѭ!1AQaqѮ!1AQaqѯ!1AQaqѰ!1AQaqѱ!1AQaqѲ!1AQaqѳ!1AQaqѴ!1AQaqѵ!1AQaqѶ!1AQaqѷ!1AQaqѸ!1AQaqѹ!1AQaqѺ!1AQaqѻ!1AQaqѼ!1AQaqѽ!1AQaqѾ!1AQaqѿ!1AQaq!1AQaq!1AQaq!1AQaq!1AQaq '/.54<XWBGLQV\aglrw| P( ? *5BIOTZ`fkpuz~O Z _ -39} d >22!(-12Bov4>BG|G MYj{%6GXiz$5FWhy#4EVgxLQY!V !  &,27;@EINSX\aglquz<^  %*06;?DIMRW\bhmqv{e33m!r!  b|#'3,/7f!!k?FKT^eplq@4uzV4u cc~4z~ $,3<DMQX4`fns"| "%" &}   $(f-27;>BFKOTXnnn[bh<|rnnffnfw|}kl0* +cr=BIOT\YIbhnsfPfwf4dygQ %*.37;AGLPgU$g*gZ`eiEdo3lpu| /g#(-:g27<BH?gMRWJgPg\afkYZUgYgpStz ^gDLKg oo oooo$ o/2>FtgJS]fygkr{igLqttGMSY^eksz3&+ MT{"&-6>DIMRV[dhov~ $*/49>CHMSX^chmrw| $*v/27;>HOXblt|K ?5xY !!!*4UW=C)4IM^"SZ+`lpvYz"? %V \ V &19?"DLPTZ`jpvA g+v '/ 7BFRPZX]ahnv}T)W4y Z/G. 3L]LU. % -/49>DINSX]bhmrw|  $)-27=BFJMOSV[_cgkthw!h&h~,h1h:#  %-6h4>GTY^dkv $+3<DMW`hq{ )3<DMW`ju  (1;DNYclt} '0:EOXbmw%2>IS\dks|%/8BMWbny#,6AKVbmw (2=GR^is|#,6AKVbmw%1>JWer~@hEhCzx t"%'+/318<?DHOUY]Oh`gpxTh  T6$,2Yh7#>AIVcp}6; $^h*17dh<?CKT0\dks}EgE $(,4<mhBHTZ_jt~rh!mM$)-16<GTYwh^js #(-17<EJOTY]dj%5,5o=qht}hh &.49k@GMRX_ekgXkpv^e5gD})"',16;@EJOUZ_ejou{ !&+06;@EJOTY^chmrw|6 !C&*.19>EKQV^ejoswz`&*.4<HT[_jry&07?HPZcnz %/5:@FKR-h6X]djosvy{ "+/:Dq6OW}6^FXbfk|C%*16;CHNSX\_q "',15=#FKQ#VY^hqv~4^ 0@Qdmw~W/   #',3<BIMT]bjsy~9} D"',17?HLRaWY^chmrw|<Chhhhhh $(-1h5h=@hGIMRhUZjStS_chns|hV6pr %,2:CJPhSZ`dgo}hho5Ehi=3hh%.49?hDMV]ciquhxhh}ic   p%(-16;?G}SSMSY^beotzoo  "(.37<AEJOTXi`dlYHw}fi}#)-08?DQX]belpzpDu "',16:?DHMRW\afkpuz !%).37<AEJOTY]bgkptx|  $(,048<@DHLPTY^bfjnrv{ !%)-15:>CGLPUY_dhmqvz hF '    w#! & / 9 > B G N T ` K-j p ~            p  L(    g      * 3 > E K U ] c r x }           2  -          ! ) 2 : }-B G K W ^ g q  z ~               k"    # P$* 5 > F O W g r        DV        ]f       & 3 28 = G M Q V Z  f n y             E          x̃ ,49? 'dDLSXafkry Z "&/3>BFHw PUYbhY 65lyg $'+k /sD 3q 7AGMSY_ekqw} U1$#(-27<AFKPUZ_dinsx}BHNTZ`flrx~  $).strip(s) -> string Return a copy of the string s with leading and trailing whitespace removed.S.title() -> unicode Return a titlecased version of S, i.e. words start with title case characters, all remaining cased characters have lower case.Asu-(qE=q96;:qo__complex____complex____complex__ should return a complex object()%s%s%sj%scomplex_addcomplex_subcomplex_mulcomplex_divcomplex division by zeroclassic complex divisioncomplex_classic_divcomplex division by zerocomplex divmod(), // and % are deprecatedcomplex remaindercomplex divmod(), // and % are deprecatedcomplex divmod()complex modulocomplex_pow0.0 to a negative or complex powercomplex exponentiationcomplex divmod(), // and % are deprecatedcomplex_absabsolute value too largeno ordering relation is defined for complex numberscan't convert complex to intcan't convert complex to longcan't convert complex to float(dd)O:__format____format__ requires str or unicodeconjugate__getnewargs____format__realthe real part of a complex numberimagthe imaginary part of a complex numbercomplex() arg is not a stringcomplex() arg is a malformed stringrealimag|OO:complexcomplex() can't take second arg if first is a stringcomplex() second arg can't be a stringcomplex() argument must be a string or a numberfloat(r) didn't return a floatcomplex))L.pop([index]) -> item -- remove and return item at index (default last). Raises IndexError if list is empty or index is out of range.Find the n largest elements in a dataset. Equivalent to: sorted(iterable, reverse=True)[:n] 1@$@B.count(sub [,start [,end]]) -> int Return the number of non-overlapping occurrences of subsection sub in bytes B[start:end]. Optional arguments start and end are interpreted as in slice notation.)))instance(class[, dict]) Create an instance without calling its __init__() method. The class must be a classic class. If present, dict must be a dictionary or None.npp pt tt t t tT8a 6T8 ).T8 0!T8F $7T8{ ` $T8& T/U8jO  - U8O  ^8U8O 0%U8ȕ 7U8 DU8U PU8 [U8N eU8 sU8ۙ U8̗ Report whether another set contains this set.b2a_hex(data) -> s; Hexadecimal representation of binary data. This function is also available as "hexlify()".=4y =4>4>4C>4L>4B.center(width[, fillchar]) -> copy of B Return B centered in a string of length width. Padding is done using the specified fill character (default is a space).asinh(x) Return the hyperbolic arc sine of x.0K00M00O00Q00S0000000000000000001TTYYZZend([group=0]) -> int. Return index of the end of the substring matched by group.)*nameglobalslocalsfromlistlevels|OOOi:__import__apply() not supported in 3.x; use func(*args, **kwargs)applyapply() arg 2 expected sequence, found %sapply() arg 3 expected dictionary, found %sfilterO|O:formatl:chrchr() arg not in range(256)i:unichrcmpcoerce() not supported in 3.xcoercesourcefilenamemodeflagsdont_inheritOss|ii:compilecompile(): unrecognised flagsexecevalsinglecompile() arg 3 must be 'exec', 'eval' or 'single'compile() expected string without null bytesdirdivmodevallocals must be a mappingglobals must be a real dict; try eval(expr, {}, mapping)globals must be a dicteval must be given globals and locals when called without a frame__builtins____builtins__code object passed to eval() may not contain free variableseval() arg 1 must be a string or code objectexecfile() not supported in 3.x; use exec()s|O!O:execfilelocals must be a mapping__builtins____builtins__rbgetattrgetattr(): attribute name must be stringhasattrhasattr(): attribute name must be stringmap() requires at least two argsmap(None, ...) not supported in 3.x; use list(...)next%.200s object is not an iteratorsetattrdelattrhex() argument can't be converted to hex__hex__ returned non-string (type %.200s)s;embedded '\0' in input line__builtins____builtins__S:interncan't intern subclass of stringiteriter(v, w): v must be callableminmaxkey%s() got an unexpected keyword argument%s() arg is an empty sequenceoct() argument can't be converted to oct__oct__ returned non-string (type %.200s)ord() expected string of length 1, but %.200s foundord() expected a character, but string of length %zd foundpowsependfile |OOO:printstdoutsep must be None, str or unicode, not %.200send must be None, str or unicode, not %.200srange() integer %s argument expected, got %s.__int__ should return int objectrangeendstartsteprange() step argument must not be zerorange() result has too many itemsl;range() requires 1-3 int argumentsll|l;range() requires 1-3 int argumentsrange() step argument must not be zerorange() result has too many itemsstdinstdout[raw_]input[raw_]input: lost sys.stdin[raw_]input: lost sys.stdout [raw_]input: input too longreduce() not supported in 3.x; use functools.reduce()functoolsreduceIn 3.x, reload() is renamed to imp.reload()numberndigitsd|O:rounditerablecmpkeyreverseO|OOi:sortedsortvarsvars(): no locals!?__dict__vars() argument must have __dict__ attributesumsum() can't sum strings [use ''.join(seq) instead]addaddisinstanceissubclasszip argument #%zd must support iteration__import__absallanyapplybincallablechrcmpcoercecompiledelattrdirdivmodevalexecfilefilterformatgetattrglobalshasattrhashhexidinputinternisinstanceissubclassiterlenlocalsmapmaxminnextoctopenordpowprintrangeraw_inputreducereloadreprroundsetattrsortedsumunichrvarszip__builtin__NoneEllipsisNotImplementedFalseTruebasestringboolmemoryviewbytearraybytesbufferclassmethodcomplexdictenumeratefilefloatfrozensetpropertyintlistlongobjectreversedsetslicestaticmethodstrsupertupletypexrangeunicode__debug__filter(): unsubscriptable tuplecan't filter str to str: __getitem__ returned different typecan't filter unicode to unicode: __getitem__ returned different typedate(year, month, day) --> date object[StringIO([s]) -- Return a StringIO-like stream for reading or writing@2@-'VA3;0123456789abcdef̜?QH)p/ ZW[[A<\n\4"XH8^H8hH8oH8zH8H8sys.long_info A struct sequence that holds information about Python's internal representation of integers. The attributes are read only."L +8.?r"Klo must be non-negativeaxlohiOO|nn:bisect_rightaxlohiOO|nn:insort_rightinsertnOlo must be non-negativeaxlohiOO|nn:bisect_leftaxlohiOO|nn:insort_leftinsertnObisect_rightbisectinsort_rightinsortbisect_leftinsort_left_bisect,[97[9D[9O[9^[9 p[9[9[9 [9[9[9 dict() -> new empty dictionary dict(mapping) -> new dictionary initialized from a mapping object's (key, value) pairs dict(iterable) -> new dictionary initialized as if via: d = {} for k, v in iterable: d[k] = v dict(**kwargs) -> new dictionary initialized with the name=value pairs in the keyword argument list. For example: dict(one=1, two=2)settimeout(timeout) Set a timeout on socket operations. 'timeout' can be a float, giving in seconds, or None. Setting a timeout of None disables the timeout feature and is equivalent to setblocking(1). Setting a timeout of zero is the same as setblocking(0).H))getfilesystemencoding() -> string Return the encoding used to convert Unicode filenames in operating system filenames.F)K)S)(WS.partition(sep) -> (head, sep, tail) Search for the separator sep in S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return S and two empty strings.h@0@Al@0@Ep@0@"<u@0@6|@0@ Y7@00N0@0@41@@3@&@="B"H".? U'0@input([prompt]) -> value Equivalent to eval(raw_input(prompt)).H)8͂R< 3 34343 H3H3 B.rsplit(sep[, maxsplit]) -> list of bytearray Return a list of the sections in B, using sep as the delimiter, starting at the end of B and working to the front. If sep is not given, B is split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). If maxsplit is given, at most maxsplit splits are done.statvfs_result: Result from statvfs or fstatvfs. This object may be accessed either as a tuple of (bsize, frsize, blocks, bfree, bavail, files, ffree, favail, flag, namemax), or via the attributes f_bsize, f_frsize, f_blocks, f_bfree, and so on. See os.statvfs for more information.S.expandtabs([tabsize]) -> unicode Return a copy of S where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.close(): explicitly release resources held.isiisis%sililiithe pure module has been removed in Python 3.0purePURIFY_VERSIONQUANTIFY_VERSIONThis module provides various functions to manipulate time values. There are two standard representations of time. One is the number of seconds since the Epoch, in UTC (a.k.a. GMT). It may be an integer or a floating point number (to represent fractions of seconds). The Epoch is system-defined; on Unix, it is generally January 1st, 1970. The actual value can be retrieved by calling gmtime(0). The other representation is a tuple of 9 integers giving local time. The tuple items are: year (four digits, e.g. 1998) month (1-12) day (1-31) hours (0-23) minutes (0-59) seconds (0-59) weekday (0-6, Monday is 0) Julian day (day in the year, 1-366) DST (Daylight Savings Time) flag (-1, 0 or 1) If the DST flag is 0, the time is given in the regular time zone; if it is 1, the time is given in the DST time zone; if it is -1, mktime() should guess based on the date and time. Variables: timezone -- difference in seconds between UTC and local standard time altzone -- difference in seconds between UTC and local DST time daylight -- whether local time should reflect DST tzname -- tuple of (standard time zone name, DST time zone name) Functions: time() -- return current time in seconds since the Epoch as a float clock() -- return CPU time since process start as a float sleep() -- delay for a number of seconds given as a float gmtime() -- convert seconds since Epoch to UTC tuple localtime() -- convert seconds since Epoch to local time tuple asctime() -- convert time tuple to string ctime() -- convert time in seconds to string mktime() -- convert local time tuple to seconds since Epoch strftime() -- convert time tuple to string according to format specification strptime() -- parse string to time tuple according to format specification tzset() -- change the local timezoneatan2(y, x) Return the arc tangent (measured in radians) of y/x. Unlike atan(y/x), the signs of both x and y are considered.Z!3Eܡ$ =mpsetminbits: n < 0mpsetminbits: n < 0mpnew: %rmpnew: %rmpbits: %rfreeing mp constantΟ$C/dev/userS.count(sub[, start[, end]]) -> int Return the number of non-overlapping occurrences of substring sub in Unicode string S[start:end]. Optional arguments start and end are interpreted as in slice notation.getlogin() -> string Return the actual login name./dev/randomcan't open /dev/randomcan't read /dev/random!7 ! !z !m !ޙ FIXED!$pE<3pp:otruncate([size]) -> int. Truncate the file to at most size bytes. Size defaults to the current file position, as returned by tell(). The current file position is unchanged. Returns the new size. Return current stream position.44I.decode(string[, errors]) -> (unicodeobject, length consumed) Decodes `string' using I, an MultibyteCodec instance. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle UnicodeDecodeErrors.enumerate(iterable[, start]) -> iterator for index, value of iterable Return an enumerate object. iterable must be another object that supports iteration. The enumerate object yields pairs containing a count (from start, which defaults to zero) and a value yielded by the iterable argument. enumerate is useful for obtaining an indexed list: (0, seq[0]), (1, seq[1]), (2, seq[2]), ...alarm(seconds) Arrange for SIGALRM to arrive after the given number of seconds.EMPTYA@4@181818182828628J28T28^28:getstatei:setstategetstategetstate() -> statesetstatesetstate(state)classmethclassmeth(*args, **kw)staticmethstaticmeth(*args, **kw)statean int variable for demonstration purposesxxsubtype.spamlist:getstatei:setstategetstategetstate() -> statesetstatesetstate(state)statean int variable for demonstration purposesxxsubtype.spamdictOS|ibenchxxsubtypespamlistspamdict~"0ps.4bA|))rstrip(s) -> string Return a copy of the string s with trailing whitespace removed._4/}`4!~Va4+va4+H*b49~b4B~0c4A|c4!~dd4!~ e4!~e4!~f4!~Tg4!~h4!~h4U~ i4'~i4!~j4!~Hk4!~l4!}l4!~zm4!~6n4!~n4!~o4!~jp4!~__members__restricted attributebad memberdescr typereadonly attributerestricted attributecan't delete numeric/char attributeattribute value type must be boolTruncation of value to charTruncation of value to unsigned charTruncation of value to shortTruncation of value to unsigned shortTruncation of value to intWriting negative value into unsigned fieldTruncation of value to unsigned intWriting negative value into unsigned fieldreadonly attributebad memberdescr type for %spttyIOW %4.4x %4.4x %4.4x %4.4x %2.2x IOW note %dThis module is always available. It provides access to the mathematical functions defined by the C standard.>9>9>9>9>9>9>9>9>9>9>9>9;?9>?9IDREFܨܩާɱ#--listen(backlog) Enable a server to accept connections. The backlog argument must be at least 0 (if it is lower, it is set to 0); it specifies the number of unaccepted connections that the system will allow before refusing new connections..getprofile() Return the profiling function set with sys.setprofile. See the profiler chapter in the library manual.RAND_add(string, entropy) Mix string into the OpenSSL PRNG state. entropy (a float) is a lower bound on the entropy contained in string. See RFC 1750. Plan 9 version uses libmp.000000 ^ &     000 0 0 0 0 00000006"'"("""*")""7"""%" "#"+"."a"L"H"=""`"n"o"d"e""5"4"B&@&2 3 !0 !&&%%%%%%%%%; !!!!0$$$$$$$$$$$$$$$$$$$$t$u$v$w$x$y$z${$|$}$~$$$$$$$$$$`$a$b$c$d$e$f$g$h$i$ 2!2"2#2$2%2&2'2(2)2`!a!b!c!d!e!f!g!h!i!j!k!  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0b0c0d0e0f0g0h0i0j0k0l0m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 !"#$%&'()*+,-./012345Q6789:;<=>?@ABCDEFGHIJKLMNO+Mk1111 1 1 1 1 1111111111111111111 1!1"1#1$1%1&1'1(1)1%%%%%%%%% % % % % %%%%%%%%%%%%%%%%%%% %!%"%#%$%%%&%'%(%)%*%+%,%-%.%/%0%1%2%3%4%5%6%7%8%9%:%;%<%=%>%?%@%A%B%C%D%E%F%G%H%I%J%K%JU?W(cT UTvLve^aUޘ*S T^l9Z)TlR~_Wq~l|KYN_$a|0N\g\ Θup"QIYQ[O&T+Yweu[vbbE^l&{OO gnmmy_+ubOܑe/Q^PtoRK YPN6ry[DYTvVV9eivnr^uFggzvaybecQR8~\/n`g{vؚ|dP?zJTTLkdb=urRi[sn;uRS݋i_`mOW"ksSh؏bc`$Uubqm[{^RLaĞxW'|vQ`LqCfL^M`pp%c_b`ԆVk`gaIS`ff?yOpGl~dfZZBQmmA;mOkpb` 'xyQ>WW:gxu=zy{eo!Y~  TghM|ƖS%`urlsSZ~$cQ ]߄bQc[OmyBR`Nm[[e_EY~~ Vg9YsO[RZ>2uGPNlZbnc]wQݍ/OS`pgRPcCZ&P7wwS~d+ebcP5rɉQ~GW̃QT\OzZmᐏUTaST_cwiQha R*XRNW x w^wa|[bbNpbp`wWۂghxyXTS4nKQ;R[CUWs`QW-TzzP`T[cbScb[gTzw^8YWcWWw{O_[>k!SP{rFhw6weQNv\zuNYAP'andWfFcVbib^WbU!JfUegV݄jZhb{pQo0cȉapntir^ΐgjm^cRbrlOYjpmRPNm~x/}!QWd{|lh^iQShrΞ{ryotNg̑xS)RPOOuz|lRtTOTޏp^`m^[e8K`p~|Qh|o$Nϑ~fNdJPuq[foNdc^eRˆpRs3tgx4NޜmQATbsÔ6OQupu\SNn tikxYuR$vAmgmQKT<{zWbG|iZd{oKbS^pcdSOx2B^oyU_F.btTݔOee\a\Q/l_sn~\cj[nuSqNceubn&ONl~W;#{=m~YsxlVTWpNVSȏ wnfba+o)+vl_+skwƔoSQ=^8HNsghv dql wZAk'f[YZN jv0sh_[/wa|%_s|yʼnl[B^h w~QMQR)ZbׂcwЅy:n^YmplbvOe`f# T}T,xdyd!jxidTb+gX؞l o[L _rgbarNYkXfU^RUa(gvfwgrFzbTPTZ~lCNvYHYWS7uV c|`mbTQZY*Pl<\b`O?S{n+bt^xd{c_Z?\OcB}[nUJMm`grQ[bl[rmb~SmQ_tYR`sYfPu*ca|T'k%kՅUTvPljU,r^`6tbcLr_Cn>meXovxvTu$RSSN^e*րbT(RpэlxTڀWTjMiOlUv0xbpom_h|x{ gOgcxoWx9ybbR5tkdU>uv9SuPA\l{OPGrؘothydwb+TXRNjW s^QtċO\aWlFZ4xD돕|VRQbNa郲W4gWnffm1fpg:khbYNQoglvQhGYgkfu]PeHyAyw\^NO/TQY xhVlď_}llcp`=murfbŔCS~{N&~NԞMR\ocEm4XL] kIkg[TTX7:_bGj9re`ehwTNO]d\OzRN/`zONy4tRdy[lR{"l>PSndtf0l`w^y7x3u{T8Om Z~^yl[vZuNanXu%urrGS~wviR܀#W^1Yren׋8\qASwbeNߘ[ƋSwON\vY_:yXNgNbR/fUlVNOʑpl^C`[ƉՋ6eKb[[c.US&v}Q,ghkbSmufNNp[qffr͞ ^\/gh_g bzX^pe1oU`7R Tdp)u^hbS=r4lawz.TwzUxgped6V`ySN{k[UV:OUcTن\~*gsTOuÀUOMO-n \pakSv)ne~;T3z }UtcmzbegScl]\TLNalK\eh>T4TkfkNBcHS OO^W bdfirRR`fqgRxwpf;V8T!zrzo` ^`Y`qpnPlrj-^`NZUm|b~w~#Sf\Or NSYTc(HQN~T$T7m&_Z>fis.sSz[wP~vSv{DXnaNey`TNy]ajPTa']xJRTVm[mSf\][!hxU{HeTiNGkNOSc:deQhxSall"Q\ #ke__OEfe)s`tQRWb_Lx^Og'`YDQQSylĖqOO=gUy~X bZV{_ĄWSe^\ud`n}Z~~iU[`es cv)w~tf[tz@Rq_e[o]k[l ŏSb&-@T+NYr]YmŖTN qT pmv%Nx\^plDYcopYvtGd'\ez#YTo0iNV67rΑQ_NucNSfKYmNX;ScO Oc7YWyNul[Y]_iP]YNwNzbfy\Ny_Ɓ8uNԈak_INvn㋮ ы_~5kVk4YTm[n9\_pS1jtZp^($%gGΏbvq_lx fTbcOÁu^͖ Tlm8l`R(u}^O`_$\1url8nI gSSQOɑS|^mNvi^aYOO>| annN1ZN\y[틽sWTGU\_a2krtm[Ոkm3 nQCQWScVXTW?sn܏т?a(`bf~Í\|g`NShAQЏt]UfU[S8xBg=hT~p[}Q(WTef^Clm|QgeojV vvpq#bRl<`Xaf`NbU#n-gg(whiTMNpȋXde[z:P[wky|lve-]U\8h`Sbz[n~jzp_3o _cmVgN^&N4vb-f~blugqiFQSnbTُYmsewu'xOguʋ/cG5#cAw_rN`tebck?e'^uѐg/e1TwAlKN~Lv ikgbS\fScSRRR-R3R?R@RLR^RaR\R}RRRRRQTNNNNNNNNON"OdON%O'O O+O^OgO8eZO]O_OWO2O=OvOtOOOOO~O{OO|OOOOOOOOOOOOO)PLPO,PP.P-POP P%P(P~PCPUPHPNPlP{PPPPPPQPPPPQ QN=lXOeOOFlt|nQ]ɞQYR SSQYUQNVQNnN҈y4[QQQQQQQQ‹Ëˋϋ΋ҋӋԋ֋؋ً܋ߋ  !%'*+./2356iSzS"!1*=]4]=]l][]o]]]k]K]J]i]t]]]]s]]s_w____________ba_rrrrrrrrrrrrrrrrsrsrrss!s ssss"s9s%s,s8s1sPsMsWs`slsos~s%Y$YYcghijkltw}^^^^^^^^^^S^^^^^____`_`___``___`5`&``` `)`+` `?`!`x`y`{`z`B`j`}````````````````` a&aa#a`aa+aJauaaaaaaa_ ,N?rb5lTl\lJllllllhliltlvllllllllllllllllllll9m'm mCmHmmmmm+mMm.m5mmOmRmTm3mmommm^mmm\m`m|mcmnmmmnmmnmmmnm nm+nnnNnknn_nnSnTn2n%nDnnnnn-onnnnnnnnnnnnboFoGo$oon/o6oKoto*o o)ooooxoro|ozoooooooooooop#pp9p5pOp^p[[[[[[/u4d[[0[GӏՏ & !56-/DQRPhXb[ft}P_W_V_X_;\TP\Y\q[c\f\*_)_-_t<_;n\YYYYYYYYYYYYYYYYZZYZYYY Z Z2Z4ZZ#ZZ@ZgZJZUZusssssssssssssss| tssssst*t[t&t%t(t0t.t,tttAt\tWtUtYtwtmt~ttttttttttttttLgSg^gHgigggjgsgggugggggwg|gg hg hgg hggggghggghgg2h3h`hahNhbhDhdhhhUhfhAhgh@h>hJhIh)hhhthwhhkhhnihi ih$ih iiWihiqi9i`iBi]iikiiixi4iiiiiificiyiiiiiiiiiiiiiii/jijjejiDj>jjPj[j5jjyj=j(jXj|jjjjjj7sRskkkkkkkkkkkkmqrsuvxwyz|~Ύ bbbb"b!b%b$b,btttuuu4eeee ffrgfffpff4f1f6f5f_fTfAfOfVfafWfwffffffffff236;=@EFHIGMUYljʉˉ̉ΉωЉщnrr]rfror~rrrrrrrc2cc?ddkkkkklll lllll!l)l$l*l2l5eUekeMrRrVr0rbR gۀ€Āـ̀׀g݀ gZ6,2HLStYZq`i|}mgMXZń&gʁ$k7k9kCkFkYkјҘӘ՘٘ژk@_keQeeeeeeeeepppppppppppqqq/q1qsq\qhqEqrqJqxqzqqqqqqqqqqr(rlpqfqq>b=bCbHbIb;y@yFyIy[y\ySyZybyWy`yoygyzyyyyyy__<`]`Z`g`A`Y`c``a a]aaaaabllmwwx xxxxe-xxx9x:x;xx?B5DEFILNORSTVWXY[^_]abdefghijkloqrs:wwɖyyyyzG]zzzz9z7zQzϞpzvvvvvtt,u "()*+,216879:>ABDFGHIKLNQUWZ[\^cfghijklqmsuuuuuuuuuuuuuuuuuuuuuuuvuuuvvv vv v%vvvvvv3vMv^vTv\vVvkvovzxzyzzzzzzzzzzzdir}ƈɈΈ! 4+6Af{u倲vvw "%&')(1 5CFMRiqxMTlnz|{ĆΆɆφІކ߆؆ц #;%.>H41)7?"}~{`pLnSc|dYe҇Ƈ凬ˇӇчʇۇ !9<6BDEzz{{{{ {+{{G{8{*{{.{1{ {%{${3{>{{X{Z{E{u{L{]{`{n{{{b{r{q{{{{{{{{{{{{{{{{{{{{{{ |{{|| ||*|&|8|A|@|D!"#-/(+8;34>DIKOZ_h~؈߈^||Ie||||||||||||||||nf|w}}}G~~sgmGIJPNOdbapio}~rtyU~Yič֍׍ڍލ΍ύۍƍ ,.#/:@95=1IABQRJpv|otxe։މډ܉>&S*-0> ΖҖwȒ>jʓ>k#zĜŜƜǜʜ˜̜͜ΜϜМӜԜ՜ל؜ٜܜݜߜ|Xښ˚̚њECGIHMQ .UTߚ#;~֓۞ܞݞߞ",/97=>Dgetweakrefcount(object) -- return the number of weak references to 'object'.gamma(x) Gamma function at x.apply(object[, args[, kwargs]]) -> value Call a callable object with positional arguments taken from the tuple args, and keyword arguments taken from the optional dictionary kwargs. Note that classes are callable, as are instances with a __call__() method. Deprecated since release 2.3. Instead, use the extended call syntax: function(*args, **keywords).sqrt(x) Return the square root of x.*6,EO6r?9LRemove an element from a set; it must be a member. If the element is not a member, raise a KeyError.B@5@(@closerange(fd_low, fd_high) Closes all file descriptors in [fd_low, fd_high), ignoring errors.GC object already trackedgenerator already executingcan't send non-None value to a just-started generatorgenerator ignored GeneratorExitthrowthrow() third argument must be a traceback objectinstance exception may not have a separate valueexceptions must be classes, or instances, not %s__name__gi_framegi_runninggi_codesendthrowclosegeneratorGC object already trackeddecomposition(unichr) Returns the character decomposition mapping assigned to the Unicode character unichr as string. An empty string is returned in case no such mapping is defined.""""";+1.n|51.1.}1.Low-level inferface to warnings functionality.p-p-B.pop([index]) -> int Remove and return a single item from B. If no index argument is given, will pop the last value.111;SG.^\N]eg^ggXa dAegj`ioj    !"# $%% %%% %h%p% %%%  %%%$ %@@D.__sizeof__() -- size of D in memory, in bytesacquire([wait]) -> bool (acquire_lock() is an obsolete synonym) Lock the lock. Without argument, this blocks if the lock is already locked (even by the same thread), waiting for another thread to release the lock, and return True once the lock is acquired. With an argument, this will only block if the argument is true, and the return value reflects whether the lock is acquired. The blocking operation is not interruptible.{Qgy`qz=km    !"# $G3P3d3j3s3|3stat(path) -> dir-tuple Perform a stat system call on the given path.xrange(stop) -> xrange object xrange(start, stop[, step]) -> xrange object Like range(), but instead of returning a list, returns an object that generates the numbers in the range on demand. For looping, this is slightly faster than range() and more memory efficient.C@6@6,E6r$LReturn state information for pickling.>-unichr(i) -> Unicode character Return a Unicode string of one character with ordinal i; 0 <= i <= 0x10ffff.json speedups dropwhile(predicate, iterable) --> dropwhile object Drop items from the iterable while predicate(item) is true. Afterwards, return every element until the iterable is exhausted.mktime(tuple) -> floating point number Convert a time tuple in local time to seconds since the Epoch.category(unichr) Returns the general category assigned to the Unicode character unichr as string.ascii -> bin, done. Decode .hqx coding                     D.values() -> list of D's valuesL.insert(index, object) -- insert object before index7yACnF?O8M20HwZ<%s>memory was exhausted while profilingcodecode object or built-in function namecallcounthow many times this was calledreccallcounthow many times called recursivelytotaltimetotal time in this entryinlinetimeinline time in this entry (not in subcalls)callsdetails of the callscodecalled code object or built-in function namecallcounthow many times this is calledreccallcounthow many times this is called recursivelytotaltimetotal time spent in this callinlinetimeinline time (not in further subcalls)_lsprof.profiler_entry_lsprof.profiler_subentry((Olldd))((OllddO))subcallsbuiltins|ii:enabletimertimeunitsubcallsbuiltins|Odii:Profilergetstatsenabledisableclear_lsprof.Profiler_lsprofFast profilerProfilerprofiler_entryprofiler_subentryi};TTs};TT|};.V\V};.V\V};ST};ST};UU};UUA@{38 1{38 1{3 ;9{3 ;9{3  #{3 d+system(command) -> exit_status Execute the command (a string) in a subshell.}seekable() -> bool. Returns True if the IO object can be seeked.D@7@ParserCreate([encoding[, namespace_separator]]) -> parser Return a new XML parser object.isinf(x) -> bool Check if float x is infinite (positive or negative). getstats() -> list of profiler_entry objects Return all information collected by the profiler. Each profiler_entry is a tuple-like object with the following attributes: code code object callcount how many times this was called reccallcount how many times called recursively totaltime total time in this entry inlinetime inline time in this entry (not in subcalls) calls details of the calls The calls attribute is either None or a list of profiler_subentry objects: code called code object callcount how many times this is called reccallcount how many times this is called recursively totaltime total time spent in this call inlinetime inline time (not in further subcalls) count(x) Return number of occurrences of x in the array.{Qgy`qz=km    !"# $ _multibytecodec__create_codecencoding name must be a string.no such codec is supported.multibytecodec.__map_*getcodecmultibytecodec.__map_*gb2312gbkextgbcommongb18030extgb2312gbkgb18030hz_codecs_cn^lH)I)$  pa A! W6]6m6v666,getegid() -> egid Return the current process's effective group id.B@udptcpOKremoteW9-\9-a9- ))S.format(*args, **kwargs) -> unicode Return a formatted version of S, using substitutions from args and kwargs. The substitutions are identified by braces ('{' and '}').writelines(sequence_of_strings) -> None Write the sequence of strings to the file. Note that newlines are not added. The sequence can be any iterable object producing strings. This is equivalent to calling write() for each string. Difference between two datetime values..!.Z9Z9Z9Z9Z9Z9Z9Z9[9 $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $ $$$$$$$$"$$$&$($*$,$A buffer for a writeable sequential RawIO object. The constructor creates a BufferedWriter for the given writeable raw stream. If the buffer_size is not given, it defaults to DEFAULT_BUFFER_SIZE. max_buffer_size isn't used anymore. NDATAE@8@6,f&E6r~7Lunlink(path) Remove a file (same as remove(path)).$ $$FH)_#,+_astimp_bisect_collections_csv_elementtree_functools_hashlib_heapq_json_locale_lsprof_random_ssl_struct_testcapiarraybinasciibz2cPicklecStringIOcmathdatetimefcntlfpectlfpetestgrpitertoolsmathoperatorparserplan9posixpurepyexpatselect_socket_sockobjectstroptimetimingunicodedatazlib_codecs_cn_codecs_hk_codecs_iso2022_codecs_jp_codecs_kr_codecs_tw_multibytecodec_iogcthreadsignalerrnopwd_sre_codecs_weakrefzipimport_symtablexxsubtypebase85bdiffdiffhelpersmpatchosutilparsersmarshalimp_ast__main____builtin__sysexceptionsgc_warnings ?@@@    7yAC@xDp-p-EMPTYNT%d%.32s(%.32s)yPD?/proc/%d/waitreadline() -- Read one linegetcheckinterval() -> current check interval; see setcheckinterval().float.as_integer_ratio() -> (int, int) Returns a pair of integers, whose ratio is exactly equal to the original float and with a positive denominator. Raises OverflowError on infinities and a ValueError on NaNs. >>> (10.0).as_integer_ratio() (10, 1) >>> (0.0).as_integer_ratio() (0, 1) >>> (-.25).as_integer_ratio() (-1, 4)Conversion between binary data and ASCIIC@S.center(width[, fillchar]) -> unicode Return S centered in a Unicode string of length width. Padding is done using the specified fill character (default is a space)(6hiK$!h;ascii{;{;{;|; |; |; "|;(rename(old, new) Rename a file or directory.-- xml=http://www.w3.org/XML/1998/namespaceH)^%A-F@9@Return the dialect instance associated with name. dialect = csv.get_dialect(name) (( ((@@@@@@@@ """"        @P@@@@P@@P@@@@P@    @@@@@@@@@@@@@@@@   @P@P @ P @ P     ""  ""4D4g4 44Q44d44T4V4`j44m4Ύ4144F4>424.4*4*44444֤4Ҧ444r4l4\4P4N4(4&4&44 44444444Z4 <44 4444 44444444L4<444 \464444444455n5l5570 5 5 5555 555wj5*5*5(5" 5!5#5 p%5 T'5 )56*56,56.56056256456656856:56<56>56@56B56D56F56H56J56L56N56P56R56T56V56X56Z56\56^56`56b56d56f56h56j56l56n56p56r56t56v56x56z56|56~565~5~5 5acosh(x) Return the hyperbolic arccosine of x.B5F I 9-(*M9-d$ M888X18(I.$8Z+gethostbyname_ex(host) -> (name, aliaslist, addresslist) Return the true host name, a list of aliases, and a list of IP addresses, for a host. The host argument is a string giving a host name or IP number.$$$T$h$ $/$-atof(s) -> float Return the floating point number represented by the string s.!!!=!D!K!@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@!   !!   !!! !!! !  ! !!!! !                                                                     1.2.3Q@D@map(function, sequence[, sequence, ...]) -> list Return a list of the results of applying the function to the items of the argument sequence(s). If more than one sequence is given, the function is called with an argument list consisting of the corresponding item of each sequence, substituting None for missing values when not all sequences have the same length. If the function is None, return a list of the items of the sequence (or a list of tuples if more than one sequence).bd1!rE%%`ssqErrorString(errno) -> string Returns string error for given number.T@G@erf(x) Error function at x.{Gz? <@!D%0R9ƥ  :8&U@|>9>9>9>9>9>9>9stat(path) -> stat result Perform a stat system call on the given path.S.find(sub [,start [,end]]) -> int Return the lowest index in S where substring sub is found, such that sub is contained within S[start:end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.symlink(src, dst) Create a symbolic link pointing to src named dst.float.hex() -> string Return a hexadecimal representation of a floating-point number. >>> (-0.1).hex() '-0x1.999999999999ap-4' >>> 3.14159.hex() '0x1.921f9f01b866ep+1'=GE@log10(x) Return the base 10 logarithm of x.'continue' not properly in looplen(object) -> integer Return the number of items of a sequence or mapping.cPickle.Pdataunpickling stack underflowno int where int expected in memo%ld %ld __module__modulesfast mode: can't pickle cyclic objects including object type %s at %pI00 I01 %ld long too large to pickle 0123456789abcdef while pickling an objectdict items iterator must return 2-tuplesdict items iterator must return 2-tuplesdict items iterator must return 2-tuplesdictionary changed size during iteration while pickling an objectiteritems() while pickling an objectclass has no name Can't pickle %s: import of module %s failedOSCan't pickle %s: attribute lookup %s.%s failedOSSCan't pickle %s: it's not the same object as %s.%sOSSCan't pickle %s: extension code %s isn't an integerOOCan't pickle %s: extension code %ld is out of rangeOl persistent id must be string tuple returned by %s must contain 2 through 5 elementsOsave_reduceSecond element of tuple returned by %s must be a tupleOFourth element of tuple returned by %s must be an iterator, not %sOsFifth element of tuple returned by %s must be an iterator, not %sOs__newobj____newobj__ arglist is empty__new__args[0] from __newobj__ args has no __new__args[0] from __newobj__ args has the wrong class while pickling an objectValue returned by %s must be string or tupleO|i:getvalueAttempt to getvalue() a non-list-based picklerInvalid get dataUnexpected data in internal listInvalid get dataO|i:dumpdumpdump(object) -- Write an object in pickle format to the object's pickle streamclear_memoclear_memo() -- Clear the picklers memogetvaluegetvalue() -- Finish picking a list-based picklepickle protocol %d asked for; the highest available protocol is %dI/O operation on closed fileargument must have 'write' attributecopy_regfileprotocol|i:PicklerO|i:Picklerpersistent_idattribute deletion is not supportedattribute deletion is not supportedmemoattribute deletion is not supportedmemo must be a dictionarybinaryfastpersistent_idinst_persistent_idmemoPicklingErrorcPickle.PicklerGlobal and instance pickles are not supported.modulescould not find MARKpickle data was truncatedcould not convert string to intLONG pickle has negative byte countcould not convert string to floatinsecure string pickleBINSTRING pickle has negative byte countBINUNICODE pickle has negative byte countbad pickle databad pickle databad pickle dataNEWOBJ expected an arg tuple.bad pickle dataNEWOBJ class argument isn't a type objectNEWOBJ class argument has NULL tp_newA load persistent id instruction was encountered, but no persistent_load function was specified.bad pickle dataA load persistent id instruction was encountered, but no persistent_load function was specified.EXT specifies code <= 0unregistered extension code %ld_inverted_registry[%ld] isn't a 2-tuple of stringsbad pickle datastate is not a dictionaryslot state is not a dictionarybad pickle databad pickle dataunsupported pickle protocol: %dinvalid load key, '%s'.cbad pickle databad pickle databad pickle datainvalid load key, '%s'.cbad pickle dataloadload() -- Load a picklenoloadnoload() -- not load a pickle, but go through most of the motions This function can be used to read past a pickle without instantiating any objects or importing any modules. It can also be used to find all persistent references without instantiating any objects or importing any modules. I/O operation on closed fileargument must have 'read' and 'readline' attributespersistent_loadfind_globalmemoUnpicklingErrorpersistent_loadfind_globalattribute deletion is not supportedmemomemo must be a dictionaryobjfileprotocolOO|iobjprotocolO|i:dumpsS:loadscPickle.Unpicklerdumpdump(obj, file, protocol=0) -- Write an object in pickle format to the given file. See the Pickler docstring for the meaning of optional argument proto.dumpsdumps(obj, protocol=0) -- Return a string containing an object in pickle format. See the Pickler docstring for the meaning of optional argument proto.loadload(file) -- Load a pickle from the given fileloadsloads(string) -- Load a pickle from the given stringPicklerPickler(file, protocol=0) -- Create a pickler. This takes a file-like object for writing a pickle data stream. The optional proto argument tells the pickler to use the given protocol; supported protocols are 0, 1, 2. The default protocol is 0, to be backwards compatible. (Protocol 0 is the only protocol that can be written to a file opened in text mode and read back successfully. When using a protocol higher than 0, make sure the file is opened in binary mode, both when pickling and unpickling.) Protocol 1 is more efficient than protocol 0; protocol 2 is more efficient than protocol 1. Specifying a negative protocol version selects the highest protocol version supported. The higher the protocol used, the more recent the version of Python needed to read the pickle produced. The file parameter must have a write() method that accepts a single string argument. It can thus be an open file object, a StringIO object, or any other custom object that meets this interface. UnpicklerUnpickler(file) -- Create an unpickler.__class____getinitargs____dict____getstate____setstate____name____main____reduce____reduce_ex__writeappendreadreadlinedispatch_tablecopy_reg_extension_registry_inverted_registry_extension_cache__builtin____builtins__def __str__(self): return self.args and ('%s' % self.args[0]) or '(what)' cPickle.PickleErrorcPickle.PicklingErrordef __str__(self): a=self.args a=a and type(a[0]) or '(what)' return 'Cannot pickle %s objects' % a cPickle.UnpickleableErrorcPickle.UnpicklingErrorcPickle.BadPickleGetPickleErrorPicklingErrorUnpicklingErrorUnpickleableErrorBadPickleGetcStringIO.cStringIO_CAPI1.71cPickle__version__HIGHEST_PROTOCOL2.0[sssss]1.01.11.21.32.0format_versioncompatible_formatsis_tracked(obj) -> bool Returns true if the object is tracked by the garbage collector. Simple atomic objects will return false. rc4_128md5rc4_128sha13des_ede_cbcsha1aes_128_cbcsha1aes_256_cbcsha1#a/tls/clone#a/tls/%s#a/tls/%s/handfd %d 0x%x#a/tls/%s/datattls#a/tls/clone#a/tls/%s#a/tls/%s/hand#a/tls/%s/datafd %d 0x%xttlstlsServer2 initial msgRecv failed expected a client helloClientHello version %x incompatible versioncipher suites too weakno matching cipher suiteno matching cipher suiteno matching compressor cipher %d, compressor %d, csidlen %d can't initialize security: %rfactotum_rsa_open: %rexpected a client key exchangecouldn't set secrets: %rtls secrets secret %s %s 0 %scan't set keys: %rcan't set finished: %rexpected a finishedfinished verification failedchangeciphercan't enable cipher: %rcan't set finished: %rtls finished openedexpected a server helloincompatible version %rinvalid server session identifierinvalid cipher suiteinvalid compressionexpected a certificaterunt certificategot an server key exchangeexpected a server hello doneinvalid x509/rsa certificatesecret %s %s 1 %scan't set keys: %rcan't set secret: %rchangeciphercan't enable cipher: %rcan't set finished 1: %rtlsClient nepm=%d can't flush after client Finished: %rtlsClient nepm=%d can't set finished 0: %rtlsClient nepm=%d can't read server Finished: %rtlsClient nepm=%d expected a Finished msg from serverfinished verification failedopenedunable to do final open: %r send %scan't encode a %d/sys/src/libsec/port/tlshand.c/sys/src/libsec/port/tlshand.c/sys/src/libsec/port/tlshand.c/sys/src/libsec/port/tlshand.coutput buffer too small for certificate/sys/src/libsec/port/tlshand.cwrite error: %r invalid hello request during handshakehandshake message too long %d %dn-nrandom!=nn: n=%d nrandom=%d nn=%d can't decode a %drecv %shandshake message has invalid lengthmsgClear: unknown message type: %d%s[nil%.2x ]%s%s[nil%x ]%sunknown %d ClientHello version: %.4x random: %.2x sid: ciphers: compressors: ServerHello version: %.4x random: %.2x sid: cipher: %.4x compressor: %.2x Certificate CertificateRequest types: certificateauthorities ServerHelloDone HClientKeyExchange key: HFinished %.2x tlsError: %s double error: %r, %stls: local %salert %dversion 0x%x#a/tls/encalgscan't open #a/tls/encalgs: %rnothing in #a/tls/encalgs: %r #a/tls/hashalgscan't open #a/tls/hashalgs: %rnothing in #a/tls/hashalgs: %r /mnt/factotum/rpcproto=rsa service=tls role=clientstartread/sys/src/libsec/port/tlshand.cwritereadmismatched session versionsinvalid x509/rsa certificateinvalid finished exchangeinvalid versionkey expansionmaster secretserverMasterSecret failed ok=%d pm=%p pmvers=%x cvers=%x nepm=%d tls pkcs1_encrypt failedout of memoryCLNTSRVRclient finishedserver finishedout of memoryout of memoryout of memoryout of memoryȷ-:)h":)h%4:)ip":)1iDi3:)Mi z;:)ii9):)i8":)il5-:)i-:)6pt%:)o*:)ez6:)it;:)jh;:)gk;:)plԉ;:)i,":)jdJ):)-jh";)Ij`;;)ej;H)%|tjkz'n-51E d|3u|@;P filter(function or None, sequence) -> list, tuple, or string Return those items of sequence for which function(item) is true. If function is None, return the items that are true. If sequence is a tuple or string, return the same type, else return a list.H@?recvfrom(buffersize[, flags]) -> (data, address info) Like recv(buffersize, flags) but also return the sender's address info.findall(string[, pos[, endpos]]) --> list. Return a list of all non-overlapping matches of pattern in string.close() -> None. Disable all I/O operations.O4O4@O4O4HO4O4h O4 P4h/P4P45 ~304050;0<000"""" ""##"""%"&"))0000b"C"E"H"v"w"!n&k&l&i&%%%%!!!!!!!!!4)5))%=0FE%" "5!!3!'!0 ))K0M0O0Q0S000000000000d&`&b&f&a&e&g&c&$$$$$$$$$$&& 0&&&&&h&%1111111111111111###############0000""S!T!U!'##$#Q2R2S2T2U2V2W2X2Y2Z2[2\2]2^2_2222222222222222%%%%< G H I >? *jL+kMA=Z`^dy}{B>[a_ez~|T9 CGPXnpbU: DHQYoqc$4\l %5]mq~lnyVs}{m_raKp'fSW`SRhXuY\^PodTQReUzgZpqrsa?  %,9 =)/$0<4*:;v'w'x'y'z'{'|'}'~''$$$$$$$$$$p!q!r!s!t!u!v!w!x!y!z!{!$$$$$$$$$$$$$$$$$$$$$$$$$$2222222222222222222222222Q B `$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$`!a!b!c!d!e!f!g!h!i!j!I33"3M33'3363Q3W3 3&3#3+3J3;33333333k!{300!3!!22222122292~3}3|3."""V'&O4(N/N0NNNNNO O`OHOIOVO_OjOlO~OOOO0OOPPPP'P.P@P;PAPPPPPP1QQ QQ5QJQ2UQWQ4QQQQQQR4RRIRWRaRRR3RRRR4RRSSS5aScS}SSSST'TMTTkTtTTTTTTTTU+U5UPU^UUUU6UU7VV;VIVvVfV8oVqVrVVVVVVVV W!W/W3W4WpWwW|WWWWWWWWWWW XaXdX9|XXX:XXXXXXX YA]YmYYYYYYYZ#ZgZmZwZ~ZZZZZ[%[]RA[V[}[[[[\\#\+\7b\;a?aa@"b>bCbVbZbobbbbb cc9cCcec|ccccdd"dydQd`dmddddddddd"e)eAgeeBf fff:f"f$f+f0f1f3ffHfLfYfZfafefsfwfxffCfffff";fffg)3gfgGgHg{gggggggggghRhh,h1h[hrhuhDhhhhhhhhhh iIi5iBiWicidihiiiii;;iiiiijj;j>jEjPjVj[jkjsjjjjjjjj<kk,k5kFkVk`kekgkwkkkkpkkkkll3lYl\lltlvlllllllllllmm.m1m9m?mXmemEmmmmmmmmmmmmmF4nDn\n^nnnnnnooG*o/o3oQoYo^oaobo~oooooooooooooopp(pJp]p^pNpdpuppppppppq+qq q.q0qFqGqQqHRq\q`qhqqqqqqqqrrUrVr?>rrrrr's(sPsfs|ssssssssssssst tttJ&t(t*t+t,t.t/t0tDtFtGtKtWtbtktmttttttttttttttttttuu/uouyuur?uuvvvvvvv-v5vCvKvdvevmvovqvvvvvvvvvvvvvvv ww4w6wFwMwNw\w_wbwzwwwww-xCxNxOxQxhxnxKxxxxyxy.y1y4yLMEyFyNOP\yQyyRSyyyyyyyyyzT9z]zmzUzzzzzzz{-{;{G{N{`{m{o{r{{V{{|1|| |3|6|dBY|m|y||||||||}}}}#}1}A}H}S}\}z}}}}}}}}}W(~~~~YG~R~a~~~GZ[&57<ʀ׀J`ghmʁρׁ\SD[D`tƂՂb"-:CGQU}ǃσу _H_ps„2#/Ydz˅΅)8W[6bElu qEև ʈΈ`'029@aԉ"7GN]auyЊߊ"bcFTYiIhde΍э׍ #=p{DH-6T-gĐŐǐאݐސ&"#'/14=H[ב89:<@COx’˒̒Ӓ!%HIJdejpƓޓߓ3Jckqr˕ЕӕIڕޕXҖޖh3;MNOZnsɗޗۗi +0jRSVWYZelȘX$-.8JNRÚΚ֚ L-^yfruΛ#AOPScewCGRcp|ם|Þў9WY[\w^&vk~S . & Eԅ/i  E8u4 01closeO(is)filemodeclosefdrO|si:fileiointeger argument expected, got floatNegative filedescriptorencoder failed to return bytesMust have exactly one of read/write/append mode and at most one plusinvalid mode: %.200sCannot use closefd=False with file namenameI/O operation on closed fileFile not open for %sreadingw*unbounded read returned more bytes than a Python string can hold reading|O&writings*an integer is requiredO|iwriting|Orb+rbwb<_io.FileIO [closed]>name<_io.FileIO fd=%d mode='%s'><_io.FileIO name=%s mode='%s'>readreadallreadintowriteseektelltruncatecloseseekablereadablewritablefilenoisattyclosedTrue if the file is closedclosefdTrue if the file descriptor will be closedmodeString giving the file mode_io.FileIOPop the smallest item off the heap, maintaining the heap invariant.F@9@/net/cs!port=%s %s=*!port=%s!%s=%s port=*port .| .Disconnect this buffer from its underlying raw stream and return it. After the raw stream has been detached, the buffer is in an unusable state. B.isalnum() -> bool Return True if all characters in B are alphanumeric and there is at least one character in B, False otherwise.span([group]) -> tuple. For MatchObject m, return the 2-tuple (m.start(group), m.end(group)).N'W'I@ExternalEntityParserCreate(context[, encoding]) Create a parser for parsing an external entity based on the information passed to the ExternalEntityRefHandler.<^%"\& %      00;=[]0 0 0 0 0 00000 `"f"g""4"B&@&2 3 ! &&%%%%%%%%%%%; 0!!!!0" """""*")"'"("`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$`!a!b!c!d!e!f!g!h!i!I33"3M33'3363Q3W3 3&3#3+3J3;33333333{300!3!!22222122292~3}3|3R"a"+"."""" """5")"*"~H܄Op1fhfE_(NNNOO9OVOOOOOO@P"POPFPpPBPPPPJQdQQQQRRRRRSS$SrSSSSTTTTUYWeWWWWXX YSY[Y]YcYYYV[[/u[[\\\\']S]B]m]]]]!_4_g___]````` a`a7a0aabbc`dddNeff;f f.ff$fefWfYfsffffffg)fggRhghDhhhiii0jkjFjsj~jjjk?l\llollmmommmmmmm9n\n'n izip_longest object Return an izip_longest object whose .next() method returns a tuple where the i-th element comes from the i-th iterable argument. The .next() method continues until the longest iterable in the argument sequence is exhausted and then it raises StopIteration. When the shorter iterables are exhausted, the fillvalue is substituted in their place. The fillvalue defaults to None or can be specified by a keyword argument. ."4"W!'!#()!g"F!>!w)x)%"R"$!,"v),(y(v(z(/"!("(?!*(-(,)!)#)@!*)-)")$($)%)&(&)')((())())0)/(/)+(+).(.)'"0"("+"*"-")"A%B%C%D%E%F%G%H%I%J%K%L%M%N%O%P%Q%R%S%T%U%V%W%X%a%b%c%d%e%f%g%h%i%j%k%l%m%n%o%p%q%r%s%t%u%v%w%x%',!,",#,$,%,&,(,),*,+,,,-,.,/,0,1,2,3,4,5,6,7,8,9,:,;,<,=,>,?,@,A,Q,R,S,T,U,V,X,Y,Z,[,\,],^,_,`,a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,W,*!.!/!0!1!S"T"%!&!6"G!H!X!y)z){)|)})~)f"I!5"$'`"e"b"Y'J!w(x({(|(}(~(0%1%2%3%4%5%6%7%8%9%!%"%#%$%%%&%'%(%)%*%g!h!f!i!j!U"X"V"Y"W"!"""#"S!$"T!t!u!3"2"n!p!D!P!+!|!}!{!z!r!s!1"E!q!-!o!V!A!U!B!C!l!m!x!y!v!w!A"Q!R!g(h(i(j(k(l(m(n(o(p(q(r(s(t(u(g)h)i)j)k)l)m)n)o)p)q)r)s)t)u)M)N)O)P)Q)R)S)T)U)V)W)X)Y)Z)[)\)])^)_)`)a)b)c)d)e)f)M(N(O(P(Q(R(S(T(U(V(W(X(Y(Z([(\(](^(_(`(a(b(c(d(e(f(!&,&"&-&#&H&G&.&$&B&A&/&&&F&E&1&%&D&C&0&'&<&I&J&7&K&L&2&)&>&M&N&9&O&P&4&(&Q&R&8&=&S&T&3&*&U&V&:&?&W&X&5&+&Y&Z&;&[&\&@&]&^&_&`&a&b&c&d&6&F"a!`!C"G"H"K"J"I"L"c!b!:"9"e!d!8"7"_!^!B"[!]!\!D"E"Z!Y!O"N"P"Q"O!N!<"="@";">"?"M"["\"]"Z"!!"!#!(!4!5!6!7!8!9!:!;!*?*@*A*B*C*D*E*F*G*H*I*J*K*L*M*N*O*P*Q*R*S*T*U*V*W*X*Y*Z*[*\*]*^*_*`*a*b*c*d*e*f*g*h*i*j*k*l*m*n*o*p*q*r*s*!+"+#+$+%+&+'+(+)+*+++,+-+.+/+0+1+2+3+4+5+6+7+8+9+:+;+<+=+>+?+@+A+B+C+D+E+F+G+H+I+J+K+L+M+N+O+P+Q+R+S+T+U+V+W+X+Y+Z+[+\+]+^+_+`+a+b+c+d+e+f+g+h+i+j+k+l+m+n+o+p+q+r+s+t+u+v+!$"$#$$$%$&$'$($)$*$+$,$-$.$/$0$1$2$3$4$5$6$7$8$9$:$;$<$=$>$?$@$A$B$C$D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T$U$V$W$X$Y$Z$[$\$]$^$_$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$t$u$v$w$x$y$z${$|$}$~$1)2)3)4)5)6)7)8)9):);)<)=)>)?)@)A)B)C)D)E)F)G)H)I)J)K)L)_"1(2(3(4(5(6(7(8(9(:(;(<(=(>(?(@(A(B(C(D(E(F(G(H(I(J(K(L(^"I'J'K'L'M':';'\']'^'6'7'8'T'U'V'W'X'!'"'#'%'+','-'.'/'0'1'2'3'4'''(')'*'='>'e'f'g'h'a'b'c'?'@'A'B'C'D'E'F'G'H'N'O'P'Q'R'S'Z'['c"l'&'`'o'a"<'m'5'9'j'k'_'d"d'n'i'ilKoRv2X[m2_>_;yt\du&s`]&axN0\*ciqzM/|!S+qQg,RyN}q?^:{9yRN+c`kzNwK%eaJLTajc\-_kK/UuVxe@^#lMi'jvi;{igLofPA^,dLXqy_N$z2f{z=zHLMoUU"SQl'dRl1v{NQP?K$m(mB^bv\mu\9`NT5t[S5V$lfdjqlK@KrljPry%l_PjgkPQ\i[L}W[aZ6V_cC^D^!Jln#S7nOxHj8n,q%qNiNpS$plagOKs)m>JotNv{^;P7Uqn(tx\'KNZf`%mrny\\y\srxytq|p=R$L6zMLzZOv8iuXNLMWQTmikJbY2}-cLV4Y'aSnCP3}dUhOCm2P~N(ZPxV}QxRxS\b]y{A]5c]mDN!Kc]]|/y{R!O(d6t~l.cmgA}bZ3Xd]opqvpzuQOZT\&\?oONY`VYTlKj?J0UiOmqOLxdmdXW'}+j2vpO=ytf[KQsQi)s`PRicZRb"vtadZUg?u"O/M#O0M~q#P/a#x&J;wjrH^SiI^^}@JjyNQTnRT#Y(}YWNw>zVOpWakExz\C]_yoge}#v|Y)}ngeUPo1M"w2q1q2M+Z'Jbc<{$Y:nSxz{$O{\cv*m!raN&z`yVlnd!yo{ky#n,j(JztVMv|ItTx&xJ^FrZWPSEXfj]sZddvrvB_}YvL:S/day&pSK<`JtzT*}by7tB}0|l}bJ=}gjC_RQbN$S+}`_GrpgnP*sK^8vua3q#w)J%OD_0a?p$v6cFzoPm}D]w|?f-^?zqeDm%Rn}6uvaL^^|Wl]M7V3MUxXejOPOLj.j-jqS%SOw$n$P"rpP#rxw3P)[;SlJ&qUKgw^M$w@x]SPL&Osvwa\S~z'zYk'O/jod9iXqXXr`4f|\qsPc{rF[qPrP\OQS1LXw(Kd\tB\'p@fmJkhheC\^mrSwLTN+gCK1a2wsSRS@u]_snqg4}HrRstnSbQLj_:iWYMurqGzxYBTevE]rg_mKJz[5h&S5}Iybd={$WENUNfV=eM^sl`mll>{k_xa>ysP*`bhTb}R(eSY^S8te-mjznM&m.mmp!]/mx|kXyL5M)z]aUbOm"]JyhjmekSTizaLddaGh[NU\5ws|sp/N5qRoHhqkTK>`xcij2|t``O%n*zCf2a+Jdc;iVbrsVn2jvPYlKZ(O#][XNyUiQcZMd9V@o|a9vG_1dg\h\VzvSZqrz}bOUxP_MKupd+KDW~bZ].ZnJ9U!cch+s)OwSqTdNrhue.g:Vl_@ddh5X\d9t6q^b5aoM'qeN]KcY,syP+lS^iwuy^anKcH|pMvyp_?e?Na|0mQ};vOyZkAJ8RqMScf}mfzc*pPyb|'xeaynvgmj4|Bu\Wuph]mS|u?Z{LzS$tWoCTc{m{-`nj3{Bdgv]RL_I|)ev`3v~apKojpj@Z4xrkCdWiqdoJWNJ|asDKecEK4j=iIW[k1mCL>wK|tx7YSsTsdwQw7X1NBJ4{FKvpgUPjTL/K*t/iCuXii]sq{U;^{ts}r}&wI]ST(LAZULdYJzce},J;}G}2gQjt_lQ^dCe&YS{|rdu_xhmxGNv}XhXMVgZLcJv_GpFp:XtqptLue|Ejsj[]W\}^yrGUPXHp!Q"QTYhVJY1ZGXb\Nstu9qSZjvuO.}RJ4_]W:z'n=uuxhmaT#QVaxyJ[yKTT\Y>nmwnRfaywm][h3[wQ0`bTWvyW]X}M+r=MBx,r-J.J.OBc7\Z[;YsJSvxfujvjyv/OSJ/J0R:q3WCc}sZ^[^^ocb{nw_JWhN[[;qqi7zFP+L(nzKyy}L~SPdnrUTM_8|PQMrRwTJYU^XYM)nP\]VTVSPm!M5_x_!T2NJhukUcPu!u'Y+eKfquEe#y[`kvqKjY"uQWxQxjyj3Z_ooqve?ndb?P,zQu3g>iNr4[N|n]4g4W4w>MiZ0OYwfsYN*NHK'PKpGPEd`[ZU'W@nvxRuimko]p]q]r]>YF{3O}n+dEZlX(Q)b<^5gp[bopq4Oq[1`%_Ry}g#fq{0K.rgM\hWg@wcP!Z=L)QL]~c*Q*h6jzyLfXvGTKYRYKSwX)Zxu^^/r)xHXAnAys]zj=v;a?MTtMfO|"{\`;tUZ2yr{v[_^r[\xnwhkzRv2`~|+QzWH{Wb#Txp(Wga?SdoEWbkg|"dhbPfh{htteh^`4vRj{yB`dJ7g}j]Y4Z*ni{K[5Z>q,SI{O_@SWcfoP|@iSu\l7w8jyQH\9j^q6W5O(Ynl*]"M.h=aQrAi|R5[gs~XQ|2m/t#{A|+n%TrtYnJ{cM;X[ewxTv)WIKQfLp.XSy~UL|rkZXbVmQV3`R|HkASMpwORmXTI\qW;_%sMt?q1xziK{UJTyJwHVh|=s~n~gBS6S-Lzv2VXRXg%c9g-pL{!k&TM{=U_q{v4^kUHe${9Ta^#d7Wnx5^RVUy:gUkwUgo>a.ziVnV;gKl3U4N%{na(wN{=X}{i|6OGm,n]L'vzf$u\}3mINho?a[zcK)w&{9\@qHmCo-VN}!ht{'UvqSf^L2xk\6}je`qL[M]HTmY%u{fTfH}!V?}S|!os,b7up`8}hc'T|hRzoxSV4UPppw3n:jSjIm+],e!}P_3lQ_mm8xzw+x`t:T3dZi6^?Y@YoVLY*Ze_ew2Ly_`W;Tz}3Ls[R_JNZnddO{7OCnjN-baWuzIU,xYgismXDcqpehz`Dn^Y"k#kB|;j+hb^om#hqOgr|4V.b7SLz\z5mca,h]hio=t8O[i,QGZIkLh7^X-\kb|VyJZTWt!L:O8uCYhPEcxk1r;O-SahlN4`c^w]2rvs[v~W_xrw)PZf&uT3bg^<\6RUu!N)uy]z]Up_vZrkdqr9l|}*aYJoo*uyl-xBrCvRW"yVpzp`vsiCr+T3J&MCMZMOYDv]nDg4bb_[g1h.|MekztMT8s!irrksWpWO_O@hAhcO"i*PAs+PdTUCq_nkVYtfW7Z{]O]#XYZXpDoXaTqrm[U\UDsWK6bqoU{XSP]Yp3K]U'M,P:QDq3eu{ai`}<|"Z#Z!RoRmbi^\N5rdPQ]Ha7[c_9mEqOs+W,akcGnIazJ{pazZpgLtZ?LmN)UbzePVk_l|_Vwj^4K>o5L=Oro7bhL|p`VFq8b+k5KQXNtwsFW;Q*wJmSWzXEvLQ|]}_eyJ`}r0SstIZ^f:xPh{XUj#VFv[r|d2hZZ\rV{2i-nczn\ju`f}p,WEu`ne[^]pY#iyqDrK`$i9b1ck|(M6L[p:f)MCsYa+oEgi`Es@T?U.]|y@L"e8NRXVy*qQNGvk[~_aXswgW~TV:bXOL`yk}}hWXKbi:hGcMlNl?V'cV_h}an(v}];xQhWynNOl%iUVEM:m=Q>O;l1RiLDY|i>Ql4eHMHnHgIM7yhqrYu[5JFYIX+Ybo\%Vqb~V!Y@X[\=m8_%j-WysxmGuJack^rLxYjFSf[/upN~i6{rbrO9wsYKa]Z9Z{k9Kym``@t<}1_oc#`9}1pKM>m@UpczmdimU]gvT7eg[?bKntW]p+N^gVVLa3hne"\P`5U!U[{KysK%tHzWVei\{P}v{%Z=[blwM^pIvo^1Sn|ChHqqNmytr6d9up\qc%h;r$^LZiJZcY|ZjDy$c]{JoDhLUWk-Y+{YS"U^vvZQ`(iyu/z|kj`2cEUcqnULMYmAXlzkqj1Y7JgSex2S@b_reM,yMM.n.VjW`g.kYOM\{mp^kW%^W_P[Q[#U2p\\hJfxN\\jR[3i[w(c.Wa`:KQe\PAUJX)c$`)iGS]\.x8L.PrXJc/L-TQvLPFJBU:NGJ0zX_:uketo5]*Mrcw{Pw:}a}~v@QEh8dhaALmR>[b`IzMa8J`rIqq^_pDxLnr^IgsbagKcLcxO,o~}%|1zY_R`ZtJq#Nr!vKk|qGsk`|m[aenu^SzKq/P9]CQ1uFjap,vYukp:]?rEw"[vr:JuweKfnS`%NXV/TIiNSBtfK!q2k"q3k4ptK0T2s7{lugn2tmusObpNnLq8euWsceOFO3sXdyOZOMzcfbrnu;J\crNYV0netBXP\nL`UJvJ}VXOt&V>\T[GW~rMqCb^\_\-o+f]y?j.oPtsN,f^NyUtcPM8U}w)\v^*\cr4i\RfivcJgNPwZuw^{JFwHOPaPntitNMU[O;],Nhi4TGd[uAz)^xTwo3S7kxo\uLmU[OqPq2u.Y,UFb#}e{+_ub-v3u5p%a]u"l}m4u8{#[JVYKTezs8k7`lWlq/eaUmWQQrayo<]\vepDtii{soT"L~w<_Mk7PBV-h/o%KiKhzFLgfGj$[IO|bzo^kHu^TU`0oGb/YgyegJOQaHb{oyzr\'`hxjK]0WhX=KZyNxpym`3c3tBjfr6pV[dkgrUW6ThyAWUejiLWiSIb[|-M0L"jvd@P7p!nvWJbKbOz_kKV4tMmRd)j:d"sRMKvfqAmWb{SM5oiz&y=_Gw}x|x+^h[]cbaFQPvfkyZGlx^ix^cuNCzWeHlIs;d.f6o?\=NCXOPzOJsW`GQ.i=hDzObEz8y`\0{)X_e'ynvLvxbql`ZRqLRKO=J?]ovy^4z-Ugq>^@\HQIQ>xvKyTbuSaiX~xLO$}vNPzsL>f.vpUJQ>|qUiM5zPbwtTM#g%[Qb"Wcw&j!PZNk{&[^[eX`j*X`e[VFojxUdwNX`oWmtfMtLcuJda\Hy?|'hDX>K.\wWhp@]MOs\0Yif0fgh?0ijklmnopqr@0sA0tuvwxyB0zC0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y0Z0[0\0]0^0_0`0a0Áb0c0ād0e0f0ŁƁǁg0ȁɁh0ʁˁ́i0́΁ρj0ЁсҁӁԁՁցׁk0؁l0فځہ܁݁ށ߁m0n0o0p0q0r0s0t0u0v0w0x0y0z0{0|0}0~0!1"1#1$1ABCD%1EFG&1HIJ'1KLMNOPQR(1ST)1*1UVWXYZ+1,1ab-1cde.1fghijkl/101m11n21opqrst31uvw41xyz5161718191:1;1<1=1>1?1@1A1B1C1D1E1F1G1H1I1J1K1‚ÂĂłƂǂȂL1ɂʂ˂̂͂΂ςЂM1N1т҂O1ӂԂՂP1ւׂ؂قڂۂ܂Q1R1݂S1ނ߂T1U1V1W1X1ABY1CDZ1[1\1EFGHIJ]1^1K_1L`1MNOPQRa1STUVWXYZabcdefghijklmnopqrsb1c1tud1vwe1f1xg1yzh1i1j1k1l1m1n1o1p1q1r1s1t1u1v1w1x1y1z1{1|1}1~1!2"2#2$2%2&2'2ƒÃăŃƃǃȃɃʃ˃̃̓΃σЃу҃ӃԃՃփ׃؃كڃۃ܃݃ރ߃(2)2*2+2,2-2.2/20212223242AB52CD62E72FGHIJK82LMN92OPQ:2RSTUVWXYZa;2<2bcde=2fg>2hijklmnopqrstuvwxyz?2@2A2B2C2D2E2F2G2H2I2J2K2L2M2N2O2P2„ÄQ2ĄńƄDŽȄɄR2ʄ˄̄S2̈́΄τT2Єф҄ӄԄՄքU2V2ׄ؄لW2ڄۄ܄݄ބ߄X2Y2Z2[2A\2BCDEFG]2^2_2H`2Ia2b2JKLMNc2OPQRSTUd2VWXYZabcdefe2f2ghijklg2h2mni2opqj2rstuvwxk2l2yzm2n2o2p2q2r2s2t2u2v2w2x2y2…z2{2|2Å}2ą~2ŅƅDž!3ȅɅʅ˅̅ͅ΅υЅх҅ӅԅՅօׅ؅مڅۅ܅݅ޅ߅"3#3$3%3&3'3(3)3*3+3,3-3.3/30313ABC2333D4353637383E93F:3;3<3GH=3IJK>3LMNOPQR?3@3SA3B3C3TUVWXYD3E3ZaF3bcdG3efghijkH3lmnoI3pqrstuvwxyzJ3K3L3M3N3O3P3Q3R3S3T3U3V3W3X3Y3Z3[3\3]3^3_3`3a3b3c3†ÆĆņd3e3Ɔdžf3g3ȆɆh3ʆˆ̆i3͆Άφj3Іц҆ӆԆՆֆ׆؆نچۆ܆݆ކ߆k3l3m3n3o3p3q3r3s3t3u3v3w3x3ABCDEFGHIJy3KLMNOPQRSTUVWXYZabcdefghijklmnopqrsz3tuv{3wxy|3z}3~3!4"4#4$4%4&4'4(4)4*4+4,4-4.4/4041424‡ÇćŇƇLJȇɇʇ34ˇ͇̇·χЇч44҇ӇԇՇևׇ؇هڇۇ܇݇އ߇5464748494ABCDE:4;4FGHIJK<4LMNOPQR=4>4STU?4VWXYZa@4A4bcB4defC4D4E4ghijkF4G4lH4mI4J4nopK4qL4rstM4uvwN4xyzO4P4Q4R4S4T4U4V4W4X4Y4Z4[4\4]4^4_4`4a4b4c4d4e4f4g4h4i4j4k4l4m4n4o4p4q4r4s4t4ˆÈĈňƈLjȈɈʈˈ͈̈ΈψЈш҈ӈԈՈֈ׈؈وڈۈ܈݈ވ߈u4v4w4x4y4z4{4|4}4~4A!5B"5C#5DE$5F%5&5GH'5IJK(5LMNOPQR)5*5S+5,5-5TUVWXY.5Zab/5cde05fghijklmnop1525qrstuv35wxy45z5565758595:5;5<5=5>5?5@5A5B5C5D5E5‰ÉĉʼnƉljȉɉʉˉ͉̉ΉωЉщF5҉ӉԉՉ։׉؉G5ىډۉH5܉݉މI5߉J5K5L5M5ABCDEFGHIJKN5O5LMP5NOPQ5QRSTUVWR5S5XT5YU5ZabcdeV5fghijklmnopqrstuvwxW5yzX5Y5Z5[5\5]5^5_5`5a5b5Šc5ÊĊŊƊd5NJȊɊʊˊ̊e5f5͊Ίg5ϊЊh5i5ъj5ҊӊԊՊ֊k5l5׊m5؊n5يڊۊ܊݊ފo5ߊp5q5r5s5t5ABCDEFu5v5Gw5x5y5z5HIJKL{5|5MN}5OPQ~5RSTUVWX!6"6Y#6$6%6Zabcd&6'6(6ef)6ghi*6jklmnop+6,6q-6.6/6rstuvwxyz06162636465666768696:6‹Ëċŋ;6<6=6ƋNj>6ȋɋʋ?6ˋ̋͋΋ϋЋы@6A6ҋB6C6D6ӋԋՋ֋׋؋E6ًڋۋ܋݋ދߋF6ABCDEFGHIJKLMNOPG6H6QRI6STUJ6VWXYZabcdefgK6hijklmL6nopqrstM6uvwxyzN6O6P6ŒÌČŌƌnjȌɌʌˌ̌͌ΌόЌьҌӌԌՌ֌׌،ٌڌی܌݌ތQ6R6ߌS6T6U6V6W6ABCDEFGHIJKLMNOPQX6RSTUVWXYZabcdefghijklmnopqrY6stuZ6vwx[6yz\6]6^6_6`6a6b6c6d6e6f6g6h6Íči6ōƍǍȍɍʍˍj6k6͍̍΍ύЍэҍӍԍՍl6֍׍؍m6ٍڍۍn6܍ݍލߍo6p6q6r6s6t6u6v6w6x6y6z6{6|6}6~6!7"7#7A$7BCDEFGH%7&7I'7(7)7JKLMNO*7+7PQ,7RSTUVWXYZabcde-7f.7ghijklmnopqrstuvwxyz/707172737475767778797:7;7<7=7>7?7@7A7B7C7D7E7F7G7H7I7ŽÎĎŎƎǎJ7ȎɎʎK7ˎ͎̎ΎώЎюҎӎԎՎ֎L7׎M7؎َڎێ܎ݎގߎN7O7P7Q7R7S7T7U7V7W7ABCDEFGHX7IJKLMNOPQRSTUVWXYZabcdefghY7ijklmnoZ7pqr[7stu\7vwxyz]7^7_7`7a7b7c7d7e7f7g7h7i7j7k7l7m7n7o7ÏďŏƏǏp7ȏɏʏˏ̏͏Ώq7ϏЏяҏӏԏՏ֏׏؏ُڏۏ܏ݏޏߏr7s7t7u7v7w7x7y7z7AB{7CDE|7FGHIJKL}7~7M!8N"8OPQRST#8$8UV%8WXY&8Zabcdef'8(8g)8h*8+8ij,8-8klmnopqrstuvwxyz.8/808182838485868788898:8;8<8=8>8?8@8A8B8C8D8E8F8G8H8I8J8K8L8M8N8O8P8ÐĐŐƐQ8ǐȐɐʐː̐͐ΐϐАѐҐR8ӐԐՐ֐אِؐڐېܐݐސߐS8T8U8V8W8AX8Y8BZ8C[8\8DEFG]8^8_8HI`8JKLa8MNOPQRSb8c8Td8e8f8UVWXYZg8h8abi8cdej8fghijklmnok8l8m8pn8qrsto8uvwxyzp8q8r8s8t8u8v8w8x8y8z8{8|8}8‘ÑđőƑǑȑɑʑˑ̑͑ΑϑБёґӑԑՑ֑בّؑڑۑ~8ܑݑޑ!9ߑ"9#9$9%9&9'9(9A)9B*9CDEFGHIJ+9,9-9K.9LM/9091929NOPQR3949S59T69UVW79X8999YZa:9bcd;9efghijkl<9m=9nopqrstu>9vwxyz?9@9A9B9C9D9E9F9’ÒĒŒƒG9ǒȒɒH9ʒ˒̒I9͒ΒϒВђҒӒJ9ԒՒK9֒גْؒڒےܒݒޒߒL9M9N9O9P9Q9ABCDER9S9FT9U9V9GW9HX9IJY9Z9[9\9]9KL^9_9`9a9b9MNOPc9d9Qe9Rf9STUg9VWh9i9XYj9Zabk9cdefghil9m9jn9o9p9klmq9nor9s9pqt9rstuvwxyzu9v9w9x9y9z9{9|9}9~9!:":#:$:%:&:':“Óēœ(:):Ɠ*:+:,:Ǔȓɓʓ˓̓-:.:͓Γ/:ϓГѓ0:ғӓԓՓ֓דؓٓ1:ړ2:3:4:ۓܓݓ5:ޓߓ6:7:8:9:::;:<:ABCDEF=:>:G?:H@:IJKLMNA:OPQB:RSTUVWXYZabcdefC:ghijklmD:nopqrstuvwxyzE:F:G:H:I:J:K:L:M:N:O:P:Q:R:S:T:”ÔĔŔƔU:V:ǔW:ȔX:ɔʔ˔Y:Z:̔[:͔ΔϔДєҔӔ\:ԔՔ֔הؔٔڔ۔ܔݔޔ]:ߔ^:AB_:`:CDa:EFGb:HIJKLMNOPQRSc:TUVWXYd:Zabe:cdef:fghijklg:mnh:oi:pqrstuj:k:vwl:xyzm:n:o:p:q:r:s:t:u:v:w:x:y:z:{:|:}:~:•!;Õ";ĕŕƕǕȕ#;$;ɕ%;&;';ʕ˕͕̕Ε(;);*;ϕЕ+;ѕҕӕ,;ԕՕ֕וٕؕڕ-;.;ە/;0;1;ܕݕޕߕ2;3;4;ABCDEFGHIJKLMNOPQRSTUVWX5;6;YZ7;ab8;9;cdefghi:;jk;;<;=;lmnopq>;rstuvwxyz?;@;A;B;C;D;E;F;–G;H;ÖĖI;ŖƖǖJ;Ȗɖʖ˖̖͖ΖK;L;ϖЖіM;ҖӖԖՖ֖זٖؖږۖܖݖޖߖABCDEFGHIJKLMNOPQN;RSTUVWXYZabcdefghijklmnopqrO;stuvwxyzP;Q;R;S;T;U;V;W;—×ėŗƗǗȗɗʗ˗̗͗ΗϗЗїҗӗԗ՗֗חؗٗڗۗܗݗޗߗX;ABCDEFGHIJKLMNOPQY;RSTUVWZ;XYZ[;abc\;defghij];^;klmnopqrstuvwxyz_;`;a;b;c;d;e;f;g;h;i;j;k;l;m;n;o;p;q;r;s;t;u;v;w;x;˜ØĘy;z;Ř{;|;};ƘǘȘɘʘ˘~;!<̘͘"<ΘϘИ#<јҘӘԘ՘֘ט$<%<ؘ&<٘'<ژۘܘݘޘߘ(<)<*<+<,<-<.=?=@=A=B=šÚĚŚƚǚȚɚʚ˚͚̚ΚϚКњҚӚԚ՚֚ךؚٚښۚܚݚޚC=D=ߚE=F=G=H=I=J=K=L=M=N=O=P=Q=R=S=T=U=V=ABCW=X=Y=DEZ=FGH[=IJKLMNO\=]=PQ^=_=RSTUVWXYZabcdefghijklmnopqr`=stuvwxyza=b=c=d=e=f=g=h=i=j=k=l=›ÛěśƛǛțɛʛ˛̛͛ΛϛЛћқӛԛ՛֛כ؛ٛڛۛܛݛޛߛm=n=o=Ap=BCq=r=Ds=EFGHIt=u=JKLv=MNOPQRw=x=STy=UVWXYZabcdefghiz=jklmnop{=qrstuvwxyz|=}=~=!>">#>$>œ%>&>ÜĜ'>ŜƜǜ(>Ȝɜʜ˜̜͜Μ)>*>ϜМќ+>ҜӜԜ՜֜ל,>؜ٜڜۜܜݜޜߜ->.>ABCDEFGHIJKLMN/>OPQ0>RSTUVWXYZabcdefghijklmnopqrstuvwxyz1>2>3>4>5>6>7>8>9>:>;><>=>>>?>@>A>ÝĝŝƝǝB>C>ȝD>ɝE>ʝ˝̝͝ΝϝF>G>НѝH>I>J>ҝK>L>M>ӝԝ՝֝N>O>P>םQ>R>S>؝ٝڝT>U>۝V>W>ܝݝX>ޝߝY>Z>[>\>]>^>_>`>a>b>c>d>e>f>g>h>Ai>j>BCDk>EFGl>HIJKLMNOm>PQRSTUVWXYn>o>Zap>q>br>s>t>u>cdefgv>w>x>y>z>{>|>h}>i~>j!?"?kl#?mno$?pqrstuv%?&?w'?x(?yz)?*?+?,?-?.?/?0?1?2?3?4?5?6?7?8?9?:?;????@?A?B?C?D?E?F?G?H?I?J?K?L?M?N?O?P?Q?R?S?T?U?žÞĞŞƞǞV?W?ȞɞX?ʞ˞̞͞ΞϞОўҞӞԞY?՞֞Z?מ[?؞ٞڞ۞ܞݞ\?]?ޞߞ^?_?`?a?b?c?d?e?f?g?h?i?j?Ak?BCDEFGl?m?HIn?JKLo?p?q?MNOPQr?s?Rt?Su?TUVWXYv?w?Zax?bcdy?efghijkz?{?lm|?}?nopqrs~?!@tu"@vwx#@yz$@%@&@'@(@)@*@+@,@-@.@/@0@1@2@3@4@5@6@7@8@9@:@;@<@=@>@?@Ÿ@@A@B@C@D@E@F@G@ßğşH@ƟǟȟI@ɟʟ˟̟͟ΟϟJ@ПџK@ҟӟԟ՟֟ן؟ٟL@M@ڟ۟N@ܟݟޟO@P@Q@ߟR@S@T@U@V@W@X@Y@Z@[@\@]@^@_@`@a@b@c@d@e@f@g@h@i@j@ABCDk@l@Em@n@o@FGHIJKp@q@LMr@Ns@Ot@PQRSTUVu@WXYZv@abcdefw@ghix@jkly@mnopqrstuvwxyzz@{@|@}@~@!A"A#A$A%A&A'A(A)A*A+A,A-A.A/A0A1A2A3A4A5A àĠŠƠǠȠɠʠˠ̠͠ΠϠРѠҠӠԠՠ֠נؠ٠ڠ۠6A7Aܠݠ8Aޠߠ9A:A;AA?A@AAABACADAEAFAGAABCHADEFGHIJKLMNOPQRSTUVIAJAWXYZabKAcdeLAfghMAijklmnoNAOApPAqQArstuvwRASAxyTAzUAVAWAXAYAZA[A\A]A^AA_ABCDEFG`AHIJKLMNOPQRSTUVWXYZaAabcdefgbAhijklmnopqrstuvwxyzcAdAeAfAgAhAiAjAkAABClADEFGHIJmAKLMNOPQRSTUnAoAVWpAXYZqAabcdefgrAsAhtAiuAjklmnopqrstuvwxyzvAwAxAyAzA{A|A}A~A!B"B#B$B%B&BAB'BC(BD)BEF*BGHIJ+B,BK-B.B/BLMNOPQ0B1BRS2BTUV3BWXYZabc4B5Bd6B7B8Befghij9Bklm:Bnopqrstuvwxyz;BABCDEBHIJ?BKLMNOPQ@BABRBBCBDBSTUVWXEBYZabcdefghijklmnopqrFBstuvwxGByzHBABCDEFGHIJKLMNOPQRSTIBJBUVKBWXYLBZabcdefMBNBgOBhPBiQBjklmRBSBnopqrsTBtuvwxyzUBVBWBABCDEXBFGHYBIJKZBLMNOPQR[B\BSTUVWXYZabcdefghijklmnopqrstuvw]Bxyz^B_B`BaBbBcBdBeBABCDEFGHIJKfBgBLMNOPQRSTUVWXYZabcdefghijklmnopqrshBtuvwxyziBABCDEFGHIJKLMNOjBPQRSTUVWXYZabcdkBeflBgmBhijklmnopqrstuvwxyznBoBpBqBrBsBtBuBABvBwBxBCDyBEzBF{BGHIJKLM|B}BN~B!C"C#COPQRS$C%CTU&CVWX'CYZabcde(C)Cf*C+C,Cghijkl-Cmno.Cp/Cq0Crstuvwx1Cyz2CABCD3C4CEF5CGHI6CJKLMNOP7C8CQ9C:C;CRSTUVWCZab?Ccdefghi@CACjBCkCClmnopqDCrstECuvwxyzFCGCHCABCICDEFGHIJCKCJKLCLMNMCOPQRSTUNCOCVPCWQCXYZabcRCdefSCghiTCjklmnopqrstuUCvwxyzVCWCABCXCDEFGHIJYCZCK[CL\CMNOPQR]CSTUVWXYZabcdefg^Chijklmnopqr_C`CstaCuvwbCxyzcCdCeCfCgChCABCDEFiCGHIjCJKLMNOPQRSTUVWXYZabcdefkCghilCjklmCmnopqrsnCoCtpCuqCvwxyzrCsCtCuCvCwCxCyCzCABCD{C|CE}CF~CGHIJKLMNOPQRSTUVWXYZabcdefghijklmn!D"Dop#Dqr$D%D&Dstuvwx'D(Dy)Dz*D+D,D-D.D/D0D1D2D3D4D5D6DABCDEF7D8DG9D:D;DHIJKLMDghijklmnopqrstuvwxyz?D@DADBDCDDDEDFDGDHDIDJDABKDCDELDFGHIJKLMDNDMODNPDOPQRSTQDUVWRDXYZSDabcdefgTDUDhVDWDXDijklmnYDopqrstuvwxyzZD[D\D]D^D_D`DaDABCbDcDDEdDFGHeDIJKLMNOfDPQRSgDTUVWXYhDZabcdefghijklmnopqrsiDtuvwxyjDzkDlDABCDEFGHIJKLMNOPQRSTmDnDUVoDWXYpDZabcdefqDrDgsDhtDijklmnuDopqvDrstwDuvwxyzxDyDzDABCDEF{D|DGH}DIJK~DLMNOPQR!E"ES#ET$EUVWXYZ%Eabc&Edef'Eghijklm(Enopqrstuvwx)E*Eyz+E,E-E.E/EABCDEFGHIJKLMNO0E1EPQ2ERST3EUVWXYZa4E5Eb6Ec7Edefghi8E9Ejk:Elmn;EEu?E@EAEvwxyzBECEDEEEFEGEHEIEJEKEABCDEFGHLEIJKLMNOPQRSTUVWXYZabcdefghijklmnopMENEqrOEstuPEvQEwxyzRESETEUEVEWEXEYEZE[E\E]E^E_E`EABCDEFGHIJKLMNaEOPQRSTUbEVWXcEYZabcdefghijklmnopqrstudEeEvwfExyzgEhEiEjEkElEmEnEABCDEFGHoEIJKLMNOPQRSTUVWXYZabcdefghipEjklqEmnopqrstuvwxyzrEsEtEABuEvECDwEEFGxEHIJKLMNyEzEO{EP|EQRSTUV}EWXYZabcdefghijklmno~Epqrstuv!Fwxyz"F#F$F%FABC&F'FDEF(FGHIJKL)FMNO*FPQR+FSTUVWXY,FZabc-Fdefghi.F/Fjk0Flm1F2Fn3Fopqrs4F5Ft6Fuvwxyz7F8F9F:F;FF?FABCDE@FAFFBFGCFHIJKLMDFEFFFNGFOPQHFRIFSTUVWJFKFXLFMFNFYZaOFbcPFQFdeRFfghSFijklmnoTFUFpVFWFXFqrstuvYFZFwxyzABCDEFGHIJKLMNOPQR[F\FST]FUVW^FXYZabcd_F`FeaFbFcFfghijkdFeFlmfFnopgFqrstuvwhFiFxjFykFzlFmFnFoFpFqFrFsFAtFBCDEFGHIuFJvFKLMNOPQRwFxFSTyFUVWzFXYZabcd{F|Fe}Ff~Fghijkl!Gmnopqrstuvwxyz"GABCDEFGH#GIJK$GLMNOPQRSTUVWXYZabcdefgh%Gijk&Glmn'Gopqrstuv(Gw)Gxyz*G+G,G-G.G/G0G1G2G3G4GABCDEFGHIJK5GLMNOPQRSTUVWXYZabcdefghijklmnopqrs6Gtuv7Gwxy8Gz9G:G;GG?G@GABCDEFAGGHIBGJKLCGMNOPQRSDGEGTFGUVWXYZabcdefghijklmnopqrstuvwxyzGGHGIGJGKGLGMGNGOGPGQGRGASGBCTGUGDVGEWGFGHIJKXGYGLMZGNOP[GQRSTUVW\G]GX^G_G`GYZabcdaGefghijklmnopqrstuvwxbGyzcGdGABeGCDEfGFgGGHIJKhGiGLjGMkGNOPQRSlGmGTUnGVWXoGYZabcdepGqGfrGgsGhijklmtGuGnovGpqrwGstuvwxyxGyGzzG{G|G‚ƒ„…†}Gˆ‰~G‹Œ!HŽ‘’“”"H–—˜™š›œž#H$H %HABC&HDEFG'HHI(H)HJ*HK+HLMN,HOP-H.HQR/HSTU0HVWXYZabcde1Hf2Hghijkl3H4Hmn5HopqrstuvwxyzÁÂ6H7HÅÆÇÈÉ8H9HË:HÍÎ;HÐÑÒÓÔÕÖHÚÛÜÝÞ?HàA@HBCDAHEFGHIJKLBHMCHNOPQRSTUDHEHVWFHXYZGHabcdHHefIHghJHiKHjklmnoLHpqrMHstuNHvwxyzāĂOHĄąĆPHĈĉĊċČQHRHĎSHĐđTHēĔĕĖėĘęĚěĜĝUHğĠABCVHWHDEXHFGHYHIJKLMNOZH[HP\HQ]HRSTUVW^H_HXY`HZabaHcdefghibHjkcHldHmnopqreHfHstgHuhHiHjHkHvwxyzŁlHmHnHoHŅņpHňqHŊŋrHōŎsHŐőŒœŔŕtHuHŗŘvHŚśŜŝŞwHxHŠyHABCzHDEFGHIJ{H|HK}HL~HMNOPQRPKVKgKOMhM-N{O"P8PPP]PTQUQXQ[Q\Q]Q^Q_Q`QbQcQdQeQfQhQiQjQkQmQoQpQrQvQzQ|Q}Q~Q"R#R'R(R)R*R+R-R2R>RBRCRDRFRGRHRIRJRKRMRNRORPRQRRRSRTRURVRWRYRZR^R_RaRbRdReRfRgRhRiRjRkRpRqRrRsRtRuRwRxRfT|T%U+U.U8VMVKWdWE[d[%\%]U]t]|^~^3_a_h_q`-amauc!d)d.e1e2e9e;e#?#@#A#B#C#D#E#F#G#H#I#J#K#L#M#N#O#P#Q#R#S#T#U#V#W#X#Y#Z#[#,!]#^#_#`#a#b#c#d#e#f#g#h#i#j#k#l#m#n#o#p#q#r#s#t#u#v#w#x#y#z#{#|#}#&"K!L!~!~#M!\#h!l!'!c!@!A!$("(((&(:(,(*(0(.(B!4(2(9(!(%('()(-(1(#(+(/(3(5(6(7(8(&!%!@AB!&"&#&$&%&&&'&(&)&*&+&,&-&.&/&0&1&2&3&4&5&6&7&8&A&B&C&D&E&F&G&H&I&J&K&L&M&N&O&P&Q&R&S&T&U&V&W&X&''!'"'#'$'%'&'(')'*'+','-'.'/'0'1'2'3'4'5'6'7'8'9':';'<'='>'?'@'A'Q'R'S'T'U'V'X'Y'Z'['\']'^'_'`'a'b'c'd'e'f'g'h'i'j'k'l'm'n'o'p'q'W'\C*!,!.!/!0!1!E-!k!d!e!Fy!f!GHm!Yq"r"s"t"u"v"w"x"y"z"{"|"{!|!z!}!IJKLJ!G!F!ML!X!^!NO!ON!D!E!I!H!R!S!`!_!C!K!W!V!U!PY!T!\!]!QRZ![!Q!M!SP!Y"Z"["\"]"^"_"`"a"b"E"F"G"H"I"J"K"L"M"N"O"P"Q"R"S"T"U"V"W"X"1"2"3"4"5"6"7"8"9":";"<"=">"?"@"A"B"C"D"$)%)&)')()))*)+),)-).)/)0)1)2)3)4)5)6)7)8)9):);)<)=)>)?)@)A)B)C)D)E)F)G)H)I)J)K)L)M)N)O)P)Q)R)S)T)U)V)W)X)Y)Z)[)\)])^)_)`)a)b)c)d)e)f)g)h)i)j)k)l)m)n)o)TUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~v!u!x!w!t!s!p!r!q!o!n!b!a!!!"!#!(!)!e4!5!6!7!8!9!:!;!>!?!~!2!3!$?$@$A$B$C$D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T$U$V$W$X$Y$Z$[$\$]$^$_$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$abfg!%"%#%$%%%&%'%(%)%*%+%,%-%.%/%0%1%2%3%4%5%6%7%8%9%:%;%<%=%>%?%@%A%B%C%D%E%F%G%H%I%J%K%L%M%N%O%P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%m%n%o%p%q%r%s%t%u%v%$!`cdE(F(G(H(I(J(K(L(M(N(O(P(Q(R(S(T(U(V(W(X(Y(Z([(\(](^(_(`(a(b(c(d(e(f(g(h(i(e"f"g"h"i"j"k"l"m"n"ZIJKLMNOPQRST;R!6@_FABCrMIU}HOIBO"X;2kSD$Xs3E(WRG'X@JFpG{15RT4+6?K)XGHI*6J=AOQK%I-XLv8>Q\cPVMNa7O.4PYAQ/XTUVKDWC>X1X4CeRY.VZN'Uu:&7V@Z9FREGG[T9\K3RR]^?XE>rF2R0OgO_`abiJcd@XefghijrBRBkiHlmnopqrstu,Gvwxyz{|KA}hSyU~BJ~6!XZSw?FT%;AXeN.>(XGQ)P=XoYvM:?;=%:`Rz2`:6DmO)>$MAAWGqYtYKHiXZR2JJHlXjXFXv=MFp3kXq=i=THS4XBV2PWKJ{KLU68IOZYpX*GnXz4nATRmXGRoXGCvQYVrXuX~<[j=Yklmn:Yo30pqrBYstuvwxyz{|}~DY61?Y95s>HLr:PRCYh=+3EYk>FY;Y_D>YAY@Y.U5VcGHYYŃƃkHǃȃ+HɃʃK0+9yAbY˃<@29̃X9KPx1dF_>d5HW̓xQf<^J΃σ=)Eރ߃Z9#Z)T$Z{Y,6k7y1|Ye3v>v?1Rd@36~Y}Y;>`FFO-?K;PQJ5RI[WPS9M<0v3w;J[/:TdT65s5VXPHUVV7PGWXW/?XY;[XXZ[LP.;\]^>kPAuArTU844_u3`a>IbcdPEefgYE{@hp1iYXN9j=5klZXmnFV"K/H2IL4L?ot9p[X\Xg6A#Jt<18n8bXK=dXcX|EeXfX&A0Hl0&9S[?[x@">M@„Ä@[FJĄńƄ*2DŽȄɄBSʄcC˄+Q̄̈́΄τB[ЄU@ф҄ӄC[Ԅ1?Մքׄ؄لڄ6PraZstuvdGwx'3yr6|Lz@z{w@|9QaQGX}~^2e@q:HX-TaOIXJXCOx3G>KXL[%HXO~HN2VSf20mA6_5_;VP=YUH0#6I?(L3_7JRSOX6RE:>K>L7_p54_uST3w8:_O:*_ALMwRM7A_…D_Åąq7I0V6T7Ņ,:}LT?1KtFƅ(VE_DžbN33ȅɅ|N54ʅGNp:˅aN̅=Qͅ΅@_υЅt4хJ3҅f8;_ӅԅՅօEDׅ<_=_>_;E?_B_1TC_؅:GXNمڅۅ܅݅XDޅJ_߅O_\VI_Z_6NG:N_H_^EkIt:|CW>F_M_XE&UM:L>=S@8dVG_>9'?|AK_L_P_@[_e_AW_V_IWc_d_ke'RR_B)?C[TDH?T_EFGLOHI]_JJQK^_'07FS_Le:M_6[M~9UTNO__lO%0g_Q_FQU_X_Y_\_P);Q`_a_Rb_f_h_4SSTUVWg86Ej_ZI(ADDXY^?xOZ[\\Un_]^_`ab82c_:l_dA[edQfghitK=4j&0klmnoq_FLr_pqm_rstuvwi_xyz{k_|o_p_=;}~s_t_#;[J(N'`*3&`!`~_YM|_z_P?DWLIx_!0}_{_"`(`H7!F6I2@u_>EDXy_vD#`$`%`%P4`dL1`&?/`9N+`FI.@.`m:0:)`v_3`8`-49`2OH:0`†ÆĆņƆdžzPȆɆʆˆ̆͆ΆφІ,`ц{T҆w_ӆgEԆ-`ՆwSֆ6`7`׆؆نچۆD`aP܆݆ކ<`߆I`J`>`*`$IA`2`HJC`5`KNCKM`F`B`K`:`?`@`E`G`H`L`;`TKU`V`R`@AP`Ncd;7eP[.L2?5;xWS?fghiji?kla<3L^[S0kNX79WBFmn$@o9Lpg[a[:Fc[qh[rwEstuj[vwi[@?xyzf[e[{|}~94,@"Bb[d[MPm[]@r[b6s[R[89+Tl[Q?p[Q[f5k[e?n[q[y[!9#0qBG3o[x[RFt[u[w[v[~[rS:2}[ˆÈĈ$\ň{[ƈLjȈɈz[ʈˈ̈|[`Ey;͈Έ#\ψЈ%\шCL҈ӈԈQ6@]Ոֈ׈!\؈"\وڈۈ5G܈݈ވi6߈'\&\)\$1L50?_QB6@ABCDE(\FGHIJKLzKskMNO\KPQ~KRSTALUVWXY{HZ[\]^_*\`abcdnL+\efghijklmnopqrstuS[v/\,\w3>x{Jyz{-\|}~JI9D=G.\vTfP+DU6T[Z1U[V[>:‰ÉĉʼnƉljȉɉ@Hʉˉ͉̉Ήω?JIHЉ3WщyI҉ӉG?ԉՉx:։׉8hBlQHmn{eopqrJ6KoI͊Ί7fϊp6ЊъҊdCӊԊՊ֊׊؊يiS4fڊ5fۊ"H܊݊ފߊ=f9fEFqM;ffABCD:fEF7@GHIJKLMNO$S?ftICfPQDfRSTUvPVWXYZ[\]^_`abcdefg=ChijklmnDCBfopqrstuvwxyz{|Af}~Gf1OtkJfEf^<)I5eg4T6BK0Q<5YJb7dI+=>NpW!PYI{6Xfb<>3PIYf"3L^HSM^"RN^M>O^,J|R_3jeaD!>2NrDV>(Fc2ŒS>ÌČ|GkLl=]NŌƌ:JAFleaUVWXYZz{|}~@aAaGag3iF^4BQHaFaEaCaBa@18UDaKaLaJazoSaRa6GIaNaÍPačōƍǍȍɍʍˍ͍̍΍TaύQaMaЍэOaҍӍԍՍUa֍׍؍ٍڍۍ܍ݍލߍVaWaXa@ABCDEFGHIJKLMNOPQRSTUZaVWXYZ[\]^_`ab[acdefghi!Njklmnopqrstuv]gw(4]Vxy2Q23z{$9sWIG^>.9|WN}~n2O[:}4_a\:`a2;IBaalP=MbaC5GEcadaÏďŏƏySǏȏɏʏˏ̏ea͏-QΏϏfa"NЏяҏӏԏՏga֏B5׏؏ُڏhaU;ۏ܏ݏޏߏDP`bX1dRabIV|M&CCcRVgbhbGSlbl?mbeb@3nDnbCPv:ib^73;,LKKdbfbjbkb@AwbBCtbuTsbDE-EFzUBE@2GHobIrb/AoMs;hL/c1c'O.c)N];k5e>R2M391+cQ2,5_9h6kO7cL;ÐĐGHJPŐƐǐȐɐ8cn3ʐː̐͐)mΐzSdSϐАѐ*m9cbRҐӐԐՐ֐5cאِؐڐ^SېܐݐސP83cߐ6c_74c"@:c8T@H4A;cBE;CwIDEeIFGH=DIJKLMNO+mPQRS}BTUVW[;.?XYZ[\]^?N_`abc~-m?c):,m=c@c6:.68PC0.m/mA@Ac3E‘ÑđőƑǑȑɑʑˑ̑͑ΑϑBcБёґӑԑՑ֑בؑ2\ّڑۑܑݑޑ0mߑj8lN'jgPyJVH7OI3RNd=^cr;(j=U]F)j*j,j+j.j-jX=/j>BA4w4';flel?7yKb1glHIhlilVJP^E2zT@AKFG0r4SHBCDPMEF8?GHIJKLM[?NO$G4VP)@Q^(IoQ$Eg063EHQRb0STv7UVzEWXs6YRUP3<Q0abcdefVRcJ%Wg6M669?[Uh'8WEijkR^Y?UB@Gl$;(1mnjEop{E'Lqrst'1uvwV5xyz(D{S^:Qi3|rC}~w7tV#5p24DiD-@T^h0DE`AU9\>XMN0OMV^P>>WU^PU]0bD#Bp<5S9@!E&2qT(@CJW^|U09-H)KY^=?4F'W0JCDV3R98V|j40f?tLZM?VNBNN"L.PSD25X^uU762’ÒĒŒƒǒȒɒL@pKʒq<;;75˒̒͒uEΒf^ϒВђc^]>ҒӒ_^ԒՒ֒ג74]=ْؒ`^mDڒےܒݒFOޒ`5ߒ^6ZJt5e^FUa^ML~FEE4Rr>SB=L83S=X?FMZQk4d^]^g^~j0Bb^@V'5t2h^r^@ABm^Cq^DE`HFGHaWo^hCaLIe2JKL>RMNOPQRSn^Tk^UNU'4VWXYZ+?>>[\R=]^_`i^a.Tb^^cj^defg?@hl^s2i8'BijA=klmnou^x^pq+2$4rsj4&Ituvwxyv^QKzc8{w^z^|}~y^BLa0n4:e/Pk2!kt^cIs^Z0!Rw1/Lp^$K*U{^]4&D}^~C!D!_“ÓLAē|^o>œ2FƓǓȓɓʓ˓͓̓ΓE3vHϓГ:K~^ѓғ$_ӓԓՓ֓2Wדؓٓړۓ73ܓݓޓߓCAKG%2i4+WlD"_#_%_3:&_^@CIY2fG'_\G(_"k@ABSKCDE*_F)_GA2HIJKLMNOPQRSTUVWXYZ[\]^_`JEabcdefgh+_ijklmnop\TqrstuAHvwxyz{|}~,_p>-_'V7j6kUJ|XD8%9E7~UJ9'PMtP5tCH>7k=0L=2AV1(3R8"IX68k4>}JCG{Us7”ÔDNĔŔƔ+Us1ǔȔɔ3l_0ʔ5l˔͔̔76ΔOAϔzu1PДєeUҔSNӔԔo=b3Ք+8֔6Uה=mؔO6ٔ9KBPڔ۔ܔݔޔߔ=76l)JTE9l8lCB7l}P:l;leWjLM%@NOP;jQ}2RwCh;STUWRtN?jVWXzNgG'>PjGV@A]TQj>ORjnJ/E50TjSj_t:D)1•Õĕŕ_eƕǕȕɕUjʕ˕͕̕ΕϕЕѕҕӕԕՕ֕וٕؕڕەܕݕޕߕoJVjWjXFXjYj;TzG7R|8Bj\2|BxTfLnW@ABCBTPSCksED~7EFTkGHI7K^kJJ@KLM{MN/3OZFPQRSTU|kV>DW4N)D>1}TXuJYlVZ[SFd6\]^_z;`a`Pbc1IdST(HefK8g>hHaHOhThVhq9XhuW{D\hi2Qhm<–ÖB?MhyVĖxAq2ŖƖǖȖɖʖ˖̖_h͖AJYhΖϖЖі$UҖj1;UNhPh06ShӖ]h8@ԖwJՖ(K֖ז\Fu@ٖؖږۖܖihݖޖߖ#PrhjV`hahyQK:y8q8TTohnhlhp9RLfh&Nr?80qhph@Wdh)M#I8;[=jh@ABCbhcheh55ghEGkhmh0=.WDxhEFGHIJKLuhM0MvhNOPQRSTUV:AWhhX7Cp0YZ[\]^_`thabcwhdef#9ghijklmnopRIqrsNC`Nf@tuvwsKx]L5PyzaJ{sh|}~lir?istuAivwqAxy6Hz{|=i}~BiCi3i6i1;@iw69XH1O1Q1~EP1+C1U$kA:šÚĚ:LŚƚǚ%kȚ'kɚʚ˚(k͚̚Κ&kϚКњҚӚԚ՚)k+k*k֚ךؚٚښ,kۚOJ5XqCܚ%CxF-kJDݚ.k/k0kU7ޚߚz71kbG3k$:uQ102k4k*5HBhG5k.K_c@S[Y!M-VsG`Yc;::bc+O`cGI9:@A4QacjH/9-=X3[NBC@LDEFhcictMGHIJK-LL3jk{cucS:lmnoP7MSpNVSUA94UXQqrst9PvGuvw*H42xZCyz{nc|}|coc(7wctc~:7"Evc]E(2|F`D"Wa@yczc}c)Lsc>SC14mqcrcxc:PCFsT~c`='d&dsQ#d)dwH4O(d.deB46r="di:*d,d}6^V2d-d!dn;]M"GIEwA$d3G,===%dGWb2+dC4XYZl;[MQ\mL5m]^_`abcdeGefgh(TiKdUWBdj%=EdklfSmIdxIno>dpqeSrs~GI6t|T32WduvwBNxMdyžÞFWĞVTS2>lŞƞǞȞAjɞʞ˞/B64̞͞ΞWQϞОў43Ҟ2H;?@lӞԞKV՞֞?lAlמ؞ٞڞ۞ܞݞޞߞElf>?LZE<>Fl~1Dl(Uc5Bl6Ac3Cl8KC@~LRAHlf:S@rV@ABLQCDEF>?G37UIGlb;HLL}=HHI)OJKLMNOPiMQkERSTi7UVWXYZ[\]^_IQ8:`abcdIlefJlg@;Klhbl:1Y7ijklmnopqrs9=tuvwxyz{LlfQMl|}~;HQlSlM;e0ݟޟߟWlXldl88/RV0y53X,K]c,Ff0FE9k:k;k@Q#Erj2D5DN@sjADoNpjtj|I#GXL~Nujvj,Og@wj àĠŠƠ?6xjǠyjȠzjɠʠ{jˠ̠͠ΠϠРѠҠӠԠՠ֠qjנؠ٠ڠ۠ܠݠޠߠ.Hka87lama4WnaoaLSqaq?paR571sara|:ta79Q>@A|DB]:F=CDEFGHuawaIJ@6AO(JvaxU|Sxa|ayaKLzaj@M~a!bG@NOPQ{aR}aSTUVWX%bYZ[TA\]^_#b`(b~2"babcMCB2'b&bde$b)bfg+bhijIPmV(C,bkWOlm.bnoo:pq`i-b*brstu+;3Tvwxyz{|}~0b/bai1b2b3b!L4b@ABCDEFGHIJK5bLMNOP~PQRJBSqSTuMUV`gWXagYZ[\A>]^_`jBabcdgdecgfghijkfMl5Cmnbg7;VOoaAigpqrhgsttg#2uvwxjgyfgz{|}~lgkg:IdUeg)7ggngsgiVmgrgqg`0ug@ABCDEFGHIJrGKE@m@LMpApgNOPQvgvKRSTUVWXYZ"h!h[\]^_`AWabzgygc{gdwge~gf}gg|ghiUAYG}ECEjklmnmGopqr#hstuvwxyz{|}~&h%h'hw:xg$hpH*I)he9~Q(h@AB*hC-h.hD'AEFG/hHIJ0hKL,hM4hNOPQRSTUVWX+hY1hZ[\]^_`a5h2h3hbcdefghijklmnopq7hrstuvwxyz{|}~6hO9,p-p0Fj0?H_MMN1j@2jA?FI4BCDEFGH3jIJKLgUMNOPQRSTy]U4jV5jW6jXYZ[J80_uI\pL]^zI_`abc{IdeCS&Kf&8.pB1g8eoLISWJK^pL1E]pqQM`pL0j=NOPQR_R_pS/4h7fpep#FapbpC4TUcpnUVW[LR>2,H\]jp^_`awQbLV[:ipc;6de4Mfg&Fhij!Akpnpkmppplpl>;opmnop5LrpqrU3stuvT1wxspyztpvpa4{qp|wp}~zpxpup}pyp|p~p!qAN$q#qvA{p]Jq4q11L&q'q,qNU)q3H"q+q(q%q*q@ABCDEF)0-qGHIJKL/qM1qNOPQR0qS.qTUVW"QXYZ[\]^2q_`a3qbcdefghio9jkG5lW0Y0mnomTpD5qT=J;'prs^8tu(pvw(0x)pyznM{|*p}~+p$FeVdqeqsC[S@QVhEA/SBfRCDAn;05UNQ`xmwL[QEWvU|m{mymzm}m&>@ABC/K!n=6D"n@DE~mFG^=G2HIJKLMNOPQRSC6TUV%n:X#n&nWXYiCr3Z[\]^_'n$n9O`a(nwBbcdefghijklm)n*nn+^op3FqFGruVI5s2Ktuv+nwx+My,nz{|}~0U-nDvG[#4,Cfq8JSR*V@roAX>BC=soL6+0CDEF/JGH6mI7mJKLMyN/7s?8mkB0INOPQRS9mTUvF3?VWXmefiEghiFFjkiIRTAmBmCmEmly@m!4nopqh9rPmstuvQmwJmxOmyxNz{6KLmMm|}~uORmrA2SKm7HoJjlq@igIjklnFklmnllomFmlpqrstuvwxplyzfWsl{|qlnlol#WqInKtl}rl~iOvl1F@5Z<|;Xe8YZ[\]^BD_`abcdefgh#pijklmkKnopqrstuvwxyz{|}~&p(Q?>nG6q7qU?)48q;MTG-U9q:qOG$ROV;qQ=04=>\4QN_?=q@Az?q@qFGHIJAqKLMNOPQRSTU~AVWXYZ[\]^_`"AabcdefghijzJkl>Umnop:>9>BUqr"?s/M5qtuvwxy_=zK6{|}~qVCsDsM8FsGsJ0EsIsqKKs&PJ1HsOsQ5WsRsTsSs{7?1NsJsZ5Ps@AQsBUsCDEFMsGc2&t%t@ABCDEFGHI.b4TtUt+>@AVtBCD[tEWtZtF}:GXtYtHIJKLMNb8GL\tOZ2PQSCRScT7?TUVWXYZ]t[\]^_`4Eabcdefghitij5OklmnopqrstuvwxINyz{|}~XKwKt=OW[@@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvuPwxyz{|}~jt@ABCDEFGHIJKLktMNOPQRSltTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~cw17mt@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abckWdefghijklmnopqrstuvwxyz{nt|}~yf@>zfl:{fKO|f*gs0^Ha=+gFH,gf;x8$Q-ggBx>J=3M.g/gn>ePgKPLL<0g(g?g)<@gAg6gP6BgCgDg:;^5FB`1Eg5TFg?8HgGgl7Igx2JgKgLgMgNgOgPg'SuKQgRgSgTgIIUgVgWgXgYgI=Zg>sW81H?s@sAs^9xMhX1:@^B7nA#7BCDE9nF8nU0GHIJK;nVUoWLMNCVOP=npJQnVWXY@nZ[?n\]^_`abcrQd‚ƒ„…†‡ˆ‰Š‹ŒŽyqO4‘’“”zq–—˜™š›œžŸ @2m1mAB`K^RCAKXUDbHE_@!7FkUGk90O?VEk}SWHkXYIkZ[N7\BkDkvIWVMU2POk8NPk](5^_`ab31Rk%LcdefghiVESkjQk_ENk$JUk{0klz:mn7XcqoJkKkLkMkVk@fYkph?HRWk\kl8Xkq:=rXPs70t]k\Duvwx,Vyz{`4|}vB9<~ÀZk[k`TjFTD_k'EuY12dkE=ÅÆbkÈÉÊËÌÍÎÏÐÑÒÓckÕ,8QMekØÙak3AÜÝÞß"F@ABCDEsLFfkG0@8RgkHIJ/8-8Khk;GsMLMNjkkkOPQRSmkTUVWHPXrkYnkZ[\qkyH]|Qlk^_ik`abc98YOeDokpkZLHMr0dvkefghiukj22klmn`8owkpqrstul1vwEL$D%Oxyz{|yk}~"lrEzk㥹ĆćĈĉEIċČčĎď_b~kđĒēNM!l[17Sĕ\RėĘ}k{kěĜĝĞğĠ@ABCDEFGHIJKLMN<3OPQ0jRSTWT+tt3UVWXYAVBVZ[\]^_iUJ>`'ta(R(t)tb*tK>_Scdefg`IaIhiBsjfJkrLlmnopq6b4KrhN[Vs-t.t/ttuvw2tx=:3tc00ty1t"=U2z6t7tf602OO4t,4{5t|}8t~ŀŁłŃ9tŅ'M:t;tʼnŊtřŚśŜŝŞş?t@ABC^t\R7E0G\>PA\(;_<7L\`aF\?\[Gbcd?Q@\efJ\ghP\ij-NB\kC\H\I\T2Q\UKl7T[\_\&Lf\mgC\\noA?Y\pz069e\S\qD\V\tH`?rstu;Ivwx=1y"Sz{Z\|}U\~;F^\ƂƃƄƅBW/C67QG)Cb\X\k\T\Ƈ]\%>W\`\Ƌc\d\x\Ǝa\"]g\ƐƑƒƓƔƕƖƗƘkt\F]2GHIJKs\vz>ǍJ:ǏǐǑJ]E]?]ǕǖK2C]K]$2U]Ǚǚ>]ǜǝPFP]ǟǠ@AT]bAF7BCDEFN]O]GHID]JKL=]MM]QLNI]OPQRB]HCGz]|]~]"^*0N1klmno,^pqrs&^6=oHtuvwxyz{|}~!^ʁ%^ʃʄʅ)^ʇʈʉʊ(^ʌʍ'^ʏʐʑʒʓʔʕʖ-^LTʙʚʛ3^*^.^ʝY@ʟʠ@A!16^B1^CDEFGHI2^JKLMNOPQRST&Q5^UVWXYZ[/^\]^0^_=P`ab4^mJ9^cdefgh8^i7^jklmnop;^qrstuvwe=xyz{|X2jC}~:^:E˂˃˄˅ˆ<^ˈˉˊˋˌˍYLˏːˑ*7˓˔˕˖˗˘˙˚˛˜˝˞˟ˠ@AeTBCD=^EFGHI?^JKLMNOPQRST"DUVWXA^YZ[\]^_`abcdefgh>^i@^jklmnopqrstuvw:UxyzB^{|}~̀́̂̃̄̅̆̇̈̉̊̋.r";2B0EGB̍/ȑ̐̑̒iP̔̕]S̗̘=k̛̜̝̞̟̠̚f30r@1rAB-JCDEFGHIg:3r5r4rdK:O2r4JORlBJKLMNOPCN8rv07rQRSTU>rVO2WXYZ[\AQ:r]^_`aijjjkj`ljmjnjojG=abc{udef}ug~uh|uijklb=m!v%4nopq"vrst#vuvw2lxyz{|}~ӀӁӂӃӄTQӆӇӈӉӊjYӌӍӎӏӐӑӒӓӔӕӖӗӘәӚӛӜӝӞӟӠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_$v`abcdefgh:nijklmnopqrstuvwxyz{|}~ԀԁԂԃԄԅԆԇԈԉԊԋԌԍԎԏԐԑԒԓԔԕԖԗԘԙ2UԛԜԝԞԟԠ@ABCDEFG~S\LHIJKLMNODJPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ՀՁՂՃՄՅՆՇՈՉՊՋՌՍՎՏՐՑՒՓՔՕՖ՗՘ՙ՚՛՜՝՞՟ՠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ab@ecdefghijklmnopqrstuvwxyz{|}~րց%vփքօֆևֈ։֊֋֌֍֎֏֐֑֖֛֚֒֓֔֕֗֘֙֜֝֞֟֠@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_/>`abcd)Fefghijklmnopqrstuvwxyz{|}~׀ׁׂ׃ׅׄ׆ׇ׈׉׊׋׌׍׎׏אבגדהוזחט%ZF<)6<8OH%<&Z'ZVLCH(Z}F5QiR6QG<2=d;)Z*ZHQ+ZmPo6[BOKm7hIC7w>$V,Z-Z@FgW6J)U_KoU.Z_VJ40Z/ZkR1Z2Z3ZTJ4Z+J5Z6ZO3oV7Z0;.58Z9Zn9/QhR:ZC8jOo2;ZZUSe;?Z5KPK@ZkGnVAZ5EA6BZL7N?CZDZ-KEZw5FZBA;WGZ8LjR1DHZ}5Q;IZ3PJZKZ=NLZMZNZw2QZOZhQPZUCRZSZTZUZ;P%Ry0VZ+GWZw=!CXZYZ}C7LZZ[Z>@WF\Z]Z4G^Z_ZH9@ABCDEFGHm;IJKL96xtMytNOcMPQRSTUVW9uXYZ[`k\]^_`asO?;bcdefgh@:%TijklmnoYapqrstu*1r2tuvwxyzuu{|wu}~؀Q:vu2C؃؄؅؆؇؈yu؊؋xu؍؎؏ؘؙؚؐؑؒؓؔؕؖؗ؛؜؝؞؟ؠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ـفقكلمنهوىيًٌٍَُِّْٕٖٜٟٓٔٗ٘ٙٚٛٝٞ٠@ABCDEFGHIJKLMN41jU:8O19F2pTMO\0KUu;JV770L6Fa1:9|Va9!7zTDuLuڙښڛO0x5IuJu\Eڟڠ@EuFuABGuKuC`>Huz8DEFPuSuGHIg?Jr9Xulm_L[unopqrH2YWsYutZu\uubuvwx`uyz{_u]u|}au~ۀ^udueucLۃ?e85cuhu#Lۅۆۇۈfuguۊۋیۍێ>uېۑےۓ۔ەۖۗۘۙۚD1ۜ?u۞E5d2luiuW6@muAjuBCDEFkuGHZ4IjTJKLnuMy3NOPQRSTouquUVWpuXYZ[\]^ru_su`abcdefghijkmI*9lm{Gnoc6pqrstuvILwxyz{|}~܀܁܂܃܄܅܆܇܈܉܊&j܌܍܎܏ܐܑܒܓܔܕܖܗܘܙܚܛܜܝܞܟܠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~݂݄݆݈݀݁݃݅݇݉݊݋݌ݍݎݏݐݑݒݓݔݕݖݗݘݙݚݛݜݝݞݟݠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`53~Tl9yPami*WniVBmHd:oipiqiaVrisiuitiviwiaGxiXTyiN=bzi{iO=|i(8>A}i21T;u9~ic!j"j#jx7-MQe:6@(Md9AEJQ3YKlTRej7BCDNeEFGHIJUe~4VeKLMNOSeTeP]RQR_BF1SbSTU]6lKVWeWXvSYZ[\]i1^t6ZeXeYe@5_`aER\ebc^edefghi]e2Gj#Rkl[emnopbTZUqrstu`eqWvwxyz{|ae}\1{Q~bede߁߂߃ce߅ee߇߈߉ߊXRK5_guZxZvZwZߒߓzZOPGDߕn0ߗߘ0PyZJS*:"[qG|Z{Z[I}Z![^W~ZZAߞ%[ߠtS@A'[$[B([CD<=EFGI@#[&[#VH)[IJK-[LMN.[,[B:OPQ$?+[RST*[GT?2UV/[Wy9X0[YZ[\;3]^_&5`abc<61[defu6g2[hijklmnopqrstuvwxyz{I1|}~4[3[5[7[6[8[9[@:[ABOSztuGCWdE|t}t{tCF>DEFGoPHIS7JKMT*LLM"u!u(:~tVKNOP$uR@Qj3R*M%u#u4=(uS)uM=8Ca?aK*uTUV&u'upDWXYZ[,u\<4]mW^W4+u.u_`-u/uQPabcdefgQC)Hhijklm0u1unopqrs2utu3u4u5uvwxy7u6uz{|}8u~I2TSMJo@XV0R?Ap=*8@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmxYN39VnUnXnWn%EYnZn.G[n/G\n'2]n^n_n`nanjWbncnXo?o}N@o`B846Wu=@GOCoAoBoDo'6|LCEoFoAGoOoHoIoJoBGqoM6KoBLoMoF6>CNoCPoQoRorUDSowDEToxDUoVod8w0WoXoYoFZo[o\o]oG^o5>ao_o`oHbocoMAdoeofogohoiojokoloX@Imo-AnooopoJKbOLMNOPQRS$3TUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[ECEcAIFc\U1JN34rHGcPOHcdlm2>ne5opG7q??RCfCrsLXtuvo8wxyz{|}~y=%QP00w1w,P002w3w4wJG@AO>BC7wDEFGHIJ6wK^1L5wMN8wO9wPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$NMH+:8h9h:hB>tROTXI@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDE3R%6jG|qnO3KkPoggMK9Y6}qd0LK~q$T-BlADF1>!rUb?b@bAb97{R$=NJ%1GKBb|6DHCbH=}1Dbv6EbYDFbZO]9Gb!@Hbv2@IbAsAJbKbxBLbMbNbWJ8XeYcOBCDEFGHIJKL%pMN0\OPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQmB&TTM1Q[3}GR52?B`f;JafbfT>cf$WUMef]=hffB':ifTjfR3iQUV%?kfoFlfmfWXnf-FofY'Ipfqfrf9esftfbBufvfhVwfZxfG9[\]^_`a;w:wbcde>wuvvvwvxvzHyvzv{v|v}v~v!w"w#w$w%w&w'w(wn1)w*w+w,w-w[A.w/w@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[qD/p&<0pyC\8E;Q]1p2p3p4p5pp?pi>@pl6ApBpCpDp5HEpFpdGptEeHpfghIpiJp=wjKpLpMpkNplmnoOpW:pPpQpRpSpTpUpVpXpqr%SWpsYptuvwxyz{|}:u9B~dwewfwgwhw4BjwkwsB@ABCDEFGHptIJKotLMiBNawbwOPQRSF;TUVWdYXYZrJh@$p[Z:\]-G^_`,Dablwmwnwcpwowdqweftwgswhrwuwijklvwmnopqrstuimvjmkmwv&6>XD9;X1\sJwwxwyw@ABCD{wEzwFG1G|w}wHIJKL~wMNOPQRSTUVWkF4lXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~]33v4vdA5v6v7v8v9v:v#H;vzA(9hmj9_Y@ABCDEFGHIJKLMNOUhijklmnopqrstuvwxyz{|}~!#"###g!%#&#'#(#)#*#+#,#-#.#/#0#1#2#3#4#5#6#7#8#9#:#;#<#=#>#?#@#A#B#C#D#E#F#G#H#I#J#K#L#M#N#O#P#Q#R#S#T#U#V#W#X#Y#Z#[#\#]#^#_#`#a#b#c#d#e#f#g#h#i#j#k#l#m#n#o#p#q#r#s#t#u#v#w#x#y#z#{#|#}#+!i!j!V~#W$#PyCapsule_New called with null pointerPyCapsule_GetPointer called with invalid PyCapsule objectPyCapsule_GetPointer called with incorrect namePyCapsule_GetName called with invalid PyCapsule objectPyCapsule_GetDestructor called with invalid PyCapsule objectPyCapsule_GetContext called with invalid PyCapsule objectPyCapsule_SetPointer called with null pointerPyCapsule_SetPointer called with invalid PyCapsule objectPyCapsule_SetName called with invalid PyCapsule objectPyCapsule_SetDestructor called with invalid PyCapsule objectPyCapsule_SetContext called with invalid PyCapsule objectPyCapsule_Import could not import module "%s"PyCapsule_Import "%s" is not valid"NULLPyCapsulewrite(bytes) -> int. Write bytes to file. Return the number of bytes written.G@a@B.ljust(width[, fillchar]) -> copy of B Return B left justified in a string of length width. Padding is done using the specified fill character (default is a space).ۖ33Descriptor to change the getter on a property.array(typecode [, initializer]) -> array Return a new array whose items are restricted by typecode, and initialized from the optional initializer value, which must be a list, string or iterable over elements of the appropriate type. Arrays represent basic values and behave very much like lists, except the type of objects stored in them is constrained. Methods: append() -- append a new item to the end of the array buffer_info() -- return information giving the current memory info byteswap() -- byteswap all the items of the array count() -- return number of occurrences of an object extend() -- extend array by appending multiple elements from an iterable fromfile() -- read items from a file object fromlist() -- append items from the list fromstring() -- append items from the string index() -- return index of first occurrence of an object insert() -- insert a new item into the array at a provided position pop() -- remove and return item (default last) read() -- DEPRECATED, use fromfile() remove() -- remove first occurrence of an object reverse() -- reverse the order of the items in the array tofile() -- write all items to a file object tolist() -- return the array converted to an ordinary list tostring() -- return the array converted to a string write() -- DEPRECATED, use tofile() Attributes: typecode -- the typecode character used to create the array itemsize -- the length in bytes of one array item eval(source[, globals[, locals]]) -> value Evaluate the source in the context of globals and locals. The source may be a string representing a Python expression or a code object as returned by compile(). The globals must be a dictionary and locals can be any mapping, defaulting to the current globals and locals. If only globals is given, locals defaults to it. can't resize shared unicode objects../Objects/unicodeobject.c../Objects/unicodeobject.cNegative size passed to PyUnicode_FromStringAndSizeinput too long../Objects/unicodeobject.c%d.%dlreplace%p../Objects/unicodeobject.cunichr() arg not in range(0x110000) (wide Python build)strict../Objects/unicodeobject.cdecoding Unicode is not supporteddecoding bytearray is not supportedcoercing to Unicode: need string or buffer, %.80s foundutf-8latin-1asciidecoder did not return an unicode object (type=%.400s)utf-8latin-1asciiencoder did not return a string object (type=%.400s)O!n;decoding error handler must return (unicode, int) tupleposition %zd from error handler out of boundspartial character in shift sequencenon-zero padding bits in shift sequenceunexpected special characterutf7utf7unterminated shift sequenceABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/unexpected end of datainvalid start byteinternal errorinvalid continuation byteinvalid continuation byteinvalid continuation byteutf8truncated datacodepoint not in range(0x110000)utf32truncated dataunexpected end of dataillegal UTF-16 surrogateillegal encodingutf16truncated \xXX escapetruncated \uXXXX escapetruncated \UXXXXXXXX escapeillegal Unicode charactermalformed \N character escapeunicodedata.ucnhash_CAPIunknown Unicode character name\ at end of stringunicodeescape\N escapes not supported (can't load unicodedata module)0123456789abcdefrawunicodeescapetruncated \uXXXXrawunicodeescape\Uxxxxxxxx out of range0123456789abcdeftruncated inputillegal code point (> 0x10FFFF)unicode_internalO!n;encoding error handler must return (unicode, int) tupleposition %zd from error handler out of boundslatin-1asciiordinal not in range(256)ordinal not in range(128)strictreplaceignorexmlcharrefreplace&#%d;asciiordinal not in range(128)charmapcharacter maps to character mapping must be in range(0x110000)character mapping must return integer, None or unicodecharmapcharacter maps to sizeReturn the size (in bytes) of this objectEncodingMapcharacter mapping must be in range(256)character mapping must return integer, None or strcharmapcharacter maps to strictreplaceignorexmlcharrefreplace&#%d;O!n;translating error handler must return (unicode, int) tupleposition %zd from error handler out of boundscharacter mapping must be in range(0x%lx)character mapping must return integer, None or unicodecharacter maps to strictreplaceignorexmlcharrefreplace&#%d;decimalinvalid decimal Unicode stringstrictreplaceignorexmlcharrefreplace&#%d;empty separatorempty separatorempty separatorempty separatorsequence item %zd: expected string or Unicode, %.80s foundjoin() result is too long for a Python stringpadded string is too longreplace string is too longreplace string is too longThe fill character cannot be converted to UnicodeThe fill character must be exactly one character longn|O&:centerUnicode equal comparison failed to convert both arguments to Unicode - interpreting them as being unequalUnicode unequal comparison failed to convert both arguments to Unicode - interpreting them as being unequalcountencodingerrors|ss:encodeencoder did not return a string/unicode object (type=%.400s)encodingerrors|ss:decodedecoder did not return a string/unicode object (type=%.400s)|i:expandtabsnew string is too longfindstring index out of rangeindexsubstring not foundn|O&:ljust|O:lstrip|O:rstrip|O:strip%s arg must be None, unicode or strrepeated string is too longrepeated string is too longOO|n:replacerfindrindexsubstring not foundn|O&:rjust|On:split|On:rsplit|i:splitlinesignoren:zfillstartswithstartswith first arg must be str, unicode, or tuple, not %sendswithendswith first arg must be str, unicode, or tuple, not %scannot switch from manual field specification to automatic field numberingcannot switch from automatic field numbering to manual field specificationToo many decimal digits in format stringMissing ']' in format stringOnly '.' or '[' may follow ']' in format field specifierEmpty attribute in format stringend of format while looking for conversion specifierexpected ':' after format specifierSingle '}' encountered in format stringSingle '{' encountered in format stringunmatched '{' in formatUnknown conversion specifier %cUnknown conversion specifier \x%xMax string recursion exceededformatteriteratorfieldnameiteratorO:__format____format__ arg must be str or unicode, not %s(u#)encodereplacesplitrsplitjoincapitalizetitlecentercountexpandtabsfindpartitionindexljustlowerlstripdecoderfindrindexrjustrstriprpartitionsplitlinesstripswapcasetranslateupperstartswithendswithislowerisupperistitleisspaceisdecimalisdigitisnumericisalphaisalnumzfillformat__format___formatter_field_name_split_formatter_parser__sizeof____getnewargs__string indices must be integersaccessing non-existent unicode segmentcannot use unicode as modifiable bufferaccessing non-existent unicode segmentnot enough arguments for format string-formatted integer is too long (precision too large?)%s0%c%%.%dl%c%s%%%s.%dl%c#strict%c arg not in range(0x110000) (wide Python build)%c requires int or char../Objects/unicodeobject.cformat requires a mappingincomplete format key* wants intwidth too big* wants intprec too bigincomplete formatstrict%s argument has non-string str()%%%c format: a number is required, not %.200sunsupported format character '%c' (0x%x) at index %zdnot all arguments converted during string formattingnot all arguments converted during string formattingstringencodingerrors|Oss:unicodeunicodeCan't initialize 'unicode'Can't initialize field name iterator typeCan't initialize formatter iter type6A ||l}~,܀W*cÆsɇu%ՉEdďt$~|5ԑF4PKejkE0(qgh$P$ʿ$Oտ$$QpY.$Q$$R'$("6"C"T"t""""""""#"7"]"x""""","Z"u""""-"<"V"|"""""""&"R"""H@/[+Y,A%9+*$>W 3 Ff6f6,f62f6Gf6Mf6bf6of6f6f6H.! @__builtin__lost __builtin___stdoutlost sys.stdout_excepthook(OOO)sys.exc_clear() not supported in 3.x; use except clausesexc_typeexc_valueexc_tracebackexits:setdefaultencodingcallexceptionlinereturnc_callc_exceptionc_returni:setcheckintervali:setrecursionlimitrecursion limit must be positiveobjectdefaultO|O:getsizeof__sizeof__Type %.100s doesn't define __sizeof__|i:_getframecall stack is not deep enoughOO!:call_tracingcallstats_clear_type_cache_current_framesdisplayhookexc_infoexc_clearexcepthookexitgetdefaultencodinggetfilesystemencodinggetrefcountgetrecursionlimitgetsizeof_getframesetdefaultencodingsetcheckintervalgetcheckintervalsetprofilegetprofilesetrecursionlimitsettracegettracecall_tracingunknowndebug-dpy3k_warning-3division_warning-Qdivision_new-Qnewinspect-iinteractive-ioptimize-O or -OOdont_write_bytecode-Bno_user_site-sno_site-Signore_environment-Etabcheck-t or -ttverbose-vunicode-Ubytes_warning-bhash_randomization-Rsys.flagsmajorMajor release numberminorMinor release numbermicroPatch release numberreleaselevel'alpha', 'beta', 'candidate', or 'release'serialSerial release numbersys.version_infofinalsysPython error: is a directory, cannot continue rwwstdinstdoutstderr__stdin____stdout____stderr____displayhook__displayhook__excepthook__excepthookversionhexversion(ssz)CPythonsubversion(szz)CPython_mercurialdont_write_bytecodeapi_versioncopyrightplatformexecutableprefixexec_prefixmaxsizemaxintpy3kwarningfloat_infolong_infomaxunicodebuiltin_module_namesbiglittlebyteorderwarnoptionsversion_infoflagsshortfloat_repr_stylecan't create sys.pathpathcan't assign sys.pathpathno mem for sys.argvargvcan't assign sys.argv-c-cno mem for sys.path insertionsys.path.insert(0) failed... truncatedstdoutstderr$$"$%$($+$.$1$4$7$:$=$@$C$F$I$L$O$R$U$X$[$^$a$d$g$j$m$p$s$v$Codec used when reading a file in universal newlines mode. It wraps another incremental decoder, translating \r\n and \r into \n. It also records the types of newlines encountered. When used with translate=False, it ensures that the newline sequence is returned in one piece. When used with decoder=None, it expects unicode strings as decode input and translates newlines without first invoking an external decoder. inconsistent mountnot mountednot in unionmount rpc errormounted device shut downmounted directory forbids creationdoes not existunknown device in # filenamenot a directoryfile is a directorybad character in file namefile name syntaxpermission deniedinappropriate use of fdbad arg in system calldevice or object already in usei/o errorread or write too largeread or write too smallnetwork port not availablewrite to hungup streami/o on hungup channelbad process or channel control requestno free devicesprocess exitedno living childreni/o error in demand loadvirtual memory allocation failedfd out of range or not openno free file descriptorsseek on a streamexec header invalidconnection timed outconnection refusedconnection in useinterruptedkernel allocate failedsegments overlapi/o count too smallken has left the buildingbad attach specifierno free file descriptorsno free mount devicesno free mount rpc bufferno free segmentsno free memoryno free Blocksno free routesattach -- bad specifierunknown fidbad character in directory nameread/write -- on non open fidread/write -- count too bigphase error -- directory entry not allocatedphase error -- qid does not matchaccess permission denieddirectory entry not foundopen/create -- unknown modewalk -- in a non-directorycreate -- in a non-directoryphase error -- cannot happencreate -- file existscreate -- . and .. illegal namesdirectory not emptyattach -- privileged userwstat -- not ownerwstat -- not in groupcreate/wstat -- bad character in file namewalk -- too many (system wide)file system read onlyfile system fullread/write -- offset negativeopen/create -- file is lockedclose/read/write -- lock is brokennot a socketprotocol not supportedconnection refusedaddress family not supportedinsufficient buffer spaceoperation not supportedaddress in useunnamed error messagePrivate method returning an estimate of len(list(it)).readlines([size]) -> list Call readline() repeatedly and return a list of lines read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned. S.expandtabs([tabsize]) -> string Return a copy of S where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.Line endings translated so far. Only line endings translated during reading are considered. Subclasses should override. tell() -> current file position, an integer (may be a long integer).6D4*c;D4SD4=cZD4Encode .hqx datah-h-i-  i-long.bit_length() -> int or long Number of bits necessary to represent self in binary. >>> bin(37L) '0b100101' >>> (37L).bit_length() 6Update a set with the union of itself and others./tmp/tn000000000000H)߃#<l!A8ooq$C8P7V@S.format(*args, **kwargs) -> string Return a formatted version of S, using substitutions from args and kwargs. The substitutions are identified by braces ('{' and '}').6,@p%|$X#t;floor(x) Return the floor of x as a float. This is the largest integral value <= x.S.islower() -> bool Return True if all cased characters in S are lowercase and there is at least one cased character in S, False otherwise.log(x[, base]) -> the logarithm of x to the given base. If the base not specified, returns the natural logarithm (base e) of x.math domain errormath range errorin math_1in math_1ain math_2atan2copysignmath.fsum partialsfsumintermediate overflow in fsum-inf + inf in fsumfactorial() only accepts integral valuesfactorial() not defined for negative values__trunc__in math_frexp(di)dO:ldexpExpected an int or long as second argument to ldexp.in math_ldexp(dd)(dd)in math_modf(dd)math domain errorloglogloglog10fmodin math_fmodhypotin math_hypotpowin math_powacosacoshasinasinhatanatan2atanhceilcopysigncoscoshdegreeserferfcexpexpm1fabsfactorialfloorfmodfrexpfsumgammahypotisinfisnanldexplgammaloglog1plog10modfpowradianssinsinhsqrttantanhtruncmathpie+.D38.34({7_ <,.b;l6j;Cn2s; x1;-(;.; p$Private method returning an estimate of len(list(it)).S.translate(table [,deletechars]) -> string Return a copy of the string S, where all characters occurring in the optional argument deletechars are removed, and the remaining characters have been mapped through the given translation table, which must be a string of length 256 or None. If the table argument is None, no translation is applied and the operation simply removes the characters in deletechars../Y@!!!!8k|€@repr(object) -> string Return the canonical string representation of the object. For most object types, eval(repr(object)) == object.S.ljust(width[, fillchar]) -> int Return S left-justified in a Unicode string of length width. Padding is done using the specified fill character (default is a space).close() -> None. Close the file. A closed file cannot be used for further I/O operations. close() may be called more than once without error. Changes the fileno to -1.lookup(encoding) -> CodecInfo Looks up a codec tuple in the Python codec registry and returns a CodecInfo object.bind(name, old, [flag]) -> int Change name space.Base class for text I/O. This class provides a character and line based interface to stream I/O. There is no readinto method because Python's character strings are immutable. There is no public constructor. NMTOKENSH))QQiRTVMO!AQ,8U6./YP124789ABCEFGHIJKLMNA lock object is a synchronization primitive. To create a lock, call the PyThread_allocate_lock() function. Methods are: acquire() -- lock the lock, possibly blocking until it can be obtained release() -- unlock of the lock locked() -- test whether the lock is currently locked A lock is not owned by the thread that locked it; another thread may unlock it. A thread attempting to lock a lock that it has already locked will block until another thread unlocks it. Deadlocks may ensue.iiiiiexpected string or bufferbuffer has negative sizebuffer size mismatchmaximum recursion limit exceededinternal error in regular expression enginepatternposendposO|nn:matchpatternposendposO|nn:searchjoinsourceposendposO|nn:findallsearchsourcemaxsplitO|n:splitre_subxNnreplstringcountOO|n:subreplstringcountOO|n:subncannot copy this pattern objectcannot deepcopy this pattern objectmatchsearchsubsubnsplitfindallfinditerscanner__copy____deepcopy__patternflagsgroupsgroupindex_sre.SRE_PatternOiO!|nOOregular expression code size limit exceededregular expression code size limit exceededinvalid SRE codeno such groupre_expanddefault|O:groupsdefault|O:groupdictkeysstartno such groupendno such groupspanno such groupcannot copy this match objectcannot deepcopy this match objectgroupstartendspangroupsgroupdictexpand__copy____deepcopy__lastindexlastgroupregsstringreposendpos_sre.SRE_Matchmatchsearchpattern_sre.SRE_ScannerO|nn:scannercompilegetcodesizegetlower_sreMAGICCODESIZEMAXREPEATcopyright}}}}}}}}}}~}}~}}}}}}}}}}}}}}}}}}} }} }}}}}} !"#$}%&'()*+},-./}}}}0123456}789:;<}}=>?}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}cycle(iterable) --> cycle object Return elements from the iterable until it is exhausted. Then repeat the sequence indefinitely.$$$$$$adler32(string[, start]) -- Compute an Adler-32 checksum of string. An optional starting value can be specified. The returned checksum is a signed integer.get_count() -> (count0, count1, count2) Return the current collection counts settrace(function) Set the global debug tracing function. It will be called on each function call. See the debugger chapter in the library manual./bin/ape/shsh-c6,E.6r"LH)x?8  }$- Q/,v8,$:modf(x) Return the fractional and integer parts of x. Both results carry the sign of x and are floats. À h ""H)-ŝA4d!ʟD.copy() -> a shallow copy of DD.reverse() -- reverse *IN PLACE*B.splitlines(keepends=False) -> list of lines Return a list of the lines in B, breaking at line boundaries. Line breaks are not included in the resulting list unless keepends is given and true.reload(module) -> module Reload the module. The module must have been successfully imported before.L.index(value, [start, [stop]]) -> integer -- return first index of value. Raises ValueError if the value is not present.state is not a dictionary__reduce____setstate____unicode____getitem__ not supported for exception classes in 3.x; use args attribute__getslice__ not supported for exception classes in 3.x; use args attribute__dict__ may not be deleted__dict__ must be a dictionaryargs may not be deletedmessagemessage attribute was deletedBaseException.message has been deprecated as of Python 2.6messagemessagemessage__dict__argsmessageexceptions.BaseExceptionCommon base class for all exceptionsexceptions.ExceptionCommon base class for all non-exit exceptions.exceptions.StandardErrorBase class for all standard Python exceptions that do not represent interpreter exiting.exceptions.TypeErrorInappropriate argument type.exceptions.StopIterationSignal the end from iterator.next().exceptions.GeneratorExitRequest that a generator exit.codeexception codeexceptions.SystemExitRequest to exit from the interpreter.exceptions.KeyboardInterruptProgram interrupted by user.exceptions.ImportErrorImport can't find module, or can't find name in module.EnvironmentError[Errno %s] %s: %s[Errno %s] %serrnoexception errnostrerrorexception strerrorfilenameexception filename__reduce__exceptions.EnvironmentErrorBase class for I/O related errors.exceptions.IOErrorI/O operation failed.exceptions.OSErrorOS system call failed.exceptions.EOFErrorRead beyond end of file.exceptions.RuntimeErrorUnspecified run-time error.exceptions.NotImplementedErrorMethod or function hasn't been implemented yet.exceptions.NameErrorName not found globally.exceptions.UnboundLocalErrorLocal name referenced but not bound to a value.exceptions.AttributeErrorAttribute not found.tuple index out of range???%s (%s, line %ld)%s (%s)%s (line %ld)msgexception msgfilenameexception filenamelinenoexception linenooffsetexception offsettextexception textprint_file_and_lineexception print_file_and_lineexceptions.SyntaxErrorInvalid syntax.exceptions.IndentationErrorImproper indentation.exceptions.TabErrorImproper mixture of spaces and tabs.exceptions.LookupErrorBase class for lookup errors.exceptions.IndexErrorSequence index out of range.exceptions.KeyErrorMapping key not found.exceptions.ValueErrorInappropriate argument value (of correct type).exceptions.UnicodeErrorUnicode related error.%.200s attribute not set%.200s attribute must be str%.200s attribute not set%.200s attribute must be unicodeencodingencodingobjectobjectobjectobjectobjectobjectobjectreasonreasonreasonO!O!nnO!encodingexception encodingobjectexception objectstartexception startendexception endreasonexception reasonx%02xu%04xU%08x'%.400s' codec can't encode character u'\%s' in position %zd: %.400s'%.400s' codec can't encode characters in position %zd-%zd: %.400sexceptions.UnicodeEncodeErrorUnicode encoding error.su#nns%02x'%.400s' codec can't decode byte 0x%s in position %zd: %.400s'%.400s' codec can't decode bytes in position %zd-%zd: %.400sexceptions.UnicodeDecodeErrorUnicode decoding error.ss#nnsO!nnO!x%02xu%04xU%08xcan't translate character u'\%s' in position %zd: %.400scan't translate characters in position %zd-%zd: %.400sexceptions.UnicodeTranslateErrorUnicode translation error.u#nnsexceptions.AssertionErrorAssertion failed.exceptions.ArithmeticErrorBase class for arithmetic errors.exceptions.FloatingPointErrorFloating point operation failed.exceptions.OverflowErrorResult too large to be represented.exceptions.ZeroDivisionErrorSecond argument to a division or modulo operation was zero.exceptions.SystemErrorInternal error in the Python interpreter. Please report this to the Python maintainer, along with the traceback, the Python version, and the hardware/OS platform and version.exceptions.ReferenceErrorWeak ref proxy used after referent went away.exceptions.MemoryErrorOut of memory.exceptions.BufferErrorBuffer error.exceptions.WarningBase class for warning categories.exceptions.UserWarningBase class for warnings generated by user code.exceptions.DeprecationWarningBase class for warnings about deprecated features.exceptions.PendingDeprecationWarningBase class for warnings about features which will be deprecated in the future.exceptions.SyntaxWarningBase class for warnings about dubious syntax.exceptions.RuntimeWarningBase class for warnings about dubious runtime behavior.exceptions.FutureWarningBase class for warnings about constructs that will change semantically in the future.exceptions.ImportWarningBase class for warnings about probable mistakes in module importsexceptions.UnicodeWarningBase class for warnings about Unicode related problems, mostly related to conversion problems.exceptions.BytesWarningBase class for warnings about bytes and buffer related problems, mostly related to conversion from str or comparing to str.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions bootstrapping error.exceptions__builtin__exceptions bootstrapping error.exceptions bootstrapping error.BaseExceptionBaseExceptionModule dictionary insertion problem.ExceptionExceptionModule dictionary insertion problem.StandardErrorStandardErrorModule dictionary insertion problem.TypeErrorTypeErrorModule dictionary insertion problem.StopIterationStopIterationModule dictionary insertion problem.GeneratorExitGeneratorExitModule dictionary insertion problem.SystemExitSystemExitModule dictionary insertion problem.KeyboardInterruptKeyboardInterruptModule dictionary insertion problem.ImportErrorImportErrorModule dictionary insertion problem.EnvironmentErrorEnvironmentErrorModule dictionary insertion problem.IOErrorIOErrorModule dictionary insertion problem.OSErrorOSErrorModule dictionary insertion problem.EOFErrorEOFErrorModule dictionary insertion problem.RuntimeErrorRuntimeErrorModule dictionary insertion problem.NotImplementedErrorNotImplementedErrorModule dictionary insertion problem.NameErrorNameErrorModule dictionary insertion problem.UnboundLocalErrorUnboundLocalErrorModule dictionary insertion problem.AttributeErrorAttributeErrorModule dictionary insertion problem.SyntaxErrorSyntaxErrorModule dictionary insertion problem.IndentationErrorIndentationErrorModule dictionary insertion problem.TabErrorTabErrorModule dictionary insertion problem.LookupErrorLookupErrorModule dictionary insertion problem.IndexErrorIndexErrorModule dictionary insertion problem.KeyErrorKeyErrorModule dictionary insertion problem.ValueErrorValueErrorModule dictionary insertion problem.UnicodeErrorUnicodeErrorModule dictionary insertion problem.UnicodeEncodeErrorUnicodeEncodeErrorModule dictionary insertion problem.UnicodeDecodeErrorUnicodeDecodeErrorModule dictionary insertion problem.UnicodeTranslateErrorUnicodeTranslateErrorModule dictionary insertion problem.AssertionErrorAssertionErrorModule dictionary insertion problem.ArithmeticErrorArithmeticErrorModule dictionary insertion problem.FloatingPointErrorFloatingPointErrorModule dictionary insertion problem.OverflowErrorOverflowErrorModule dictionary insertion problem.ZeroDivisionErrorZeroDivisionErrorModule dictionary insertion problem.SystemErrorSystemErrorModule dictionary insertion problem.ReferenceErrorReferenceErrorModule dictionary insertion problem.MemoryErrorMemoryErrorModule dictionary insertion problem.BufferErrorBufferErrorModule dictionary insertion problem.WarningWarningModule dictionary insertion problem.UserWarningUserWarningModule dictionary insertion problem.DeprecationWarningDeprecationWarningModule dictionary insertion problem.PendingDeprecationWarningPendingDeprecationWarningModule dictionary insertion problem.SyntaxWarningSyntaxWarningModule dictionary insertion problem.RuntimeWarningRuntimeWarningModule dictionary insertion problem.FutureWarningFutureWarningModule dictionary insertion problem.ImportWarningImportWarningModule dictionary insertion problem.UnicodeWarningUnicodeWarningModule dictionary insertion problem.BytesWarningBytesWarningModule dictionary insertion problem.Cannot pre-allocate MemoryError instanceCannot pre-allocate RuntimeError instance for recursion errorsmaximum recursion depth exceededcannot allocate argument for RuntimeError pre-allocationcannot allocate tuple for RuntimeError pre-allocationinit of pre-allocated RuntimeError failed;Zx0Nwrite(b: bytes) -> int. Write bytes b to file, return number written. Only makes one system call, so not all of the data may be written. The number of bytes actually written is returned.getrecursionlimit() Return the current value of the recursion limit, the maximum depth of the Python interpreter stack. This limit prevents infinite recursion from causing an overflow of the C stack and crashing Python.ɡ6,E6r$Lname(unichr[, default]) Returns the name assigned to the Unicode character unichr as a string. If no name is defined, default is returned, or, if not given, ValueError is raised.A!J!60?!D!!!Z3 VB-w`!F8`H$ބ$P4(|X"BS4 @=H-:InfinityNaN0!!_current_frames() -> dictionary Return a dictionary mapping each current thread T's thread id to T's current stack frame. This function should be used for specialized purposes only.w!~!D.setdefault(k[,d]) -> D.get(k,d), also set D[k]=d if k not in DN$֯W$$$T$H]$compile(source, filename, mode[, flags[, dont_inherit]]) -> code object Compile the source string (a Python module, statement or expression) into a code object that can be executed by the exec statement or eval(). The filename will be used for run-time error messages. The mode must be 'exec' to compile a module, 'single' to compile a single (interactive) statement, or 'eval' to compile an expression. The flags argument, if present, controls which future statements influence the compilation of the code. The dont_inherit argument, if non-zero, stops the compilation inheriting the effects of any future statements in effect in the code calling compile; if absent or zero these statements do influence the compilation, in addition to any features explicitly specified.max(iterable[, key=func]) -> value max(a, b, c, ...[, key=func]) -> value With a single iterable argument, return its largest item. With two or more arguments, return the largest argument. >$DGGEEFFDE&FHHIIGJJLLKK)I(HMMOONNJ+KWWVV-MYY[[ZZ\\]]__^^aa``/Olliiffkkhhjjqqttsuuwwvv&&CCUUggppmmoonn90/265389abcdgilv!&"&#&$&%&&&'&(&)&*&+&,&-&.&/&0&1&2&3&4&5&6&7&8&ejqrst{A&B&C&D&E&F&G&H&I&J&K&L&M&N&O&P&Q&xR&S&T&U&V&W&X&uzwy|''BCDEFGHIJKLMN!'"'#'$'%'&'(')'*'+','-'.'/'0'1'2'3'4'5'6'7'8'9':';'<'='>'?'@'A'Q'R'S'T'U'V'X'Y'Z'['\']'^'_'`'a'b'c'd'e'f'g'h'i'j'k'l'm'n'o'p'q'W'rstuvwxyz{|}~>!=!B!F!G!H!I!w"x"E!D!s"l!m!("n!qor"+","*"-"M"N"O"_"P"`":";"]!e"g"g!\"J"K"A"@"i"j"h!h"f"b"b!a"e!f!c"d">"?"<"="]"^"!(,("(-(#(.($(/(&(1(%(0('(<(7(2()(>(9(4(((8(=(3(*(:(?(5(+(;(@(6(#"""%"$"'"&"!"~!{!}!|!~"z!y!j!i!v"u"t"!!"!#!7!9!:!;!R!S!T!U!V!W!X!Y!Z![!)"."L!M!A!!$"$#$$$%$&$'$($)$*$+$,$-$.$/$0$1$2$3$4$5$6$7$8$9$:$;$<$=$>$?$@$A$B$C$D$E$F$G$H$I$J$K$L$M$N$O$P$Q$R$S$T$U$V$W$X$Y$Z$[$\$]$^$_$`$a$b$c$d$e$f$g$h$i$j$k$l$m$n$o$p$q$r$s$+!,!5!6!!%"%#%$%%%&%'%(%)%*%+%,%-%.%/%0%1%2%3%4%5%6%7%8%9%:%;%<%=%>%?%@%A%B%C%D%E%F%G%H%I%J%K%L%M%N%O%P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%m%n%o%p%q%r%s%t%u%v%&!0;e><2$TI?M"P/1%n3#P$@BRV5:Jg>&>N'(BJ)$P*fC+,-%Pz6.&P]40Cg<'P(P/0)P5G1W527GcFC83K3Ii*Ph>+P5245e6p8iL&V678pM}F9:;%4<55,P-P;N=MhA/Pv;sF=2P>1_8^8f0>?KOJO3:!0@3P4P5P4K6Pr8g0rK|5}5~5bDPCB?PUIg@EF8!@PBPGHIeBaNJ0JAP>2KD6LgCMNo7CP$GOPQRk4STUDPK0VW`8l4zI2HY5XYZ[\q2gPAE]lGFP^`MEPGPn:HP$Up_qPPrstSPQPuB2;JKPvwxyOPs8z{H;|}&4~!TPLP"#cN$x;%MP&RP'()UP*NP+,!6M0-."6A2%UyKnIt8//?7N012345XJ6787%Bd289:;S=<=>YP?^P\P@WP/BZP]P[PA]JXPB.?CsK_P`P$=mPDEPG6IhPpJ62FGlPHIJKfPoPLRAMD8N\GOG`PnP]EQcPv8RSu8aPTUVWZ?)Q@'QANABC(Q*QDEQ,QF+QGHJH75.Q/QI/2JKL-QMNOPRt<2Q1Q0QSVPT3QUVWX~=4QYZ[%M\]^_YL`ab6Qcd5Q8Q7Q9Q:Qt0e58;7<={C$6h@w8fn9Qm~Fn4A@QAQ,Hx8;OBQ&6tL'B?o:nQoQ0AlQqQ@6KABCd9DpQEFGu7^:mGHtQrQI{Ij>{Qd3uQsQOAJKLwQvQMND3O`7|Q-NPQxQ}QzQRyQSTUVWONXy8C2tNYZ[\u=XEe9"R#R]^eN+O%R_`az8bc$Rd/3e&RVKf)RgJ-Rp*@*RP6q+R+4rstuvw.7.Rx/Ryz0R1R[<{8^L{hLwF|qJ2R3R}~!5R7R6R"#8R=2LK$|:9R%&YA'(">)6:R)*+,[H-./;R0R$Ih6e0345?F?R==6i@AR@R#>a8CR>H87DR\H4BnB(6nF1C9nG:NKFRj@;<=57GR>?HR,1u0m4@(BQ5qMKR72AJRB*6LRCqLDEFGHMRRNI|8J68NRKLPROR_?91MN^1QRORRP78QRSRSTUn5VW2;TRXtK5:Z5'MPA?H}\RZRD2fB8L!9yMGE~8ef/7gRc6JKg]HhifRj^4aRbRdRklmneR[5a?-JcR_Rc8`R$OoprJqhDb8p9rhRs]FtlRuvwx~S3i:134yR567%Sv0$S8%0JI"S|R9wR}RH::;<&S=w0/S'S(S%>iK>?-S,S@/EA.SB+SCDEF41G6:0?HIJKL)SbE*SM"0NO4S#M'>P:SQR9S0SSTUCB1SVoB6S&>WXY3SZdL[\<77S8S]^_5S;S`ab2ScdASFSBSe=SfgGS1AhISi"9?S}CjklmnopCS313WS^24bS5|>^S6\S7]S8_S9:;<=>?=1@ABCD9AEYSFZSGz3HIJKLaSMo4NdS`ScSOPQR.JSUF8HfSTUeSE3VgSWXjSiSYZ[\]^hS9GkS_`abcdelSfgnSmShpSisSqSoSrSjtSklmpquSnovSwSxSEQr|?,T/TA:#9@3TA%:B3CCD0TZDEFGHIJKLMNOPQRS4TTb?U2T5T?7V6TW`XYZ[\]^7T_$9@39Tabc:Td;T8Tef1Tj?T@T>TkBT8Glmh0VI~CTnopqrs}>tu9HE+f:NT,=J]N-t2JT./01:AMTcE2IEdE9HMDI:34IT567v16EKTGTP?8OT9N=:;<-6PT=>?@ABCDhJEF}AFDGRTHIJKOKLSTXTMN/JWTQTTTVTP&:IJQOYTECRu2m>STU[TVZTWh9X\T^T]TY`TZUTbT[\aT_T]N;Q?TAcT<@m0dG^[DeTdTfTgThTiT_`QJjTabF2kTcde~T%C}}T~3J!"w=[E#$!U%&'%9"U!G^HQL%G()+U*+85,EM-/L,V#U.&U/EB08KJE1234'U56eK7J:8*>9:;(U90H8?+@Q0,U-U*U@ABCD81/4E)UEL1IFGHIJ(0Ky0Q;LR0#0M2UNOP0UQR4U,O[\LG]^6U_`a':b9UcdXIe:U5Ufghij;Lkl^Gmno;U2Ipqrstuvwxyz{|}Uy7$LUEUBU%&'dCAU(CUDU)*+,FUGU-./0r4IUHUJU13456n>7MU\D8E1KU2NU9OURU:PUQU;z;8BUUVUZ;'9?RL(5I8WUX3@XU9BABYU#VZU[U\U^UCDEF_UG`UHpBI'1iH2XbUFMYZI=[\drUsUS0:BR?itU3F.>/>uUm@j0>klvUwUm`LnxUopqF6rs"=tuvyUzU\<,?tFT?xH"GI6{Uo5|U~6OF02S;}U"V!V}6~U8Ewxy0BKEHwJvJ?@AgE8VT=7VBCr?VGVFVEVAV@VDVGHIJxJFKLMNOPQRSWKVHVJVrMUIVTV?VXYZ[\s?]LV^7:_MVNV`abcdQVePVOVfghE:VWVhijklmSVnoRVpqTVUVrtsXVtufNYVVVvwZVx`4[Vzy]V\V^V{|_Vn@#=}d=cA~)98:*9p5!`V9:J8aV&LCGbV+9"#,4'CR6$T;[IAH%cVu4&fV'()!D*eVdVgVkD+,c?.U;J@-SB"5/"D0hViVo>9K1lVkVjV}IsV42ZKmV35oVkK6nV789:pV(HqV>JrV;<=>?@A34?J/GtVuV,944vV88DM)Mv4xVB#D-91>_H2>CDx=lDyJ9E.9\IyVEFGYEB:HIK8JmDKLC0n=/9GMMNOzV{VQGP|VwN-ORQS~V}VTUG3VW!W$W%WX#WY@I3>'W&W"WZ(W)W[*W-W+W,W.Wd1nD/Wz7v26G0W{F[J\1W.O]^_2W@J5W!P1P`0Ww@WvExAWBWyCWz4W3W{DWA7|}'I~L:7I&DKIEW!4>F1"FW#$GW%rL&`H'(JW}1,@IWHWB7TBNWLW)KW'Ne8*+y=MWLE>=,@FQWPW-.OWRWf8/20SW|I[=13TWyH456AF'D70EUW+54?8,I9:;?@AVWV;:K;K~1[WBiCCDXWEFGw2HIJK-XZWLM0GNYWOWWPz9]WQRScWiWaW\ETUfW]IVW`WXeWgNW;YUB^WZ^5hW-@e1bWx2gW[16dW\]jW^lWvWtWqW_`apWxNbrW26c19dz=efyWkWgoW_Whz2sWuWQCi(:82mWxWwW36)Bf3jC7nWklzWm}W!Xno=/XWF%&'()*GO+X+,1X-{9.K@/0T0*X(X1ZA2|W4;FB=X3[A8X45X6X5f<9XX?XU0<=>?@3XABCr6&0DE64;XFCXBXGHGXIJHXKLMNFXIXAXEXOJXKXPQ@X|;RDXVB292X5?XXiJNXOXPXWXSVXT}K74TXE743QXU8NSXV0UXVLXRXYXD7MXWXY]MZ[\+M]^\X`X_`~AyNaXab^X[XcdZX_Xefgh0Ji4FjF7kbX]XlcX{712mnkXo84pqriXjX):hXfXeXlXdXnXst{2uvwxyz{pX~oX|}!"#(DsXqXgX|7rXvXuXwXtXxX$%&'yXzXjJ|X{X?=.@f2|2(}X)?0L@~X*Cl!Ya7+"Y,-o@./#Y0$Y:5%Y&Y'YWBM81aL2*Y-Y+Y?.Y@1JA70B^IcHC/YD2Y5>;50Y7Y6>1YDGEFGH^M3Y4Y8YjE5Y39^@FY4HrBIJdH-ZzJKqDLMuKN;Y!2jCOPDYQ4C>YEY@YGYCYBYoGRAYRGr5H3Vg3!?IYNYJYW}7XOY";i9YZ&==Y};LY[\X;MYD0]^HY_`)Dabcs546KY'0deC:f6?ghirDjTHQY^Aklmno*Bpq+;RYrTYPYstuaJ=Dvw\Axy{JN<`Y_Yz{x?|~7}~YY9>!hF1G"#$WY%]A&'x<\Y(8>VY[Y)SG*+UY!7,-]3.]Y+NN:5CZY/\@059d?f1.0eY?bY@Ax4BCg1DhYEFIMlYGH;BsYIJmYKjYqYLSYMNOPQnYrYRSBHkETUkYVoYH7Wq:X]@YwYZ[\]^&E_`abcdeftY`KguYhivYNL"@jkb7lm}Ynop5;zYyYqr2Gst5Fuvw1E{Yxy|YoIzEG#;q@PK{I3%Z~Y|}~JM'Z!#Z$Z"#$%`A&'("Z?Y)*&Z!Z+Z,Z'E.Z+,$;)Z-.<5//Z0(Z3Z2Z11Z24Z36Zq>45Z569Z789:;<=7Z>?8ZpY@AB;Z:ZCDxYZ@Z?ZAZ~2G69HI|J/@JN8KCZLFZRIM_5NOEZDZTGGZ56IZHZPQ:46;XFRSI7t?JZ0@(E_IKZTUVLZMZW8J]UF@XLIX:eHCHYZME[ANOZP<\PZ]60^T6M@_`IQZB;GC`[;7?abcRZ}Jw1\;dUZeSZVZ9NTZfg{@WZh2BiXZjkz4lZZYZm[Z\Z{4|F6Cl5];aA\=00n]Zopqr"2aZstu79`Zv+::>wx_Z;>y@L*:z{W0N@|}fZ~!1@G1"#$%U=&fKr:'()*<>+'@,-.eZcZdZ0/kC&[1jZ~;89hZ23iZ48?57gZ6/;89:;qZmZ"3nZoZUH@ABaIJ7rZD2@E=>GHIRCJLCFKG6sZwZK2tZvZMNOuZPk=QHCE0xZRSTUyZVW*DXqNC;YkJZ[=K\"[{Z]~Z}Z^_zZ`a![^Fb|Zcdef#[l=$[gKMxGh%['[i([jkl)[J6H199*[+[q=bAm?XR>A=AXBG:rPnon7-M~J~Ip,[qs:?D-[/Or>Ks+D.[|4tu/[0[ZL$LvK\K%;2[k;[NE~9[+B:[r>]L<[=[hM!B[":9#UG?[lE^ZbZ$O5%GG&A[>>DH'(G[zH>[D[C[)*O@+,mK-SN./gK0L2^;HOF[u?E[@[O8123L[J[4M2H[N[T[5679HB:;AJ"IU[pG?K;4?w@@=@SDA.MBQ[P[CR[O[DW[M[K[S[I[ElCFxLFtumTh8|Mvwh[xtD#3-:y`[p[a3n[r[znE~4{2\|ILw[}4}~[~!"@K#!\#\$'\y[%*C&'oE+\|[(\("\)*+,-9?,\./3@01*\=4234POv[&\X05x[67:L}["?GDs[89%\:;NF?$\@;\A=\XDBCDLMEvI8\JBF>\?AG5\B\A\oF@\jFHIJKLMD\7\NH6:\]=OPQ`G<\K64\6\3\RS0OZ39\TUC\53g:V]1T\W1OW\XY:?V\U\Z[\R\]^_F\`c\E\X\abcP\dK\H\I\Q\e"tfN\=9HDdAL\G\gJ\hiMMjKO\Y\jka\Z\g\e\lmn`\op_\PDeAq]\rs[\tb\h\uHn\uvi\l\f\wtC8Ix\\yd\@>zOLx\k\{|"8#2_3S\}~!A>p\"w\yX[?@A{\}\~\B,]C(]m[DEF']G&]#]HIJj\%]$]KMLNO*]&OPQR-]{6ST)]+]UV'H.]WXYZ2]/][\]^sM0]_`a^\bcd3]4]ef51g6]g7!4p=]q<]>]rN2s7C?]t?4A]uv@]B]wC]xD]_;5@!:pIybJDOz{u;|P:rN}E]F]`;~!G]H]"J]I]#XK^=l_]?^]@ABCDEa]FGHa;I1LJb]c]$5Kd]Lf]e]MNOPQRe?ST9IJ1UVEHWuDA=a5XYZFH[.<\]h]@4^x1_`rFg]>9SCi]6q]j]abcABb5r]defgh7h%5p]n]k]`Mijk@DlYFl]t]s]#7mn-2op;:m]o]qrWKtBwK|]s}]tO2u(J}L!^#x]~]h176vu]z]wt@qGgHxyz{|w]}!K~y]$^!"^"{]#"KHGc5%E$mC%%^&'(#^YBv])K1*+,-NM0^./0/^1v@,^2lM6F&^ED345L1?9)^789'=.^-^(^+^:h3;*^IG<.Nt>u@=6^4^MI>?@1^3^A:1B@92O=3bICDaM$3;?5^EF:^GC>0M7^HI2^J8^KLM^NsEBFNO63U1P>^QA^RCNSTdMUH^B^?^VWTNE^XYJ=G^L^ZqEJ^[\D^]^8C_K^`@^F^aM^|0C^N^bc=^B=L7<^R^m=:8a^i[^t5OEjV^_^/021k92X^,BO^Q^A9lmb^n]^opU^\^qrst+LuZ^^^vwxyzP8{E>9C|}~T^!"/M#W^P^rES^$Y^%&QO><~Kc^.H'o^;8(`=e^)/NB9r^*n0p^+d^,-j^.l^/OMg^.E0i^123q^4k^GL56f^7"<~^89:j3h^m^n^lBZB;v^<=|^z^)E#_w^>?@x^`^y5:IA?_<_?_!B_";_j9(G9^#$tM=_A_uB%@_+_&io'E_()I_*G_+,-C_D_.H_F_NI/N_K_J_M_TFO_01uCmB%@2P_R_3456Q_789:;gF?@T_BCP2DEtE%3FGd5^lmnop3AqF>rstu{Nvwj_y@xyf_k_zl1{|}~i_aGe_h_H>!QHl_Q<"z@#o_$%g_'7&m_'PMp_&t()O=*+q_r_,-.G./t_0u_1233G4uEw_56y_UNv_7x_m18s_9:;[Sz_gA8;|_{_$?YR}_zG?@A#`$`BCD%`EFG&`^DH(`'`I)`*`J_59`:`l$8mnHHo<`pu>;`qr86=`?`>`stu@`Q8A`vwi6x@A}9yC`D`B`zm?@AC=BCW`DV`EFGHX`IM3Z`JY`K\`[`LMNO<8PQ(NL6&2RSTUj6VWXYZ[\]^a4_`ahN^`bcd``efga`Q2hi]`j9;klAD_`mnopqrd`n7IHc`~`xyzi`{|}~=8!"#e5$f`}M%0N&'()vB*h`+,-./012345j`VNW6|HJG6k`m`7p`89:;<=>?l`@o`j8M1q`Ap?n`\NBt`$tCDEr`u`FGHg`s`IJ<:v`w`KL~MMNOPx`QRSTUVWXy`YZ[e`\]z`^_`abcD4defgh%aVHAaBa;[0GaDamFCa=>?@AB&5CJaDEaFaIaHa%IBAAAE?5FGKaHILaJMaKOaLNaV1WahHQaMSaUa>?NVaTa@YaTXaUVZa&?@ABCDEFGiH.b/bis0b1b2bH.;I3bVGJ_KN1KW1LM4bN6bO5bpEP9@9]7bALQ8bF4WH9bR:bS;bT\LUVUL>DWjAX=bYb=ZJ>@b[?b>b}H\G4)8]^_`abcFbdCb??2LeBbDbEbfAbghijklGbHbm/Dc4noeCpqrIbstuvwxyJbMbz{|}g?~DF!NbSK"Kb#Lb$%&'(Qb)*PbOb+,Sb-.RbTb/012Vb3Ub4MJ56V=FN78Wb97F:XbYb]b[b\b;Zb<^b=_b>?@`bAab7LbbBCDpLcbENCFjGk6GH;Cdb:6IJP@KLMeb=:NOPfbQRSgb&8U:TibUVWVEV:N5XYZ$KKG[\WE\9]^kb_`abcdK>efghijk2NE9l'8#Hmbmobnk8nbvDoqb73lbpjH01ql:ROrpbtuvsrbwKJxY@tbyzub{|}~sbN3!{b"zb#'<|bwb$%&}bxb'(XHvb)*yb+,"c./01-2!caK3~bk045$c789:#c;6L><%c=CA>'c&c(c?@ABCDhbEFjb*c)cGHIJ(Yc{kH|}~EA!Ac"BciG#A??caC$%@c&N>'(\0))5*+,Cc-.xD/DcG@0-L1#IEcFcUC2GN3HcGc4567o<89Jcp0:;Mc<=>KcT2N7LcF9r9fJNc?@TKABPcCQ@O1:2,0DEOcFGHIJQcRcw>KLScMO3NUcj7Of5PVcu6WcQ|@RMFS`@u:TUXcVWXYbCkAZZc\cYc[c["7\]]c&7^g5RM_c_``ca.1bcccv3bcacdec^cefc)NfgcghchtTjcickclci5NmcopO>ncocW=8Fpcjk(Clmqctxcyc+Ezcu^3vZ?dIw|cxyzhB{|}~!wc"{c}c{:#$%&&d.I'&HyEZ6%d#d(5H~c^C{EzE)v:8d*+(d,*d-.-d/.d0+d,d12)d'd3!d4OJU255d2d67d786dsG'L9;;0d9d4d:3d/d;1d}@?@"HA>dBC$HDEFGa@;dHOHI?dSJJ[CK:djdhdfdnd3mdldkd45od678pd:@9qdsd:rd;<=R8>8A?ud@AB|ECtdDEvdF5JlAG9wdGHNHIydzd{dJ|de;}dO7j5*5!eKsLH9~dLMN$efL0:[\])e^_*=>8HA%e+e`a&eP7b.e2ek7cd-eefg6ehiJ9mM<03ejk5k0el1em}E/e,e(3d@n(8op8eqrstuvw5exyz7e{4e|}Q73B9enA~!FeBeC?e=0JL)*+,->e[6lH./0mAPNo=ne1He2~@DeIeKeyDNe4Je56TJK478KL9^0:Me}N;<=>Le3o1lFOe?VePeWe@ASeBC{GDEJf;fHf?Ife4@ABM4CJfKfD]KcMEFGTM7OM9NfTO)HlkfS>*IlfjfmN4nT8h;nHop*8CKqofmfN9O9i0h:rsYG_0tf@CtXGu[Bvwxyvfz{rfufpfsf&K|U8}0qf}~xf!yf"#9F$;6%&&g=G'i;(<6H@FO.LwfT@)*+,S5zf-./|f01{f2}f3&C>G41D56#g7"g89~f:U?eI%g;$gP9SO<5g=>)g*g?@ApgVW22Eg@gXUAgYZBg!B[\DgCgFg]^_GgHg`C?ai2IgWN+?@)320ABCDkgngNGED?FV2G'KHI]7\6JmgKj2LM#4NOq1rgjN]BPDI~gQW2|gzgqgRogSpgTccz{|qA}:h;hY2~.28h!"#$%.h&6h=h7h'5h(vg)*3h+,/h-./P41hh20h|G3LiM9hOh456Gh{?78F5]6Bh9:;[2EhZ:=QEJh?nJ@AhZ2V8)IKh?hAHhBCRhDChEDh:FFIhGFh(KLh`0HI@hJKNhMhkGTh_hM~3bhPhNUhnMO^hPQUMRS*NTUVWxCXYZk3[\rIdh!F]^10_]h`YhrASh[h`ha,Gbc*0dXheahxIfgh\hWhiU>/=jk,ehujhsAvwfhxmhy_Cnhz{VMch83|ih}lh,L~ohhhkh!"#)K!O$%&'sh(*+zh,rhC<-.Qh/012NJ"Lyhxhthuh6134whqh5678UD9:;vh~0<)=>"B?CJ@{h!iYHA~hV>I<#i>6BCDEF$iGyI}hHVhIJKLMNO|hPOO"FsIQ+iR1iSTUV2iW%iXvGYZ/i'i[)i\]^3i(i_,ir1`eF-i0iabcd&ie&Af*i';E?07tLtyLr=ghij7i5iklmnNOop4iqruMs6i8i9iuvi@i%&'()?i1]"]*+Ei,-.Di/0vMu5:N?s6Ki@ABCDLiEnCFGMiHIJzFK:0mc2RiSiLMNi=;NOPQROiBGSTUPiQi[iVUiXiWXYZTi[\]^_`aVibWiX?@;MABCDEFG&jH%jIJ.jKLM(jN0jOfM3j*jPQ+jR/j2j1jSTU)jV,j=jWXYZ[\6j]^_`ab4jc5jd:j;je*3fB59jghi$jjklm8jjpqr@j?jsotuvwxBjAjZiFjyz{|Cj}~DjEj!Gj"l7#Ij$Hj%0=&'()T9'^*+JjQ=,-93.Kj/R10W>Lj12U9Mja03=I4Njj?5UjRjoC67SjPj^68OjVj67^B\jXj5BWj9Zj:;[j]j?@oHYj^j`jS8TjA0ABC_jD[:vNajbjuAEFGHI"NJKLcj5MdjejMdJfjN@:#NOkjPQRljX>jjSTgMgjij=@~?UhjmjV#JojnjWXYl3+KpjZ[\]^_|jrj`sjabctjujdefgyjzjhixjjkvjlqjwjmno{j7ppq(2rstu~j_6}jvwx"k!k$ky#kz%k{1=|&k}'k~!"#(k>@WM)k$JFG*k$+k+8%,5&,k'(k;AG-kP3)*+,.k-0kwM/kF?1k2k.3kQ4/0124k35k6k7kQ3456788k9k:kr29(?;k:;<=>kCDEW7V?Ak$FF@kGH17IJ?kwB-5BkCkKY>LMm7NDkO,KPQ_@Rv5uLJASEkTG?pCZ>UVWFkXYIkZJk[\]>:BBHk^[>>I_`aGkbcl;S1dNkX7en;fm;MOMkLk'AM5CO:3\>ghijklKkmnoPkpQkOkqX8@Mro;'GstTku@@BCvw6MxWkl8y?@SkXkm8UkVkzRk{b@IF|}/C]2~!"pH#C5$4D[k%Yk&LC'()A@R4Zk[?*JN+,-@O.\kgk5D/fk0ckkkdk`k|D_k]k1!Mp;2ak^k345ekt=A86zB7EKZ1b0%F89ik?:hkfFmk;bklknk,8jkV9okXMrkuksk5I@ApkB`6CtkvkDEFGHIzkwkNykxkJKL{k1$lRn8STU%lV&lW>;XYNZZ'l[(l\2=)l*l]^+l,l-l_`a+Cbc.lde0l/lf&Fg1lh-Ki2l3lj4lklm5lnorZFpq]>6lstuvwk9.P7lxyz{8l?I9l|Al}:ll?l#$%@lBl&'(-3gDiIb:W9)OI_2NHElS4U@DlIlyCcLGlHl.5JlcG_B*+qH=EFlGKl2Ll(OBDEO,-q;Kl.1B/\l(A0xFPI213Ol?;r;4^>eG5-8NlMljI6A<7RE89:;<=QlRlX9Pl>?@ASlTlVl#BBUlf4XlWlYlC[l]l^lDEV@FO<_lGR3H`lIvAalblkI/5JclKL6DM[1NOPQdlRSTq?@.m/mAB2m1m0mC4m3mvLD6mE5m7mF8mGHIJ:mKLM9mH?;mNOm6mPQRS?mTUVW@m=mXAmVEDm]Gmd^_`a4?VJ@imAkmBCjm`2DvFlmwG3EEmmR=FomGHBL~mqmrmIIDJ`BwAK(FLpmU5MymNvm%n)F`Csm~DSEtmxm`?OgGLDPB@wm.B$Bum)0"OzmQRTUVaBS5=J?WX|m{mYo0}m/I'nZ[Fk?[\YCx6&n7M?1]WJa2!n"n#n$n;F#Cc0(n)n#t^=B_*ns1LA`/8ZMab+n,EcxAW<,nd/nee=-n+A*Afd0KN1nrH3n2n0ndcT4gnmh5n4nijk6nl8MmnopqrstaFu.K7nY<8nv9nwxy:nz!E{}j0~!"#$Y9|:O-%&'(>n)*+47;n?An@ABCEFDGH"EIJCnKBnLMNOPQRSTUSFDn6=`<[GqCVrqrRnPnstuQnvwxyTnSnzz>Un{|}~VnWn!"#PHS:a?@_FC3AgnBCdnfnDEFGbnHIJKLOoenMNOPkNQRZ8STUVWonXYZ4Ejn[\mnkn]pn^_`qnainbcvnt1dehnfg-Hlnh`>ijklmn[9opqrstuvHKwd6F=/K?@ABCDEFGHI{=JKLzn_JMT1NOFIrCx5P|nQ]9RST,;UV{nm?WXYn?!o#oZ[\]{>^"o$o_`S6aEIbcb<#O~nx:?Ode&ofg%o'o}nhijiFUEklmWDn,oopqCC(or)ostuvw-7x+oyz{|}08~!*o"a>#$%&'()y3*+,0o-?:yA.JD/01234;35;6.o/oCD-o7891o:<7o=>?@:oABCDE9o-EF2o3o6oGH8oIJ@6K;o5oLM4oOPNQRSTU?oV@oWXYZ[Ao>o=o\]^b>*F?@AqosoBroClIDEtoFGHIuoe:JvowoKIKLMNOPKAQR$0KBSxomI{oyo_9zoB8TUVWXEJ}o!p~o"pY!1X?|=Y4#pfG%pZ"1$pDD[MN+F|o&N18\][M^_`abcy64N(7dbB!g&p,3o?eV3(pf)p'pd7g]:c>hi#1YNjkl+p.nm*pno.p,p-pp/p0plN1p2pqI@;H}?g4:Mm28=[85pr4ps;6p3p(;s:p-juVRvw?8pwxy%NqF+1zc@6<{7J|@1mNkM;p}EE{<~!p#nN9p@pBpAp?pCpDp$%zA&b2'()Ep8L*FpGp+*O,1[HpIpJp-Np.KpLpMpOp/01D@2wL34E@56PpsHQpSsLL7RpSp8TpW39VpY?:Wp;$7<=>Xp\p?Zp@AB[ps3Yp]pC^pH0_p`pDEFd>GHapIJG5KdpcpbpqkL\JMNOepfpPQRSTUVWXgpYZhp[ip\]jp^_`abZ4cdefjkpghikllp#Gmnnp;2oqppppqr$1A6GJ:D":`9g=s\?tspvwrpBMh4RH\Fxy|?NNu[7z{|vp}up(~!KK,F"#$%&P1'wptpQIjMxp)*yp+,{pjB[3\3zp-./i42801j423?E`N4567\88|p9}p~p!q#q"qwI$q:;<%q=&q>'q?@ABCD)q(qE*qFGtHLf)?H25IJKL+qM,q,R;]SH{0N;0Ot;0K~>P-q_LQR.q\MB1A;S/qn20qTUV1qWXY3q4qZ6q2q[5q\][4^7q8q_`abcdefg9q:qhi;q=qjklq@qAqoCqB6pqrstuvs3OGGqHq{|}ZCkF~!"Iq#$}G%LBX1n6o6&sCNqp6'(o2Mq)*Kq+Lq,JqXq-./0OqPq1QqRq23Tq4Sq56Y=Uq789Wq:;35Vq<={A38>Yq?@ABCDMBZqEF-FGHI[qJ`q^qL]q_qM\qKNOPbqQRSaqTdqC6cqUeqfqhqgqiqkqjq|9VWlqXYmqZ[\]<3^_nq`aoqbcq?defpqgqqhrqsqijkb9lmtquqnvqwqopxqqr1Hzqs&I{qyq}qtu|qv~qwx!ryz{|}~!""r#$%&'()*+#r,$r-.%r/&r'r(r0)r*r+r,r12-r.r5]/r345678xd459!32:1r0r%L:;<3r4r2r5rbK=>?6r{5@ABCDEFGHIJK%OL7rMNOPQR9rSTUVWXYZ>0[\:r+J8r];rrab?rcnK-;dz:/Aefg@rhiCrjklmArnDropq8BrqErrFrGrKr*;stdBuvLrIrHrJrwx_7yz{PrOrNr|30}~!"#$%&ZrVrWrSrYr'Urb3(LO)XrTrRrQr*+,-\r./_r01^r]r23456II[rs0`r7br89:o3Mr71;dr<=>?crar-C@ABCDpKEFGZNHerIPJKLfrMgrRNOQSTUVhrWirX;DYjr7HorkrlrZ1KDLPF[\^prqr>Fnrmr]*2_yrxr`au1bcdvrursr{3rr2<)2efghijc9km|r{rzrnowrl}rp~rq%s$srs&s-1!s"stt99Lvu#swxyz2K+s{'s|},s~!"#$%)s(s&'(\7)*+,-.-s/.s/s0*s12tr30saD44s55s3s672s8s81s6s9:;7s:s<=>?9s@ABCDsIIOJK;skBm:?sLNOMPQRSTUV@sAsWXBsCs48DsYZ[Es/<\Fs]^_`aGsHsIsbcLsJs?@ABCDns7cZlmposEpsFGHIJKLrssstspNqsusvsMNxswsOPQRSzsTU{sysVW6NXYZ[\|s]^}sTc_~s`abc*!t!p!s!u!J!K!v!\!$!%!?!0#1#2#3#4#5#6#7#8#9#'!(!c!a!d!)!w!A#B#C#D#E#F#G#H#I#J#K#L#M#N#O#P#Q#R#S#T#U#V#W#X#Y#Z#N!O!0!2!.!a#b#c#d#e#f#g#h#i#j#k#l#m#n#o#p#q#r#s#t#u#v#w#x#y#z#P!C!Q!1!o!tostring() -> string Convert the array to an array of machine values and return the string representation.<'!~'!~'0zJ'!s'!v'!X '!q'!@'!~'!~f'!~"'!~'!~'!~V'!~'!~'!~'!~F'!~'!~'!~z'!~6(!~(!~(!~j(!~&(!~(!~(!~Z(!~(!~(!~(!~J(!~ (!~ (!~~ (!~: (!~ (!~ (!S (!~ (!~(!~L(!~(!~(!~(!~<(!~(!~(!~p(!~,(!~(!~(!~`(!~(!~(!~(!~P(!~ (!~(!~(!~@(!~(!~(!~t(!~0 (!~ (!~!(!~d"(!~ #(!~#(!~$(!~T%(!~&(!~&(!~'(!&reducereduce() arg 2 must support iterationreduce() of empty sequence with no initial valuetype 'partial' takes at least one argumentthe first argument must be callablefuncfunction object to use in future partial callsargstuple of arguments to future partial callskeywordsdictionary of keyword arguments to future partial callsa partial object's dictionary may not be deletedsetting partial object's dictionary to a non-dict__dict__O(O)(OOOO)OOOO__reduce____setstate__functools.partialreduce_functoolseast_asian_width(unichr) Returns the east asian width assigned to the Unicode character unichr as string./_AcChAcKReturn state information for pickling.F.__sizeof__() -> size of F in memory, in bytes&*(.*Y*`**%*****J*U*IDREFS 3 $>6Ҁ$l8#E8xh"t/ .4dO?O@OAOBODOEOGOHOIOJOKOLOROTOVOaObOfOhOjOkOmOnOqOrOuOwOxOyOzO}OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOPPPPPPPPP P P PPPPPPPPPPP P"P#P$P'P+P/P0P1P2P3P4P5P6P7P8P9P;P=P?P@PAPBPDPEPFPIPJPKPMPPPQPRPSPTPVPWPXPYP[P]P^P_P`PaPbPcPdPfPgPhPiPjPkPmPnPoPpPqPrPsPtPuPxPyPzP|P}PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPQQQQQQQ Q Q Q QQQQQQQQQQQQQQQQQQ Q"Q#Q$Q%Q&Q'Q(Q)Q*Q+Q,Q-Q.Q/Q0Q1Q2Q3Q4Q5Q6Q7Q8Q9Q:Q;QQBQGQJQLQNQOQPQRQSQWQXQYQ[Q]Q^Q_Q`QaQcQdQfQgQiQjQoQrQzQ~QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQRR R R RRRRRRRRR!R"R#R%R&R'R*R,R/R1R2R4R5RRDRERFRGRHRIRKRNRORRRSRURWRXRYRZR[R]R_R`RbRcRdRfRhRkRlRmRnRpRqRsRtRuRvRwRxRyRzR{R|R~RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRSSSSS S S S SSSSSSSSSSS"S$S%S'S(S)S+S,S-S/S0S1S2S3S4S5S6S7S8SV@VAVBVCVDVEVFVGVHVIVJVKVOVPVQVRVSVUVVVZV[V]V^V_V`VaVcVeVfVgVmVnVoVpVrVsVtVuVwVxVyVzV}V~VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVWWWWW W W WWWWWWWWWWWWWWWWW W!W"W$W%W&W'W+W1W2W4W5W6W7W8WX?X@XAXBXCXEXFXGXHXIXJXKXNXOXPXRXSXUXVXWXYXZX[X\X]X_X`XaXbXcXdXfXgXhXiXjXmXnXoXpXqXrXsXtXuXvXwXxXyXzX{X|X}XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYYYYY Y Y Y YYYYYYYYYYY Y!Y"Y#Y&Y(Y,Y0Y2Y3Y5Y6Y;Y=Y>Y?Y@YCYEYFYJYLYMYPYRYSYYY[Y\Y]Y^Y_YaYcYdYfYgYhYiYjYkYlYmYnYoYpYqYrYuYwYzY{Y|Y~YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYZZ Z Z ZZZZZZZZZZZZZZ!Z"Z$Z&Z'Z(Z*Z+Z,Z-Z.Z/Z0Z3Z5Z7Z8Z9Z:Z;Z=Z>Z?ZAZBZCZDZEZGZHZKZLZMZNZOZPZQZRZSZTZVZWZXZYZ[Z\Z]Z^Z_Z`ZaZcZdZeZfZhZiZkZlZmZnZoZpZqZrZsZxZyZ{Z|Z}Z~ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ[[[[[[[[[ [ [ [ [[[[[[[[[[[[[[[[[ [!["[#[$[%[&['[([)[*[+[,[-[.[/[0[1[3[5[6[8[9[:[;[<[=[>[?[A[B[C[D[E[F[G[H[I[J[K[L[M[N[O[R[V[^[`[a[g[h[k[m[n[o[r[t[v[w[x[y[{[|[~[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[[\\\\\\ \ \ \\\\\\\\\\ \!\#\&\(\)\*\+\-\.\/\0\2\3\5\6\7\C\D\F\G\L\M\R\S\T\V\W\X\Z\[\\\]\_\b\d\g\h\i\j\k\l\m\p\r\s\t\u\v\w\x\{\|\}\~\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\]]]]] ] ] ] ] ]]]]]]]]]]]]]] ]!]"]#]%](]*]+],]/]0]1]2]3]5]6]7]8]9]:];]<]?]@]A]B]C]D]E]F]H]I]M]N]O]P]Q]R]S]T]U]V]W]Y]Z]\]^]_]`]a]b]c]d]e]f]g]h]j]m]n]p]q]r]s]u]v]w]x]y]z]{]|]}]~]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]]^^^ ^ ^ ^ ^^^^^^^ ^!^"^#^$^%^(^)^*^+^,^/^0^2^3^4^5^6^9^:^>^?^@^A^C^F^G^H^I^J^K^M^N^O^P^Q^R^S^V^W^X^Y^Z^\^]^_^`^c^d^e^f^g^h^i^j^k^l^m^n^o^p^q^u^w^y^~^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^___ _ _ ___________!_"_#_$_(_+_,_._0_2_3_4_5_6_7_8_;_=_>_?_A_B_C_D_E_F_G_H_I_J_K_L_M_N_O_Q_T_Y_Z_[_\_^___`_c_e_g_h_k_n_o_r_t_u_v_x_z_}_~________________________________________________________________________`` ` ` `````````"`#`$`,`-`.`0`1`2`3`4`6`7`8`9`:`=`>`@`D`E`F`G`H`I`J`L`N`O`Q`S`T`V`W`X`[`\`^`_```a`e`f`n`q`r`t`u`w`~````````````````````````````````````````````````````````````````````````````aaaaa a a aaaaaaaaaaaaaa!a"a%a(a)a*a,a-a.a/a0a1a2a3a4a5a6a7a8a9a:a;aa@aAaBaCaDaEaFaGaIaKaMaOaPaRaSaTaVaWaXaYaZa[a\a^a_a`aaacadaeafaiajakalamanaoaqarasatavaxayaza{a|a}a~aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbb bbbbbbb b#b&b'b(b)b+b-b/b0b1b2b5b6b8b9b:b;bc?c@cAcDcGcHcJcQcRcScTcVcWcXcYcZc[c\c]c`cdcecfchcjckclcocpcrcsctcucxcyc|c}c~ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccddddd d d dddddddddddd"d#d$d%d'd(d)d+d.d/d0d1d2d3d5d6d7d8d9d;dd@dBdCdIdKdLdMdNdOdPdQdSdUdVdWdYdZd[d\d]d_d`dadbdcdddedfdhdjdkdldndodpdqdrdsdtdudvdwd{d|d}d~ddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddeeeeeeee e e e eeeeeeeeeeeeeeeee e!e"e#e$e&e'e(e)e*e,e-e0e1e2e3e7e:eg?gAgDgEgGgJgKgMgRgTgUgWgXgYgZg[g]gbgcgdgfgggkglgngqgtgvgxgygzg{g}gggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggghhhhh hhhhhhhhhhhh h"h#h$h%h&h'h(h+h,h-h.h/h0h1h4h5h6h:h;h?hGhKhMhOhRhVhWhXhYhZh[h\h]h^h_hjhlhmhnhohphqhrhshuhxhyhzh{h|h}h~hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiiiiii i i iiiiiiiiiiiiiii!i"i#i%i&i'i(i)i*i+i,i.i/i1i2i3i5i6i7i8i:i;ii@iAiCiDiEiFiGiHiIiJiKiLiMiNiOiPiQiRiSiUiViXiYi[i\i_iaibidieigihiiijilimioipirisitiuivizi{i}i~iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiijjjjjjjjj j j j jjjjjjjjjjjjjjjj j"j#j$j%j&j'j)j+j,j-j.j0j2j3j4j6j7j8j9j:j;jl?lClDlElHlKlLlMlNlOlQlRlSlVlXlYlZlblclelflglklllmlnlolqlslulwlxlzl{l|lllllllllllllllllllllllllllllllllllllllllllllllllllllllllllmmmmmm m m mmmmmmmmmmmm m!m"m#m$m&m(m)m,m-m/m0m4m6m7m8m:m?m@mBmDmImLmPmUmVmWmXm[m]m_mambmdmemgmhmkmlmmmpmqmrmsmumvmymzm{m}m~mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmnnnnnnnn n nnnnnnnnnnn"n&n'n(n*n,n.n0n1n3n5n6n7n9n;nn?n@nAnBnEnFnGnHnInJnKnLnOnPnQnRnUnWnYnZn\n]n^n`nanbncndnenfngnhninjnlnmnonpnqnrnsntnunvnwnxnynzn{n|n}nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnooooooo o o o ooooooooooooooo!o"o#o%o&o'o(o,o.o0o2o4o5o7o8o9o:o;op?p@pApBpCpDpEpFpGpHpIpJpKpMpNpPpQpRpSpTpUpVpWpXpYpZp[p\p]p_p`papbpcpdpepfpgphpipjpnpqprpsptpwpypzp{p}ppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppppqqqqqqqqq q q qqqqqqqqqqqq q!q"q#q$q%q'q(q)q*q+q,q-q.q2q3q4q5q7q8q9q:q;qq?q@qAqBqCqDqFqGqHqIqKqMqOqPqQqRqSqTqUqVqWqXqYqZq[q]q_q`qaqbqcqeqiqjqkqlqmqoqpqqqtquqvqwqyq{q|q~qqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqqrrrrrrrr r r r r rrrrrrrrrrrrrrrrrr r!r"r#r$r%r&r'r)r+r-r.r/r2r3r4r:rr@rArBrCrDrErFrIrJrKrNrOrPrQrSrTrUrWrXrZr\r^r`rcrdrerhrjrkrlrmrprqrsrtrvrwrxr{r|r}rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrr p!q!r!s!t!u!v!w!x!y!569:?@=>ABCD;<78134  % 5 ! !!!!!""#"R"f"g""P%Q%R%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%l%m%n%o%p%q%r%s%%%%%%%%%%%%%%%%%%%%%%%%% &"000QDHa!0"0#0$0%0&0'0(0)02333333333330!!12 00000000IJKLMNOPQRTUVWYZ[\]^_`abcdefhijk0rrrrrrrrrrrrrrrrrsssssss s s s ssssssssss s#s$s&s's(s-s/s0s2s3s5s6s:s;st?t@tBtCtDtEtFtGtHtItJtKtLtMtNtOtPtQtRtStTtVtXt]t`tatbtctdtetftgthtitjtktltntotqtrtstttutxtytzt{t|t}tttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttuuuuuuuu u u u uuuuuuuuuuu u!u"u#u$u&u'u*u.u4u6u9uw?wBwDwEwFwHwIwJwKwLwMwNwOwRwSwTwUwVwWwXwYw\w]w^w_w`wdwgwiwjwmwnwowpwqwrwswtwuwvwwwxwzw{w|wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwxxxxxx x xxxxxxxxx x!x"x$x(x*x+x.x/x1x2x3x5x6x=x?xAxBxCxDxFxHxIxJxKxMxOxQxSxTxXxYxZx[x\x^x_x`xaxbxcxdxexfxgxhxixoxpxqxrxsxtxuxvxxxyxzx{x}x~xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxyyyyyyy y y y y yyyyyyyyyyyyyyyyy y!y"y#y%y&y'y(y)y*y+y,y-y.y/y0y1y2y3y5y6y7y8y9y=y?yByCyDyEyGyJyKyLyMyNyOyPyQyRyTyUyXyYyaycydyfyiyjykylynypyqyrysytyuyvyyy{y|y}y~yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyzzzzz z z zzzzzzzzzzzzzz!z"z$z%z&z'z(z)z*z+z,z-z.z/z0z1z2z4z5z6z8z:z>z@zAzBzCzDzEzGzHzIzJzKzLzMzNzOzPzRzSzTzUzVzXzYzZz[z\z]z^z_z`zazbzczdzezfzgzhzizjzkzlzmznzozqzrzszuz{z|z}z~zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{{{{{ { { {{{{{{{{{{{{!{"{#{'{){-{/{0{2{4{5{6{7{9{;{={?{@{A{B{C{D{F{H{J{M{N{S{U{W{Y{\{^{_{a{c{d{e{f{g{h{i{j{k{l{m{o{p{s{t{v{x{z{|{}{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{|||||||| | | |||||||||||||||| |!|"|#|$|%|(|)|+|,|-|.|/|0|1|2|3|4|5|6|7|9|:|;|<|=|>|B|C|D|E|F|G|H|I|J|K|L|N|O|P|Q|R|S|T|U|V|W|X|Y|Z|[|\|]|^|_|`|a|b|c|d|e|f|g|h|i|j|k|l|m|n|o|p|q|r|u|v|w|x|y|z|~||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||}}}}}}}}} } } } }}}}}}}}}}}}}}}}}}}!}#}$}%}&}(})}*},}-}.}0}1}2}3}4}5}6}7}8}9}:};}<}=}>}?}@}A}B}C}D}E}F}G}H}I}J}K}L}M}N}O}P}Q}R}S}T}U}V}W}X}Y}Z}[}\}]}^}_}`}a}b}c}d}e}f}g}h}i}j}k}l}m}o}p}q}r}s}t}u}v}x}y}z}{}|}}}~}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~~~ ~ ~ ~ ~ ~~~~~~~~~~~~~~~~~~~ ~!~"~#~$~%~&~'~(~)~*~+~,~-~.~/~0~1~2~3~4~5~6~7~8~9~:~<~=~>~?~@~B~C~D~E~F~H~I~J~K~L~M~N~O~P~Q~R~S~T~U~V~W~X~Y~Z~[~\~]~^~_~`~a~b~c~d~e~f~g~h~i~j~k~l~m~n~o~p~q~r~s~t~u~v~w~x~y~z~{~|~}~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 79;<=>?@ACFGHIJKLMNORSVY[\]^`cdefgklmopsuvwxz{|} !#$+,-./0249:<>@ADEGHINOPQSUVWY[\]^_`abcdefghklmnoprstuvwxyz{|}~ŀǀȀɀʀˀπЀрҀӀԀՀ؀߀  !"#$%&'()*+-.034579:;<=?@ABCDEGIMNORVWX[\]^_abcdfhjklorsuvwxāŁǁȁɁˁ́΁ρЁсҁӁԁՁցׁ؁فځہ܁݁ށ߁  $%&').2:<=?@ABCEFHJLMNPQRSTUVWY[\]^`abcdefgijklmquvwx{|‚ÂłƂɂЂւقڂ݂  !"#$%&)*.027;=>?ABDEHJKLMNSUVWXY]bpqrstuvyz~ƒÃăƃȃɃ˃̓΃Ѓу҃ӃՃ׃كڃۃރ  !"#)*+,-./02345679:;>?@ABCDEGHIJKLMNOPRSTUVX]^_`bdefghjnoprtwy{|}~„ÄńƄDŽȄ˄̄΄τ҄ԄՄׄ؄لڄۄ܄ބ  "#$%&'()*-./0123456>?@ABDEFGKLMNOPQRSTUWXZ[\]_`abcefgijklmnopqsuvwx|}…ÅąŅƅDžȅʅ˅̅ͅ΅х҅ԅօׅ؅مڅۅ݅ޅ߅  !"#$%&(*+,-./012345679:;=>?@ABCDEFGHIJKLRSUVWXY[\]_`acdefghijmoprstuvwx†ÆņȆ̆͆҆ӆՆֆ׆چ܆݆  $&'(*+,-/0235689:<=@ABCDEFJKMOPQRTUVXZ[\]^_abfghijklmoqrsuwxyz‡ÇćŇLJȇɇ͇̇·χЇԇՇևׇ؇هڇ܇݇އ߇  #$%&'()*+,-./01345678:;=>?ABCFGHIJKNOPQRSUVXZ[\]^_`fgjmoqstuvxyz{|ÈĈLjȈʈˈ͈̈ψЈшӈֈ׈ڈۈ܈݈ވ  "#$&'(),-./1235789:;<=>?@BCEFGHIJKLMNOPQRSTUVWXYZ[\]`abcdeghijklmnopqrstuvwxyz|}~É͉ӉԉՉ׉؉ىۉ݉߉  !"#$%&'()*+,-./0123456789:;<=?@ABCDEFGIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxz{|}~ŠÊĊŊƊNJȊɊʊˊ̊͊ΊϊЊъҊӊԊՊ֊׊؊يڊۊ܊݊ފߊ  !"#$%'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdeghijkmnopqrstuvwxyz{|}~NjЋ 89:;<=>?@BCDEHJKMNOPQRSTVWXY[\]^_`cdefghilmnopqrtuvw{|}~ŒÌČŌƌnjȌɌʌˌ̌͌ΌόЌьҌӌԌՌ֌׌،ٌڌی܌݌ތߌ  QRW_ehijlnoqrxyz{|}~ōǍȍɍʍ͍ЍҍӍԍՍ؍ٍ܍  !$%&'(+-0234678;<>?CEFLMNOPSTUVWXZ[\]^_`abcdeghjknqsuwxyz{}~ŽÎĎŎƎǎȎɎʎˎ͎̎ώЎюҎӎԎՎ֎׎؎َڎێ܎ݎގߎ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdejÏƏɏʏˏ̏͏Ϗҏ֏׏ڏ #$%'()*+,0123479:=?@CEFHIJKLNTUVYZ\]^_`adfgijklopqrsvwxyz{|~ÐƐȐɐː̐͐ҐԐՐ֐ِؐڐސߐ  !$%&'()*+,-.02345678:;<=>?@ABDEGHQSTUVXY[\_`fghkmsz{|‘ÑđőƑȑˑБґӑԑՑ֑בّؑڑۑݑޑߑ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrsuvwxyz{|}~’ÒĒŒƒǒɒʒ˒̒͒ΒϒВђҒӒԒՒ֒גْؒڒےܒݒޒߒ  !"#$%&'()*+,-./0123456789:;<=?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghiklmnopqrstuvwxyz{|}~“ÓēœƓǓȓɓ˓͓̓ΓϓГѓғӓԓՓדؓٓړۓܓݓޓߓ  !"#$%&'()*+,-./0123456789:;<=?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijlmnopqrstuvwxyz{|}~ǔϔӔԔڔ '3=CHKUZ`ntuwxyz{|}~•ÕĕŕƕǕȕɕʕ˕͕̕ΕϕЕѕҕӕԕՕ֕וٕؕڕەܕݕޕߕ #$%&'()+,-/0789:>ACJNOQRSVWXYZ\]^`cefkmnopqsxyz{|}~–ÖȖʖ˖ЖіӖԖ֖זٖؖږۖܖݖޖߖ  !"#$%&'()+,./134567:;<=?@ABCDEFGHIJKLMNOPQTUWXZ\]_cdfghjklmnopqruwxyz{}~—×ėŗƗǗȗɗʗ˗̗͗ΗϗЗїҗӗԗ՗֗חؗٗڗۗܗݗޗߗ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrst˜ØĘŘƘǘȘɘʘ˘̘͘ϘИԘ֘טۘܘݘ  !"#$%&'()*+,-/0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSVWXYZ[\]^_`abdfsxy{~™ÙęřƙǙșəʙ˙̙͙ΙϙЙљҙәԙՙ֙יؙٙڙۙܙݙޙߙ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkrÚĚƚǚȚɚʚ͚ΚϚКҚԚ՚֚ךٚښۚܚݚޚ  !"$%&'()*+,-.013456789:=>?@FJKLNPRSUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~›ÛěśƛǛțɛʛ˛̛͛ΛϛЛћқӛԛ՛֛כ؛ٛڛۛܛݛޛߛ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{}~œȜɜќҜڜۜ  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ÝĝŝƝǝȝɝʝ˝̝͝ΝϝНѝҝӝԝ՝֝ם؝ٝڝ۝ܝݝޝߝ $'.04;<@MPRSTVY]_`abenortuvwxyz{|}žÞŞƞǞȞʞ˞̞ОҞӞ՞֞מٞڞޞ !#$%&'()*+-.01234568: [(suffix, mode, type), ...] Return a list of (suffix, mode, type) tuples describing the files that find_module() looks for.Common string manipulations, optimized for speed. Always use "import string" rather than referencing this module directly.waitpid(pid, options) -> (pid, status) Wait for completion of a given child process.mr$rr$expected a value, found noneexpected string keyexpected non-empty tupleexpected non-empty string at tuple index 0expected string|Oc:__init__skip character is only supported with a dict sourceO!:addpathO!:delpathaddpathadd a pathdelpathremove a pathparsers.dirsdirsdirsnew buffer size too largenew position too largeI/O operation on uninitialized objectI/O operation on closed fileI/O operation on uninitialized objectI/O operation on closed fileI/O operation on uninitialized object|O:readI/O operation on closed fileinteger argument expected, got '%s'I/O operation on uninitialized object|O:readlineI/O operation on closed fileinteger argument expected, got '%s'I/O operation on uninitialized objectI/O operation on closed filereadline() should have returned an str object, not '%.200s'I/O operation on uninitialized object|O:truncateI/O operation on closed fileinteger argument expected, got '%s'Negative size value %zdI/O operation on uninitialized objectO|i:seekI/O operation on closed fileInvalid whence (%i, should be 0, 1 or 2)Negative seek position %zdCan't do nonzero cur-relative seeksI/O operation on uninitialized objectunicode argument expected, got '%s'I/O operation on closed fileinitial_valuenewline |Oz:__init__illegal newline value: %sinitial_value must be unicode or None, not %.200sOiI/O operation on uninitialized objectI/O operation on closed fileI/O operation on uninitialized objectI/O operation on closed fileI/O operation on uninitialized objectI/O operation on closed file(OOnN)I/O operation on closed file%.200s.__setstate__ argument should be 4-tuple, got %.200sthird item of state must be an integer, got %.200sposition value cannot be negativefourth item of state should be a dict, got a %.200sI/O operation on uninitialized objectI/O operation on uninitialized objectI/O operation on closed fileI/O operation on uninitialized objectI/O operation on closed fileclosegetvaluereadreadlinetelltruncateseekwriteseekablereadablewritable__getstate____setstate__closednewlinesline_buffering_io.StringIOloads(string) Convert the string to a value. If no valid value is found, raise EOFError, ValueError or TypeError. Extra characters in the string are ignored.n"`"o"&    (  "$"&$(*(*,0 .,402649=6;<:>@BCDGFEJHLN.P TVTXXZV^Z\``b^jdlbpnhjlnprrvt|~tv2xy{}'     )!!#%#'%)+)+-  /-51375:>7<=;?ACDEHGFKIMO/Q UWUYY[W_[]aac_kemcqoikmoqsswu}uw3z|~.L,N* /M-O+PRQSdefgxyz{01 ()89HIYhiprt !v01x@AzPQ|`a  SPQ]9\^Wvw"#%$&) 1 4 K H L H J L K &  ;=@AC89\]hi    "$&#%'*,.+-/246357:<>;=?BDCEJLKMRTVSUW[]_bdfcegjlnkmo!!!!!!" " "$"&"A"D"G"I"m"b"p"q"t"u"x"y"""""""""""""""""""0L0N0P0R0T0V0X0Z0\0^0`0b0e0g0i0p0q0s0t0v0w0y0z0|0}000000000000000000000000000000000/fd/%dbad flagsauthoratitive negative responsetemporary lookup failurename resolution failurefamily not supportedai_socktype not supportedsrvname unsupportedno memorysee errnooverflowbogus gai_strerror argumentEEEE"<"<Etuple() -> empty tuple tuple(iterable) -> tuple initialized from iterable's items If the argument is a tuple, the return value is the same object.S.rstrip([chars]) -> unicode Return a copy of the string S with trailing whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is a str, it will be converted to unicode before stripping.q8΀7q8Flush and close the IO object. This method has no effect if the file is already closed. ו6,E6re"L3D6D-**P9D-B.split([sep[, maxsplit]]) -> list of bytearray Return a list of the sections in B, using sep as the delimiter. If sep is not given, B is split on ASCII whitespace characters (space, tab, return, newline, formfeed, vertical tab). If maxsplit is given, at most maxsplit splits are done.٢6,E6r?9Ltoo many digits in integercannot convert float infinity to integercannot convert float NaN to integer../Objects/longobject.can integer is requirednb_int should return int objectPython int too large to convert to C longPython int too large to convert to C int../Objects/longobject.clong int too large to convert to intcan't convert negative value to unsigned long../Objects/longobject.ccan't convert negative value to unsigned longlong int too large to convert../Objects/longobject.clong has too many bits to express in a platform size_tbyte array too long to convert to intcan't convert negative long to unsignedlong too big to convert../Objects/longobject.can integer is requiredinteger conversion failed../Objects/longobject.c../Objects/longobject.c../Objects/longobject.can integer is requirednb_int should return int object../Objects/longobject.clong is too large to format../Objects/longobject.clong is too large to formatlong string too large to convertlong() arg 2 must be >= 2 and <= 36invalid literal for long() with base %d: %slong division or modulo by zerohuge integer: number of bits overflows a Py_ssize_t../Objects/longobject.clong int too large to convert to floatclassic long divisiondivision by zerointermediate overflow during divisioninteger division result too large for a floatpow() 2nd argument cannot be negative when 3rd argument specifiedpow() 3rd argument cannot be 0negative shift countnegative shift countxbase|Oi:longlong() missing string argumentinvalid literal for long() with base %d: %slong() can't convert non-string with explicit base(N)O:__format____format__ requires str or unicodeconjugateReturns self, the complex conjugate of any long.bit_length__trunc__Truncating an Integral returns itself.__getnewargs____format____sizeof__Returns size in memory, in bytesrealthe real part of a complex numberimagthe imaginary part of a complex numbernumeratorthe numerator of a rational number in lowest termsdenominatorthe denominator of a rational number in lowest termslongbits_per_digitsize of a digit in bitssizeof_digitsize in bytes of the C type used to represent a digitsys.long_info1Z11\1getcwdu() -> path Return a unicode string representing the current working directory.<)A)G)L)(F8,F8.F83F8B.translate(table[, deletechars]) -> bytearray Return a copy of B, where all characters occurring in the optional argument deletechars are removed, and the remaining characters have been mapped through the given translation table, which must be a bytes object of length 256.pAy@S.isnumeric() -> bool Return True if there are only numeric characters in S, False otherwise.isnan(x) -> bool Check if float x is not a number (NaN).translate(s,table [,deletechars]) -> string Return a copy of the string s, where all characters occurring in the optional argument deletechars are removed, and the remaining characters have been mapped through the given translation table, which must be a string of length 256.T# [#b#m#w#<H)^$BBZD!e$P_60=+? J@:Change stream position. Seek to character offset pos relative to position indicated by whence: 0 Start of stream (the default). pos should be >= 0; 1 Current position - pos must be 0; 2 End of stream - pos must be 0. Returns the new absolute position. . \) .s Dk/ .s Dk/ . 4x$.pyU.pycrbCan't initialize import file table..pyc.pyo# installing zipimport hook meta_pathpath_importer_cachepath_hooksinitializing sys.meta_path, sys.path_hooks, path_importer_cache, or NullImporter failedzipimport# can't import zipimport zipimporter# can't import zipimport.zipimporter # installed zipimport hook not holding the import lockPyImport_GetModuleDict: no module dictionary!pathargvps1ps2exitfuncexc_typeexc_valueexc_tracebacklast_typelast_valuelast_tracebackpath_hookspath_importer_cachemeta_pathflagsfloat_infostdin__stdin__stdout__stdout__stderr__stderr____builtin__# clear __builtin__._ _sys# clear sys.%s # restore sys.%s __main__# cleanup __main__ __main____builtin__sys# cleanup[1] %s __builtin__sys# cleanup[2] %s sys# cleanup sys sys__builtin__# cleanup __builtin__ __builtin___PyImport_FixupExtension: module %.200s not loadedimport %s # previously loaded (%s) import: deleting existing key insys.modules failed__builtins____builtins____file__Loaded module %.200s not found in sys.modulesrb# %s has bad magic # %s has bad mtime # %s matches %s Non-code object in %.200sBad magic number in %.200simport %s # precompiled from %s wb# can't create %s # can't write %s # wrote %s unable to get file status from '%s'import %s # precompiled from %s import %s # from %s dont_write_bytecodeimport %s # directory %s [O]__file____path____init__path_importer_cachepath_hooksmodule name is too longmeta_pathsys.meta_path must be a list of import hooksfind_modulesOfull frozen module name too long.No frozen submodule named %.200spathsys.path must be a list of directory namespath_hookssys.path_hooks must be a list of import hookspath_importer_cachesys.path_importer_cache must be a dictfind_modulesNot importing directory '%.*s': missing __init__.py# trying %s rbNo module named %.200s__init__.pyocfile object required for import (type code %d)Purported %s module %.200s not foundbuiltinfrozen%s module %.200s not properly initializedbuiltinfrozenimport hook without loaderload_modulesDon't know how to import %.200s (type code %d)Cannot re-init internal module %.200simport %s # builtin No such frozen object named %.200sExcluded frozen object named %.200sExcluded frozen object named %.200simport %s # frozen%s packagefrozen object %.200s is not a code object__path__Failed to import %.200s because the import lockis held by another thread.Import by filename is not supported.Empty module namenot holding the import lock__name____path____package____package__ set to non-stringAttempted relative import in non-packagePackage name too longModule name too longCould not set __package__Attempted relative import in non-packageCould not set __package__Module name too longCould not set __package__Attempted relative import beyond toplevel packageParent module '%.200s' not found while handling absolute importParent module '%.200s' not loaded, cannot perform relative importEmpty module nameModule name too longNo module named %.200s__path__Item in ``from list'' not a string__all__Module name too long__path__PyImport_ReloadModule: no modules_reloading dictionary!reload() argument must be modulereload(): module %.200s not in sys.modulesreload(): parent %.200s not in sys.modules__path____import____builtins__[s]__doc____builtin__{OO}OOOOissiOs(ssi)s|O:find_modules:init_builtins:init_frozens:get_frozen_objects:is_builtins:is_frozenrbbad/closed file objectss|O!:load_compiledrbss|O!:load_sourcersOs(ssi):load_moduleinvalid file open mode %.200sload_module arg#2 should be a file or Noness:load_packages:new_modulereloadfind_moduleget_magicget_suffixesload_modulenew_modulelock_heldacquire_lockrelease_lockget_frozen_objectinit_builtininit_frozenis_builtinis_frozenload_compiledload_packageload_sourceNullImporter()s:NullImporterempty pathnameexisting directoryfind_moduleAlways return Noneimp.NullImporterNull importer objectimpSEARCH_ERRORPY_SOURCEPY_COMPILEDC_EXTENSIONPY_RESOURCEPKG_DIRECTORYC_BUILTINPY_FROZENPY_CODERESOURCEIMP_HOOKNullImporter8-\/1\x$8/d$$readlink(path) -> path Return a string representing the path to which the symbolic link points.D.iteritems() -> an iterator over the (key, value) items of D6,L"#E6"!LI1$ LS.isalpha() -> bool Return True if all characters in S are alphabetic and there is at least one character in S, False otherwise.tofile(f) Write all items (as machine values) to the file object f. Also called as write.пn_sequence_fieldsCharacter and line based layer over a BufferedIOBase object, buffer. encoding gives the name of the encoding that the stream will be decoded or encoded with. It defaults to locale.getpreferredencoding. errors determines the strictness of encoding and decoding (see the codecs.register) and defaults to "strict". newline controls how line endings are handled. It can be None, '', '\n', '\r', and '\r\n'. It works as follows: * On input, if newline is None, universal newlines mode is enabled. Lines in the input can end in '\n', '\r', or '\r\n', and these are translated into '\n' before being returned to the caller. If it is '', universal newline mode is enabled, but line endings are returned to the caller untranslated. If it has any of the other legal values, input lines are only terminated by the given string, and the line ending is returned to the caller untranslated. * On output, if newline is None, any '\n' characters written are translated to the system default line separator, os.linesep. If newline is '', no translation takes place. If newline is any of the other legal values, any '\n' characters written are translated to the given string. If line_buffering is True, a call to flush is implied when a call to write contains a newline character.acquire_lock() -> None Acquires the interpreter's import lock for the current thread. This lock should be used by import hooks to ensure thread-safety when importing modules. On platforms without threads, this function does nothing.;SG.^\N]eg^ggXa dAegj`shh    !"# $_##\##@$\#$$%000 0'0/0K0S0h0o000000000bBhHiIlLqQinteger argument expected, got floatinteger argument expected, got non-integer (implicit conversion using __int__ is deprecated)__int__ method returned non-integercannot convert argument to integer'%c' format requires 0 <= number <= %zu'%c' format requires %zd <= number <= %zdbyte format requires -128 <= number <= 127ubyte format requires 0 <= number <= 255char format require string of length 1short format requires SHRT_MIN <= number <= SHRT_MAXushort format requires 0 <= number <= USHRT_MAXrequired argument is not a floatrequired argument is not a floatrequired argument is not a floatrequired argument is not a floatrequired argument is not a floatrequired argument is not a floatbad char in struct formattotal struct size too longformatS:Structs*:unpackunpack requires a string argument of length %zdbufferoffsetz*|n:unpack_fromunpack_from requires a buffer argumentunpack_from requires a buffer of at least %zd bytesargument for 's' must be a stringargument for 'p' must be a stringinteger out of range for '%c' format codepack expected %zd items for packing (got %zd)pack_into expected buffer argumentpack_into expected offset argumentpack_into expected %zd items for packing (got %zd)pack_into requires a buffer of at least %zd bytespackpack_intounpackunpack_from__sizeof__formatstruct format stringsizestruct size in bytesStructmissing format argumentmissing format argumentunpackmissing format argument_clearcachecalcsizepackpack_intounpackunpack_from0.2_structstruct.errorerrorStruct__version___PY_STRUCT_RANGE_CHECKING_PY_STRUCT_FLOAT_COERCEaCoc?IDREFEC.<OC.C.DCg/C.<C.C.[@C.QBԣA/dev/consS.istitle() -> bool Return True if S is a titlecased string and there is at least one character in S, i.e. uppercase characters may only follow uncased characters and lowercase characters only cased ones. Return False otherwise./?/!/P$/r$/<3-/O"/Pu6/;/"/=l&1/ u$/.1/$/jt/ /&t"/8naninfINFNANS.swapcase() -> unicode Return a copy of S with uppercase characters converted to lowercase and vice versa.encode(obj, [encoding[,errors]]) -> object Encodes obj using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a ValueError. Other possible values are 'ignore', 'replace' and 'xmlcharrefreplace' as well as any other name registered with codecs.register_error that can handle ValueErrors.read(fd, buffersize) -> string Read a file descriptor.ޚ6,L"E6"!' LB.remove(int) -> None Remove the first occurance of a value in B.S.split([sep [,maxsplit]]) -> list of strings Return a list of the words in S, using sep as the delimiter string. If maxsplit is given, at most maxsplit splits are done. If sep is not specified or is None, any whitespace string is a separator and empty strings are removed from the result.H))>A|<$k!jq k 6v/datetime(year, month, day[, hour[, minute[, second[, microsecond[,tzinfo]]]]]) The year, month and day arguments are required. tzinfo may be None, or an instance of a tzinfo subclass. The remaining arguments may be ints or longs. _multibytecodec__create_codecencoding name must be a string.no such codec is supported.multibytecodec.__map_*getcodecmultibytecodec.__map_*ksx1001cp949cp949exteuc_krcp949johab_codecs_kr(integer,string=None) -> string. Activates/queries locale processing.replace (str, old, new[, maxsplit]) -> string Return a copy of string str with all occurrences of substring old replaced by new. If the optional argument maxsplit is given, only the first maxsplit occurrences are replaced.!ojA 1jh&jg!icompress(data) -- Return a string containing data compressed. After calling this function, some of the input data may still be stored in internal buffers for later processing. Call the flush() method to clear these buffers.D.viewvalues() -> an object providing a view on D's valuesRandom() -> create a random number generator with its own internal state.B~"O~"8'U~"$Z~"-b~"i~"p~"%~"ê~" +Ę!ʘ!recvfrom_into(buffer[, nbytes[, flags]]) -> (nbytes, address info) Like recv_into(buffer[, nbytes[, flags]]) but also return the sender's address info.=8=8%>8v60>8:>8a>8p>8{>8>8$putenv(key, value) Change or add an environment variable.throw(typ[,val[,tb]]) -> raise exception in generator, return next yielded value or raise StopIteration.!"#$%&'()*+,-012345689@ABCDEFGHIJKLMNPQRSTUVXYZ[`abcdefhijklmpqr1T3v#<q<C<=6I<%T<'Z<,!c<.@"l<Q@9v<${<9<|/<|3<<<Q$H@Iu"a6$@1\-GS.replace(old, new[, count]) -> string Return a copy of string S with all occurrences of substring old replaced by new. If the optional argument count is given, only the first count occurrences are replaced.accept() -> (socket object, address info) Wait for an incoming connection. Return a new socket representing the connection, and the address of the client. For IP sockets, the address info is a pair (hostaddr, port).p@Ո$ڈ$""  "%sinput line too longcan't re-enter readline$ $$$recv_into(buffer, [nbytes[, flags]]) -> nbytes_read A version of recv() that stores its data into a buffer rather than creating a new string. Receive up to buffersize bytes from the socket. If buffersize is not specified (or 0), receive up to the size available in the given buffer. See recv() for documentation about the flags.@@flush( [mode] ) -- Return a string containing any remaining compressed data. mode can be one of the constants Z_SYNC_FLUSH, Z_FULL_FLUSH, Z_FINISH; the default value used when mode is not specified is Z_FINISH. If mode == Z_FINISH, the compressor object can no longer be used after calling the flush() method. Otherwise, more data can still be compressed.rfind(s, sub [,start [,end]]) -> int Return the highest index in s where substring sub is found, such that sub is contained within s[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.Encoding of the text stream. Subclasses should override. TUVWXYZ[\]a@ABCDEFGHIJKLMNOPQRSei`cakjdlfn_mbgh~rsopqutLMNOPQRTSVUEWZ[YX^\]_a`bcdefghi[jklmnopqrutvwxyz{}|KGJHF@ACDEHFGJIKMLNOPQRSTWUVXZ\]^_`dfghjkmnpoqr@stvwxyz{|D}~ACIBs~BYabceilu|_`ʁRx1y[x1"" """"$"0"_Dpuѝ!u"il)U 4%\$float.__getformat__(typestr) -> string You probably don't want to use this function. It exists mainly to be used in Python's test suite. typestr must be 'double' or 'float'. This function returns whichever of 'unknown', 'IEEE, big-endian' or 'IEEE, little-endian' best describes the format of floating point numbers used by the C type named by typestr.seek(fd, pos, how) -> newpos Set the current position of a file descriptor.get_debug() -> flags Get the garbage collection debugging flags. cZbBu#hH0iI5Tl.MLfdabort() -> does not return! Abort the interpreter immediately. This 'dumps core' or otherwise fails in the hardest way possible on the hosting operating system.ӓNegative size passed to PyString_FromStringAndSizestring is too largestring is too long for a Python string%ld%lld%ld%d%lu%llu%lu%u%i%x%pdecoder did not return a string object (type=%.400s)encoder did not return a string object (type=%.400s)deletion of interned string failedImmortal interned string died.Inconsistent interned string state.Trailing \ in stringstrictinvalid \x escapereplaceignoredecoding error; unknown error handling code: %.400s../Objects/stringobject.cexpected string or Unicode object, %.200s foundexpected string without null bytesempty separatorempty separatorempty separatorempty separator\%c\t\n\r\x%02xstring is too large to make repr\x%02xcannot concatenate 'str' and '%.200s' objectsstrings are too large to concatstrings are too large to concatrepeated string is too longrepeated string is too long'in ' requires string as left operand, not %.200sstring index out of rangestring indices must be integers, not %.200saccessing non-existent string segmentCannot use string as modifiable bufferaccessing non-existent string segment|O:lstrip|O:rstrip|O:strip|On:split|On:rsplitsequence item %zd: expected string, %.80s foundjoin() result is too long for a Python stringfind/rfind/index/rindexsubstring not foundsubstring not found%s arg must be None, str or unicodecounttranslatedeletions are implemented differently for unicodetranslation table must be 256 characters longdeletions are implemented differently for unicodereplace string is too longreplace string is too longreplace string is too longreplace string is too longreplace string is too longreplace string is too longOO|n:replacestartswithstartswith first arg must be str, unicode, or tuple, not %sendswithendswith first arg must be str, unicode, or tuple, not %sencodingerrors|ss:encodeencoder did not return a string/unicode object (type=%.400s)encodingerrors|ss:decodedecoder did not return a string/unicode object (type=%.400s)|i:expandtabsnew string is too longn|c:ljustn|c:rjustn|c:centern:zfill|i:splitlines(s#)cannot switch from manual field specification to automatic field numberingcannot switch from automatic field numbering to manual field specificationToo many decimal digits in format stringMissing ']' in format stringOnly '.' or '[' may follow ']' in format field specifierEmpty attribute in format stringend of format while looking for conversion specifierexpected ':' after format specifierSingle '}' encountered in format stringSingle '{' encountered in format stringunmatched '{' in formatUnknown conversion specifier %cUnknown conversion specifier \x%xMax string recursion exceededformatteriteratorfieldnameiteratorO:__format____format__ arg must be str or unicode, not %sjoinsplitrsplitlowerupperislowerisupperisspaceisdigitistitleisalphaisalnumcapitalizecountendswithpartitionfindindexlstripreplacerfindrindexrstriprpartitionstartswithstripswapcasetranslatetitleljustrjustcenterzfillformat__format___formatter_field_name_split_formatter_parserencodedecodeexpandtabssplitlines__sizeof____getnewargs__object|O:strThe basestring type cannot be instantiatedbasestringstr../Objects/stringobject.cnot enough arguments for format stringfloat argument required, not %.200s../Objects/stringobject.cstring too large in _PyString_FormatLongint argument required, not %.200s-%s0%c%%.%dl%c%s%%%s.%dl%c#formatted integer is too long (precision too large?)c;%c requires int or charb;%c requires int or char../Objects/stringobject.cformat requires a mappingincomplete format key* wants intwidth too big* wants intprec too bigincomplete format%%s argument has non-string str()%%%c format: a number is required, not %.200sunsupported format character '%c' (0x%x) at index %zdnot all arguments converted during string formattingnot all arguments converted during string formattingPyString_InternInPlace: strings only please!releasing %ld interned strings Inconsistent interned string state.total size of all interned strings: %ld/%ld mortal/immortal 333333?digit(unichr[, default]) Returns the digit value assigned to the Unicode character unichr as integer. If no such value is defined, default is returned, or, if not given, ValueError is raised.B.find(sub [,start [,end]]) -> int Return the lowest index in B where subsection sub is found, such that sub is contained within B[start,end]. Optional arguments start and end are interpreted as in slice notation. Return -1 on failure.@lib/python2.7H)))tmpfile() -> file object Create a temporary file with no directory entries. )65:WIFEXITED(status) -> bool Return true if the process returning 'status' exited using the exit() system call.float(x) -> floating point number Convert a string or number to a floating point number, if possible.QD) S.partition(sep) -> (head, sep, tail) Search for the separator sep in S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return S and two empty strings.66 66$6*6:6 >6L6$S6search(string[, pos[, endpos]]) --> match object or None. Scan through string looking for a match, and return a corresponding match object instance. Return None if no position in the string matches.Efficient diff parsingsleep(seconds) Delay execution for a given number of seconds. The argument may be a floating point number for subsecond precision.D.__sizeof__() -> size of D in memory, in bytesfcntl(fd, opt, [arg]) Perform the requested operation on file descriptor fd. The operation is defined by op and is operating system dependent. These constants are available from the fcntl module. The argument arg is optional, and defaults to 0; it may be an int or a string. If arg is given as a string, the return value of fcntl is a string of that length, containing the resulting value put in the arg buffer by the operating system. The length of the arg string is not allowed to exceed 1024 bytes. If the arg given is an integer or if none is specified, the result value is an integer corresponding to the return value of the fcntl call in the C code.file(name: str[, mode: str]) -> file IO object Open a file. The mode can be 'r', 'w' or 'a' for reading (default), writing or appending. The file will be created if it doesn't exist when opened for writing or appending; it will be truncated when opened for writing. Add a '+' to the mode to allow simultaneous reading and writing.Can't initialize threads for interpreterPyInterpreterState_Delete: invalid interpPyInterpreterState_Delete: remaining threadsPyThreadState_Clear: warning: thread still has a frame PyThreadState_Delete: NULL tstatePyThreadState_Delete: NULL interpPyThreadState_Delete: invalid tstatePyThreadState_Delete: small circular list(!) and tstate not found.PyThreadState_Delete: circular list(!) and tstate not found.PyThreadState_Delete: tstate is still currentPyThreadState_DeleteCurrent: no current tstatePyThreadState_Get: no current threadCouldn't create autoTLSkey mappingCouldn't create thread-state for new threadauto-releasing thread-state, but no thread-state for this threadThis thread state must be current when releasing <<Return whether object was opened for writing. If False, read() will raise IOError.H)% j0%As<intern(string) -> string ``Intern'' the given string. This enters the string in the (global) table of interned strings whose purpose is to speed up dictionary lookups. Return the string itself or the previously interned string object with the same value.$$$$$$$$$$$$%$-$7$@$H$zipimport provides support for importing Python modules from Zip archives. This module exports three objects: - zipimporter: a class; its constructor takes a path to a Zip archive. - ZipImportError: exception raised by zipimporter objects. It's a subclass of ImportError, so it can be caught as ImportError, too. - _zip_directory_cache: a dict, mapping archive paths to zip directory info dicts, as used in zipimporter._files. It is usually not needed to use the zipimport module explicitly; it is used by the builtin import mechanism for sys.path items that are paths to Zip archives.permutations(iterable[, r]) --> permutations object Return successive r-length permutations of elements in the iterable. permutations(range(3), 2) --> (0,1), (0,2), (1,0), (1,2), (2,0), (2,1)3$|-/  :H)e2n@ #round(number[, ndigits]) -> floating point number Round a number to a given precision in decimal digits (default 0 digits). This always returns a floating point number. Precision may be negative.Private method returning an estimate of len(list(it)).3isenabled() -> status Returns true if automatic garbage collection is enabled. fdopen(fd [, mode='r' [, bufsize]]) -> file_object Return an open file object connected to a file descriptor.O&is#:fcntlfcntl string arg too longO&i|l;fcntl requires a file or file descriptor, an integer and optionally a third integer or a stringO&Iw#|i:ioctlioctl string arg too longO&Is#:ioctlioctl string arg too longO&I|i;ioctl requires a file or file descriptor, an integer and optionally an integer or buffer argumentO&i:flockunrecognized flock argumentO&i|OOi:lockfunrecognized lockf argumentfcntlioctlflocklockfLOCK_SHLOCK_EXLOCK_NBLOCK_UNF_DUPFDF_GETFDF_SETFDF_GETFLF_SETFLF_GETLKF_SETLKF_SETLKWF_RDLCKF_WRLCKF_UNLCKFD_CLOEXECfcntlheappush(heap, item) -> None. Push item onto heap, maintaining the heap invariant.H)%Ag-A buffered interface to random access streams. The constructor creates a reader and writer for a seekable stream, raw, given in the first argument. If the buffer_size is omitted it defaults to DEFAULT_BUFFER_SIZE. max_buffer_size isn't used anymore. __exit__(*excinfo) -> None. Closes the file.6/[66)AA}?8?8?8?86,E6r?9L6,EƠ6r@;L p@e8~<e84!e8V|4t$e8}!.e8t"/Y`/:0CAS.rstrip([chars]) -> string or unicode Return a copy of the string S with trailing whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is unicode, S will be converted to unicode before stripping@getvalue() -> bytes. Retrieve the entire contents of the BytesIO object.?gc: %.100s <%.100s instance at %p> gc: %.100s <%.100s %p> gc couldn't create gc.garbage listtime__del__gc couldn't allocate "__del__"gc: collecting generation %d... gc: objects in each generation: %ld collectableuncollectablegc: donegc: done, %ld unreachable, %ld uncollectable, %.4fs elapsed. garbage collectionunexpected exception during garbage collectiongeneration|iinvalid generationi:set_debugii|ii:set_threshold(iii)(iii)enabledisableisenabledset_debugget_debugget_countset_thresholdget_thresholdcollectget_objectsis_trackedget_referrersget_referentsgcgarbagetimeDEBUG_STATSDEBUG_COLLECTABLEDEBUG_UNCOLLECTABLEDEBUG_INSTANCESDEBUG_OBJECTSDEBUG_SAVEALLDEBUG_LEAKGC object already trackedzip(seq1 [, seq2 [...]]) -> [(seq1[0], seq2[0] ...), (...)] Return a list of tuples, where each tuple contains the i-th element from each of the argument sequences. The returned list is truncated in length to the length of the shortest argument sequence.need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version1.2.3N6(N60123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz!#$%&()*+-;<=>?@^_`{|}~B.isspace() -> bool Return True if all characters in B are whitespace and there is at least one character in B, False otherwise.%d.%d.%d.%d\T9dT9mT9vT9~T9T9T9T9T9T9u-l#u-m,u-On6u-UoThis module provides access to some objects used or maintained by the interpreter and to functions that interact strongly with the interpreter. Dynamic objects: argv -- command line arguments; argv[0] is the script pathname if known path -- module search path; path[0] is the script directory, else '' modules -- dictionary of loaded modules displayhook -- called to show results in an interactive session excepthook -- called to handle any uncaught exception other than SystemExit To customize printing in an interactive session or to install a custom top-level exception handler, assign other functions to replace these. exitfunc -- if sys.exitfunc exists, this routine is called when Python exits Assigning to sys.exitfunc is deprecated; use the atexit module instead. stdin -- standard input file object; used by raw_input() and input() stdout -- standard output file object; used by the print statement stderr -- standard error object; used for error messages By assigning other file objects (or objects that behave like files) to these, it is possible to redirect all of the interpreter's I/O. last_type -- type of last uncaught exception last_value -- value of last uncaught exception last_traceback -- traceback of last uncaught exception These three are only available in an interactive session after a traceback has been printed. exc_type -- type of exception currently being handled exc_value -- value of exception currently being handled exc_traceback -- traceback of exception currently being handled The function exc_info() should be used instead of these three, because it is thread-safe. Static objects: float_info -- a dict with information about the float inplementation. long_info -- a struct sequence with information about the long implementation. maxint -- the largest supported integer (the smallest is -maxint-1) maxsize -- the largest supported length of containers. maxunicode -- the largest supported character builtin_module_names -- tuple of module names built into this interpreter version -- the version of this interpreter as a string version_info -- version information as a named tuple hexversion -- version information encoded as a single integer copyright -- copyright notice pertaining to this interpreter platform -- platform identifier executable -- absolute path of the executable binary of the Python interpreter prefix -- prefix used to find the Python library exec_prefix -- prefix used to find the machine-specific Python library float_repr_style -- string indicating the style of repr() output for floats __stdin__ -- the original stdin; don't touch! __stdout__ -- the original stdout; don't touch! __stderr__ -- the original stderr; don't touch! __displayhook__ -- the original displayhook; don't touch! __excepthook__ -- the original excepthook; don't touch! Functions: displayhook() -- print an object to the screen, and save it in __builtin__._ excepthook() -- print an exception and its traceback to sys.stderr exc_info() -- return thread-safe information about the current exception exc_clear() -- clear the exception state for the current thread exit() -- exit the interpreter by raising SystemExit getdlopenflags() -- returns flags to be used for dlopen() calls getprofile() -- get the global profiling function getrefcount() -- return the reference count for an object (plus one :-) getrecursionlimit() -- return the max recursion depth for the interpreter getsizeof() -- return the size of an object in bytes gettrace() -- get the global debug tracing function setcheckinterval() -- control how often the interpreter checks for events setdlopenflags() -- set the flags to be used for dlopen() calls setprofile() -- set the global profiling function setrecursionlimit() -- set the max recursion depth for the interpreter settrace() -- set the global debug tracing function *%; 4t"*%+ ,A+d8The functions in this module allow compression and decompression using the zlib library, which is based on GNU zip. adler32(string[, start]) -- Compute an Adler-32 checksum. compress(string[, level]) -- Compress string, with compression level in 0-9. compressobj([level]) -- Return a compressor object. crc32(string[, start]) -- Compute a CRC-32 checksum. decompress(string,[wbits],[bufsize]) -- Decompresses a compressed string. decompressobj([wbits]) -- Return a decompressor object. 'wbits' is window buffer size. Compressor objects support compress() and flush() methods; decompressor objects support decompress() and flush().!~E;3l511~C.TZ"M.lA-[.)9l.CQBWLup#B2 B&"B补A?tA*_{ A]v}ALPEA뇇BAX@R;{`Zj@' @Return a list of lines from the stream. hint can be specified to control the number of lines read: no more lines will be read if the total size (in bytes/characters) of all lines so far exceeds hint.combinations_with_replacement(iterable, r) --> combinations_with_replacement object Return successive r-length combinations of elements in the iterable allowing individual elements to have successive repeats. combinations_with_replacement('ABC', 2) --> AA AB AC BB BC CCsetdefaultencoding(encoding) Set the current default string encoding used by the Unicode implementation.!:V1Read at most n characters from stream. Read from underlying buffer until we have n characters or we hit EOF. If n is negative or omitted, read until EOF. Up1p1 q1 q1 q1 q1 q1 'q1.q1 6q1 >q1$Gq1 ,Xq14cq1<0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ_abcdefghijklmnopqrstuvwxyznon-string found in code slot../Objects/codeobject.cco_argcountco_nlocalsco_stacksizeco_flagsco_codeco_constsco_namesco_varnamesco_freevarsco_cellvarsco_filenameco_nameco_firstlinenoco_lnotabname tuples must contain only strings, not '%.500s'iiiiSO!O!O!SSiS|O!O!:codecode: argcount must not be negativecode: nlocals must not be negative??????code inequality comparisons not supported in 3.xcodegetsockname() -> address info Return the address of the local endpoint. For IP sockets, the address info is a pair (hostaddr, port).))A<Ds$A<b#A<]2A<l)A<%#A<h3A<d3A<p;A<#p"A<Ā;A<<A<R8A<:#A<Ӥd/A<0A<Lv4B<٘v/ B<1f"B<]Z.B<9"B</*B<;2B< /.7B<C>6=B<p;CB<$Y#JB<bs;TB<\3XB<l8_B<4(z-gB<D'oB<,!uB<c;|B<,7<B<<*1B<\3B<,$B<I|58B<P6B<T$B<<+B<m2B<!B<N@8B<Mt<-B<7c"methodcaller(name, ...) --> methodcaller object Return a callable object that calls the given method on its operand. After f = methodcaller('name'), the call f(r) returns r.name(). After g = methodcaller('name', 'date', foo=1), the call g(r) returns r.name('date', foo=1)._v-0w6,E6r?9LI#function(code, globals[, name[, argdefs[, closure]]]) Create a function object from a code object and a dictionary. The optional name string overrides the name from the code object. The optional argdefs tuple specifies the default argument values. The optional closure tuple supplies the bindings for free variables.Write the given buffer to the IO stream. Returns the number of bytes written, which is never less than len(b). Raises BlockingIOError if the buffer is full and the underlying raw stream cannot accept more data at the moment. E . A 3 $]+4h+!i+ k+bm+ Ho+ q+Gjr+v6s+yt+,bu+w+x+ fz+ P|+}++J++/f+<+++w+ + ƍ+ |+^+-c̑+Dʒ+*Г+F8++`+EЙ+*+|+!+e+ +ġ+<+&+&+f++&ҩ++ h+tH+3++,+*++++4+::6+8++Zb+c+@++5t+,+++ +\++^+++++n+ ++;+ +,++~+ +++1`+D++W++T+t++ C++(+)"++X+5T++++"+z+T,-R,,!,",6,&, , , ,R,",t,,v,XX,$ , ,,(,/,MO,.", ,.&!,",#,$,&,(,(,+(,3n*,J,, 2.,/,40,2,2,y|3, :5,6,~7, 8,:,L<,(M<,:>,s>,>"@,B,#C,VE,4G, H,QI,4[I,J,TK,%L,start([group=0]) -> int. Return index of the start of the substring matched by group.sߓ$m/$v;zi(zlOO)Nonecannot assign to None__debug__cannot assign to __debug__TrueFalseassignment to True or False is forbidden in 3.xnonlocalnonlocal is a keyword in 3.xNon-statement found: %d %dutf-8encoding declaration in Unicode stringinvalid node %d for PyAST_FromNode()lambdafunction calloperatorgenerator expressionyield expressionlist comprehensionset comprehensiondict comprehensionliteralcomparisonreprconditional expressionunexpected expression in assignment %d (line %d)can't %s %sassign todeleteinvalid augassign: %sinisinvalid comp_op: %sinisinvalid comp_op: %s %sinvalid comp_op: has %d childrenparenthesized arg with defaultnon-default argument follows default argumenttuple parameter unpacking has been removed in 3.xparenthesized argument names are invalid in 3.xunexpected node in varargslist: %d @ %dlogic error in count_list_forslogic error in count_comp_fors(unicode error) %s(unicode error) unknown errorbackquote not supported in 3.x; use repr()unhandled atom %dNoneunhandled factor: %dandunhandled expr: %dGenerator expression must be parenthesized if not sole argumentmore than 255 argumentsnon-keyword arg after keyword argonly named arguments may follow *expressionlambda cannot contain assignmentkeyword can't be an expressionkeyword argument repeatedillegal expression for augmented assignmentassignment to yield expression not possibleunexpected flow_stmt: %dunhandled flow statement*unexpected import name: %dunhandled import name conditiontrailing comma not allowed without surrounding parenthesesUnexpected node-type in from-importunknown import statement: starts with command '%s'poorly formed 'exec' statement: %d parts to statementimproper number of parts to 'assert' statement: %dunexpected token in 'if' statement: %swrong number of tokens for 'while' statement: %dwrong number of children for 'except' clause: %dfinallymalformed 'try' statementunhandled small_stmt: TYPE=%d NCH=%d unhandled small_stmt: TYPE=%d NCH=%d iso-8859-1u005cutf-32-be\U%02x%02x%02x%02x../Python/ast.cstring to parse is too long../Python/ast.c../Python/ast.cutf-8iso-8859-1insort(a, x[, lo[, hi]]) insort_right(a, x[, lo[, hi]]) Insert item x in list a, and keep it sorted assuming a is sorted. If x is already in a, insert it to the right of the rightmost x. Optional args lo (default 0) and hi (default len(a)) bound the slice of a to be searched. popen(command [, mode='r' [, bufsize]]) -> pipe Open a pipe to/from a command returning a file object.-+ 0123456789ABCDEF0X01234567890123456700123456789ABCDEF0x01234567890123456789abcdef0x0H)c32a2 5.4.@a- :SunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilMayJuneJulyAugustSeptemberOctoberNovemberDecemberAMPMESTEDT%a %b %d %H:%M:%S %Y%a %b %d, %Y%H:%M:%S41uRD.__reversed__() -- return a reverse iterator over the deque\6,Eo6re"Lreadlines([size]) -> list of strings, each a line from the file. Call readline() repeatedly and return a list of the lines so read. The optional size argument, if given, is an approximate bound on the total number of bytes in the lines returned. h!jl&0x!!!!!!!!!!!!Ţ!ˢ!Т!բ!ۢ!!!!!!!!!!!!!(!0!9!C!P!V!a!k!v!!!!!!!!ˣ!ۣ!!! !!'!*!-!:!single_input(0TL !$ file_input(0TL !$ eval_input !$ decoratordecoratorsdecoratedfuncdefparameters varargslist fpdef fplist stmt(0TL !$ simple_stmt TL !$ small_stmt TL !$ expr_stmt !$ augassignprint_stmtdel_stmtpass_stmt@flow_stmtbreak_stmtcontinue_stmt return_stmt@yield_stmtraise_stmtimport_stmtimport_nameimport_fromimport_as_name dotted_as_name import_as_names dotted_as_names dotted_name global_stmtexec_stmtassert_stmt@compound_stmtif_stmtwhile_stmtfor_stmttry_stmtwith_stmtwith_item !$ except_clause@suite TL !$ testlist_safe !$ old_test !$ old_lambdef test !$ or_test !$ and_test !$ not_test !$ comparison !$ comp_op ?expr !$ xor_expr !$ and_expr !$ shift_expr !$ arith_expr !$ term !$ factor !$ power $ atom $ listmaker !$ testlist_comp !$ lambdef trailer subscriptlist !$ subscript !$ sliceopexprlist !$ testlist !$ dictorsetmaker !$ classdefarglist !$ argument !$ list_iterlist_forlist_ifcomp_itercomp_forcomp_iftestlist1 !$ encoding_decl yield_exprEMPTYdefprintdelpassbreakcontinuereturnraiseimportfromasglobalexecinassertifelifelsewhilefortryfinallywithexceptlambdaorandnotisclassyieldT.count(value) -> integer -- return number of occurrences of valuereduce(function, sequence[, initial]) -> value Apply a function of two arguments cumulatively to the items of a sequence, from left to right, so as to reduce the sequence to a single value. For example, reduce(lambda x, y: x+y, [1, 2, 3, 4, 5]) calculates ((((1+2)+3)+4)+5). If initial is present, it is placed before the items of the sequence in the calculation, and serves as a default when the sequence is empty.Uk@# `-$}-@'%'%'%'%'%'%'%'%'%fO"z\ "{Qgy`qz=km    !"# $F <$"O <H/integer argument expected, got floatuser id is less than minimumuser id is greater than maximuminteger argument expected, got floatgroup id is less than minimumgroup id is greater than maximumst_modeprotection bitsst_inoinodest_devdevicest_nlinknumber of hard linksst_uiduser ID of ownerst_gidgroup ID of ownerst_sizetotal size, in bytesinteger time of last accessinteger time of last modificationinteger time of last changest_atimetime of last accessst_mtimetime of last modificationst_ctimetime of last changestat_resultf_bsizef_frsizef_blocksf_bfreef_bavailf_filesf_ffreef_favailf_flagf_namemaxstatvfs_result|i:stat_float_timeseti:accessi:ttynameet:chdireti:chmodetO&O&:chownstrictetet:linkU:listdiret:listdirstrictet|i:mkdiretet:renameet:rmdiret:stats:systemi:umasket:remove(sssss)etO:utimeutime() arg 2 must be a tuple (atime, mtime)i:_exitetO:execvexecv() arg 2 must be a tuple or listexecv() arg 2 must not be emptyetexecv() arg 2 must contain only stringsetOO:execveexecve() arg 2 must be a tuple or listexecve() arg 3 must be a mapping objectet;execve() arg 2 must contain only stringskeysvaluesexecve(): env.keys() or env.values() is not a lists;execve() arg 3 contains a non-string keys;execve() arg 3 contains a non-string value%s=%snot holding the import lock(ii)unable to determine login nameii:killrs|si:popenrbrtrwbwtwO&:setuidO&:setgidresourcestruct_rusageNiNi:wait3ii:wait4ii:waitpidNiNiet:lstatet:readlinkstrictetet:symlinkdddddii:setpgidi:tcgetpgrpii:tcsetpgrpeti|ii:closeii:closerangei:dupii:dup2iOi:lseekii:readis*:writei:fstatri|sii:isatty(ii)s|i:mkfifoiO:ftruncatess:putenv%s=%si:strerrorstrerror() argument out of rangei:WIFSTOPPEDi:WIFSIGNALEDi:WIFEXITEDi:WEXITSTATUSii:WTERMSIGii:WSTOPSIGitmpfile has been removed in 3.x; use the tempfile modulew+btmpnam is a potential security risk to your programtmpnam has been removed in 3.x; use the tempfile moduleisunexpected NULL from tmpnamunrecognized configuration nameconfiguration names must be strings or integersPC_CHOWN_RESTRICTEDPC_LINK_MAXPC_MAX_CANONPC_MAX_INPUTPC_NAME_MAXPC_NO_TRUNCPC_PATH_MAXPC_PIPE_BUFPC_VDISABLEiO&:fpathconfsO&:pathconfSC_ARG_MAXSC_CHILD_MAXSC_CLK_TCKSC_JOB_CONTROLSC_LOGIN_NAME_MAXSC_NGROUPS_MAXSC_OPEN_MAXSC_SAVED_IDSSC_STREAM_MAXSC_TZNAME_MAXSC_VERSIONO&:sysconfpathconf_namessysconf_namesabort() called from Python code didn't abort!n:urandomnegative argument not allowedaccessttynamechdirchmodchownctermidgetcwdgetcwdulinklistdirlstatmkdirreadlinkrenamermdirstatstat_float_timessymlinksystemumaskunameunlinkremoveutimetimes_exitexecvexecveforkopenptygetegidgeteuidgetgidgetgroupsgetpidgetpgrpgetppidgetuidgetloginkillpopensetuidsetgidwaitwait3wait4waitpidsetsidsetpgidtcgetpgrptcsetpgrpopenclosecloserangedupdup2lseekreadwritefstatfdopenisattypipemkfifoftruncateputenvstrerrorWIFSTOPPEDWIFSIGNALEDWIFEXITEDWEXITSTATUSWTERMSIGWSTOPSIGtmpfiletmpnamsysconffpathconfpathconfaborturandomF_OKR_OKW_OKX_OKNGROUPS_MAXTMP_MAXWNOHANGWUNTRACEDO_RDONLYO_WRONLYO_RDWRO_NONBLOCKO_APPENDO_DSYNCO_RSYNCO_SYNCO_NOCTTYO_CREATO_EXCLO_TRUNCposixenvironerrorposix.stat_resultposix.statvfs_resultstat_resultstatvfs_resultL.remove(value) -- remove first occurrence of value. Raises ValueError if the value is not present.E"J"Q"X"d"?L.sort(cmp=None, key=None, reverse=False) -- stable sort *IN PLACE*; cmp(x, y) -> -1, 0, 1t# ###+J#JJL# #((#OO#R#|###Eت#d<#__>#8##mn##Gn#B###VV#-V#34Z##{{##8#:#[ܴ#޴##F#$##4#r#JP#Z&#8GF# .#$=b#d#d#Z#~~\#^#V#X#)R#T#V#MMX#Vo####JU#",#L#.##q####Kd##.##># #p0#LL2#4#~###Q##)#@eL### 9r##I0#0#R########T#wN#P# U#k##F#d###4#2#####P>#@#rrB#D######77##B.B.S.isspace() -> bool Return True if all characters in S are whitespace and there is at least one character in S, False otherwise.?8Tz3\8staticmethod(function) -> method Convert a function to be a static method. A static method does not receive an implicit first argument. To declare a static method, use this idiom: class C: def f(arg1, arg2, ...): ... f = staticmethod(f) It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. Static methods in Python are similar to those found in Java or C++. For a more advanced concept, see the classmethod builtin.issubclass(C, B) -> bool Return whether class C is a subclass (i.e., a derived class) of class B. When using a tuple as the second argument issubclass(X, (A, B, ...)), is a shortcut for issubclass(X, A) or issubclass(X, B) or ... (etc.).!L12z2Q!# /T3!2a]*L"P1""D8&#* .L t Ctj& |&,["@ >Dq> "F2H 5$r!"!,.s*n3& '$Q@" J-Ы3):n")j) o-t3Ke*I0"."AZml"3K1 ,/v 1E'(U+R}|{_L#z"1utr xwͫA"0jJfc(h="a`c%,q `#, DBAHG?Az@H,&p "Xg"X%ML$#w~ONg+/6E3 1 $E \)*d!;3[j$_^\YX7,SRA,9WVUT&wv.* + ,,QwM_"<H1U`!%7$Y'9 \JJ'U"$&"_$a,{,2VWl{,y"& ޢ(jSQ" 2'*#3 >Q/w )@' &$}$,K =, WA l! `? G |224,:217`"no-0t \2#"6^-A_Fk&Xis Hh"2::'3":393) .#9> ;< 4:E=6%8BE@$M]1/1"\'%=p*Z# 34t1]l%-8Vi!.p #N"01!A#J1&330z&l3s3P')(0@ )" " 2h 'ͥP"/%0)w2*zju/H!o012+vyx-r./!"mBqmYD.p". d$* XOD 4/W/P["r 1 .L1- !T2R235"$P2  ]9U - Z-h, s" {T0S0 Y0!v"Y/?  9Q _\2  "s*.^1b## !s2o2 e27$/#S  6' &*@!@"#|2.#H3T!!%501 638{"#)h6M*!yf U)wyW2"'%$1!u,F+h/s.M A ֤[!q 9r)uJ Z#F ? s .)1231220]#2#33!U1,3#121mT &kz2%]"*%BE#AA#  F* I 2j0*13g#q2" 1( 10"x2d38t+" Wu,-+8 Rd G,M2-"e/Y +#'2F#? "K1$(80G(!1 E!,h2x1 1 13 #  p ^o{:)Q ;Gx&(8CD(2=/2'%2g fG#v#a!4##t FT .!+*&f&a/!!:*S"&$E1C$V3 "\ƫ',O + 8!L0h ##M{T8VG&)m!31c"5j*$41 1 &%H «/W,(4,23$ n ( ! gR*+_e8-/Jt 0) @\$746 B"3+Z#4#8Qt` cf. #?%'l, ~C#@ 'or%$#}]@^:*M1,:3D/"-)/ )30111 *01^!Y3 N*+( 1 &{s e $11 G& =^@300~)C34 `D3\ \!2D 1~2h6)^n251 ;Y $ &._k^en 2p3 /u2 0,%e(4%B},A3 ?<:a8765e310 .,'w)'A'$4 3%) M {"-2r; q$ ->s -r*^9 D Tl'*2`/8 )0/1p}uv$N'0=%) 7- T'O23 Z0 V0 .X0\0=) !0% B20! 0.* !![5%4L2=(]((? *2 .S 5C56#"90\)#*' I42 m((G q"| 0? sg0kQ#Q+MS&N3 ,(6 #FT"tO ! Х;:+! 8M :3 ) &>U msP kMؤF$L!a0jD,h0 E/ 0-ki_0lB /pe" Y0a % K: 1)<[0=c$J`22H2U02G!y1102Ip0 0C0G2h& &l'e^'0hEߤ5#. f't %$ )(00'U ! us#|{%k,@#)220%/1/2/W ")2 ߥl  Z% NfGR#|0,0!0o 0 k"0%/nwu1T,0M/%k\X *H" t I,j 08@* 0!*T! %'#0?~0_ {  w0 d=#-[*#1,!#~#)V/+    1I!3xG! =w1"l2yS0 5*F!*|O0u/~"c!EM0Q0)*3*c|j Zp)j%q+g&nK& 9l/"o""m'#`nqI$+12h2!kg%$$n G-!4~ -%-,.090)*w0.4#q0gݫt0Lz0 w])j.%2W#1B 1h!1UŦS%1$&g )1E)/0$N2#$ #3i%3+$2?*!im002j02l*  )22ccQ$i 10eb`aS -1Kl& Gg I1: L,ϥCb0@e0 -{h-g0K`0֢1i17 [{4'tj0'20' q%Ѣ1n/(:(os0 #!' M!083;2TA.p0e18,: \2E#Agu p1 ,0n'" &0,A#0cQ'u0V3% 2&r0x0{02P!' {###%50 ^z%FR0-7_)L0T0BN0*1 $3*$z U$w:!"sdL.ަT"MSF"n&lZ\%  1  1/ h m#k5v2!a,_/H7D&Mv0M1YM1']&ڤ1 2 ^U)2!Z/F&1%Zl 2 Z7m|4!N P-\+.3a%)# ,p3H',Peդ|~%`}!&_$)!&.2.۪1?!$7C-0c03q!V--]& (+m L[FCG *< Z!lJ&edl/d%[C^.!& *=qP&8.1%u%(5- p)-) s" #*٤0<<  "'62b" #s 9#H032-M-]P_mZV ,p)O/9- )8-$=%# oC&p/,/ *&>F Lg פ"~)s**!\ - *ZB#$"3S!0$0F %0h20#Ta#-0!0q,}-j12eB*k1t#/d!NF<8<pc%o 3/¤KMj x# q J+C%Hs, 0%Q*e&l"R0*O*j^"0!l'R + ,.3SH1"Mj /.p>3n$b <$"E[x!X e-077#-"( J-(qL ;>#^0%2(G/!&A+.i]]JX2TW3*Y+G- / '1Ho )ew{P*0! Q,y0'0!00{ " _:/= V'c)% $0)\6!wl{%\B$> t$fE $  ) Rl]  -'%.0 ^/8$"! 0.UX Q&  +k#Y 2"4?7'O#3>h0B *0*6?($!_( 0;?0Y0@0`[-Ax3;!0"U-!7;-b20! 0}1!h2!E!2} P5v| "N000000"0S#GY!0_-/K[w 0K2`0'0+"  ]00\0 ? 02Oq)$-$$$$$$$A$$D$$$THHK $J)ѩ(.2/*K l0 *.$$$$$$$$$$02 -G++00(";.0PW&-0.L%Q10+)p0/003= ])W;2:2U!072Y St#"\3Ѩ{3!$b!!-y3S#0j( 0_n 0 E2աr123١o  ԡG211C',1&/C0C%%Rge %%+ 3 & 30"ע& HJv!;X&022 RB1 n22T2Q00. 212.0?&T0O1?  ''!00T2 & &).22222P&2*2/!220 2}@,2j222"1&O?m$--$G ,2@ 2L8#',,2d"] 0&_ `Q 222<2K22"22 7 - Rv> .2")3<X 22c0  2&k "S_2rG 2@"20^6&a#$.:* 3"%2x)6^ }+ &9, ."̩V &2a3G r-Wh2x!qp"!:&0~ ai&3|jL-{Z~'(, ) .o0.$+ 2 2*d1/ 6&`c?3E3dF31[)0,(3P2QSH XWY!k L W0\E<) d0#  & JKM,E =0000'o, 00C0/00"> =Eh$z"BK03$.I0>  0y N2M2!tg)&|1;*jK,2g,05#!0Xm9 #000M"3  *q 13&11ƥ1*=!1V 1/1,1u" 3 .t([!a1P[2222}2t"l 240d!V}u'!7ͣB!/ 1c2 u  U/c&   , #22 22L&)2x 2A12*j/'x B|]z \Wߪ"C1"{"11 :0}PSBe"13$% $C6A*"F'a~!4#M"A3M]3_14 C^1)-(PK0z,FB Vz!}0 Y*F(c*B# )*!2!.>,7156#$?Z &#+,e{'v%M'/s!! /M 0A2}g) $%,(0-$/0,n!0O/W05 t (l ֫uO"K.R%(3{(22,/822)" u N>22 <2Q ! ]/1!/-/y'"7&}:[|$5("4 ""h#1T$#11K 36,ID2ס"]!j?2sA1kš :$ѡ5L2"&![#!z/@1H/v0L,#}0' Hz0&22u2 .t%81"E!G',cc r3] n#02j G_29 XX32e5+2|#{/~,R#(0^* %/$ ,C2/ۣ#ݣ5N 48(1" M%*A3an*ȡs"Mr -Y!n%#1, M("c!P3&"a% 3 $xS&' tQ%+'8'/%4s/M!,"F,+z /A%yS/- 1u-0z w ]!1# W%ԣk ٣գ p! *2 (*2$ $RVWX[w CDJ- 2M*k(H U"-0-b)1%3! T" L)!DGI/2!" ߦ!0\/ 0190$./`#"#"$y))1_ 1d2*11X11~(0^1 2#3,]'m=#Zr!? 1\!0 u)<'3 K(,69(w sdheV[1D 'X1-$d{#@1W%V!m/g %dc   /;ըY$, 2 - ( ) * + ' n/ %20P0)% " & o",1 *P 3*K1R1! a1ۦD!/ܦOj`(x ͦU13+c/%6."ĩ)Ph""$Y &#.1.Z?"1C02K"y"= q"p+& $5 1ML I>0JED1wAZ)U10(3+'*(A/J1"/*T !M 9D#y47U3^1a" G`̦T3] R3ǥ~WxB((" (( c3^&/al1 !1('NT(/}$ b*  "&ڦ&   \[ &| 97'6s~ >8 Br k H,O$(D((%,= ((I/ 00[A0(P(W_v1r'!(((#(es&J4i#2!V,RUPM. & bcAa٨W1h'\ʫ#") &^Q""3Q' $ɣrƣX{)}.4>3K?/'e!>-/3,-(1 (+& %!N{1N#2((Z5% !A .o O3=* 6"w2 " v1 ")z2O!( f/g B oثXo 0" ! L$;%c39! /m#pq %s&!P1bz$ "a.\&/`,)J$ Dm#^ZN D"%?%b.M"R2 WQ ,#0%%l3R k/  ".  {(A" #  0#"_%Z;Yo#Fm% ![*2)h! G*_:" ) #* ) I!:,90KOMcd.#FGM !I!%," ,* N-- -!  ~,0D -/ ` ("Vd3P*)?,#3 3ئp/h&.# ")r#"J"g%j2w,",@v3(S( %֦/Q!)04 v($ 3{1"$'2300 |(,ˢ f51$}"0(Ho320c -()$P#J'R!xBe 0+4m3>*!40 0+14 8%!D/Atg 5(@)\#Ca  %¨: %2F T h31E?ש%`Ρ]t O *7h_6&$W#;89H%B -D$%*"i\.>n m-j .L &53$"2'~#6H 21 3e"0Mxͩ'CI>"] 3#%w\&"(*"2>|"}"h7p'&U!mT!&,l*2+".h.-X/ԩ+;$C) --X#% ,!g )# _&HB" 8P!)%!!+*/M z'{C%"!v2,9 -Ģe!m* Y#xK$w"2K1'"*,.0003{TK3Z">z/=|r"M[A*ڡM=r&@y'EX#%MM&fx  %F"%M!,3M W*#"!!"!~F%$O((T  -nߠk2(/(& ".d)4&kW !U'|37(W((c"!t!*a"?#-&3,ݪ|Y#--/ g((o,/i , (o(!/x"k/2m +372D.1*(_) L32 v#&"$- 4i40#_d0Z!G,EmPv M" ¦&H$M'k/ ޫ`,_0/*Fa0!z}%s'im c#ܣ֣X a'3&Z4 * %Vik #f"o'"$;3b\ )32\b 33 3*S@k+x" [.^$#=$?2~Y) f%j ?F3)F"V .5$!#'PhO#0 ";"Ө/  h!q~WBL/.-.70fT#n-22/3'1 N2>!(0@'(18)V£! .{m+6!y((&)n3o3b32b"v3jr3u3q3|3w3k"(.33333%3' 3&X 6X2*]62sS1%{*eM`2("CN!X!33"3G3[ O3^ I#333$*3311AY 53"5 !|2_1U$$,  3&6*-pCk1Q ~,"`!.V #@!1$"01l C"TmRS=* 52_!0GD't%<?  u))2ȣC2I2H&y";#A2.O"(2h",(("O$ wOK-ϣ#*30k%ңF$b)!)e"u$ ˩,0".$F#<$]$>6  5f 4> *1 $ ("Sd0cba!Y*'g# "41#Jlt'Vwvut2zyxonmlsrqpgfedkjih$ k0] j011J3 )a J"m/3| /Z;&M&&&ZdK*, Ѡ"Ҡi,M}/Ԡ(p0H B1 i 1^0)1 i? V! vp2P%2M S2*!)0)h*%| !P' z!b'7-2/ R#- $x-n!C& Ck -1!!ED,d0,i !}#Po$!W|2yQ#'AJ* ,!i%g 0,0 *00( C 0b  (e3#ܠ'^-Bx!P.b}7R)003-#.0#!tzy3;!0)-2()w'N13M [ ׫Y&%j "E gr ]- QĠū*--o3%'(kʡzA(%*Ơ "ä+-p$zU!V{0-PI%K B#(8/=5 ].;m3!4v("(_5O;H(!n (,H*%&"(;( r$6+(K((3g'2 2;2&h0 i0Ϋ0"n'!uBT/''/%|/B+((6'(b(d1q0wO,٠  "۠1ؠ! !% "ww0Z>6i# !#&=~ $  1!u -'M *1z -d \Lu o R]$)un=f1 e l& 0R! E*2%  , 1h116"H21$/1'Q"|1o1"1111)hde[!.Ϡ*3s)%2ac ! e ? 1s!zE 0z%1 34|,b+1R+)41&0121.1/1,1-1N#-%3J2-F-@!!)331]0 -1' " 0q*$| exh ;1#,4#>181( 'mon6!:1ZA0b$" -o'-0B3!#3'45\3&ia211%11Q3R3{ $}@3('%g (t). '):    S1M3N33K3%I34*&r#*X3p&kV30I(@(^3*\3"[3)!0"/8 6 !*e3 U#"C+! !fi3h%;33R'3P_3M?f0b 0+u͠@,0Π0j50(0038!&0>/Y2X2 Y)J! ]2\2 !E2?$)>$44 2  446n17k4 y":"-*2.4003I0,3 q1.ie,v0 3Q!yCBA \) V2`" $Y!Z"Xm1V~SRQ.;,M.KIHGEMp00.[]4|*0-&o3v2 }1) 0-#"T ^#7 # "i (,!j<""^VLy` - ''_3&a.<&3W+Q -{    MB%, +v'o)n&%^!E O\!4/",\19T1>%*{,4:3= 38T*Ks!%q/',&W"m2 0,( "!%+,o-i#X![$'U a3$' `$*,+,t!$ۡ ikjml. !!v2"  i?)$O -!<4(3 U((` *2zF*a^,/@9+ > k$ M(7 il3!"j.Q L603,z!`%gr#$z#7#0(M  4(38 K=1ݤ34 %P h0>"0W)(m l  kX+9)~#!U BADCFEHGJILKNMPORQTSVUXWZY6u(l!%T%Y,%i1&4!!&#"4 W M+"TH<J,$%0+%S .o()&_\#D 0*0i0# *N)&p9  ''D&ҩ)#$4=4 4T$ H*-4 %!]*.g oo d /D# A+<4 [ xRal0<|0M3\ %Šphy0! &" [!a3"9 U* u _%.% AD[xsp;N(1J&%1(7N (&((~0_{2J(*((I V *) { fB,%)(OS,GV, $a#:1 &12( R(L9FH'MK(k):c']O2q#Y.)M$b%5% zxܪw3fd" Taqt v '8w:D%f-F0X#/O!eJ00H0] D0!,6B0 6 !|-G$ϡ)Z֡[ Z(+3#b,f̡)M1#%ӡ5С^ɡF/n2 Y*!f)m h k#MM-6s"w1!S$F##-I ('M'3D!Z3V_ ڠ37I1֠,f 0%WUܡHS?E,/A!Mh 613#'.)&3&6 78,!3#m.G0-,s-R"/"# "{ f s(~  r1F )3 ;-3/T[*"-J .)S7sT o-*,n,2rK$t2$$¢&7 G̢Ƣ -&#,7  !$,M3pfK%v%NdN% 1*/5 ".j!a#691[*p 7"! !1s1{0*.R #=#IgCDy#A:"=?!.iA<"LX$ "%ީh"  l : ,u3" }D{I/2 x"3* ,tE ШZ3J< pc*#$.83.6373435333 !<#<3=3"Y^2"7#I#1@# ! 9 h91(C":DS}2 z*EIK+DC%}3!!!2u*©, Q.[,BHzM|4(!" L 3%-<GB!j"-;u>1-.2<&(E.&b1"7^)K$U'f/Qr^7e1/3  ! !:'0% !$!! !y/1$3 M"^2-"J, N#?'3 3צ~ @&w3_#337'Uw+"+"l((3"V371j"# ) "/'^oka 0 X"YV2@%<('(!&1{  )*1,@2"1% g!&!  e11w!1~t!1pC'q &.c (>."r P1#fo1'1q}b$(I' M x(Z3$! n'!C*&(0"{y&wuw'I2 7/5?"b+# '"2$'$?9#111>p'&z 13 { A-&/5-M)1"$"KE S*(~3)Dg# bA@%u&E%y _ ܤ{!3/&)()3,O2 +i1# 3^' HC!k &q'~4[2tZ2'Mz ':P)D!Mr ' 5D3.X'Ǧ /&X"$/m#^ 13J2( 3)"as3<T.ҥCe 0, -!6Ȧ "ȩy2 2 !#a|1$m"lC:!Qb/aTwϩ**q!3 ,44I.'Z%j $k |rXf*'V@!\*0&. [ ,tZvquB2!!/# t *#qx /`$)OB/##N3cSP   Z!( z ;+%#")O3!" @[/1*f$U3P  ۫ NMt0d2c2͢$*#:ءN L+ *C"U<-Y/"Z$u/ 3''W/ 20_m"5# Y " "*,Hh j\,3M 112G'0%0'2*M #|.!r/  b- (@((R((f  'Z"Z%f["#.*'4,$"&,. #M1 F$ 3%1S 18 1)M1x1tw(%1+#\t/1-&`y teJ2Hnר- 1!m 1;.R yY11 11 1b1- n-/ C ".x3 * ! rb%~(#I""#*߫ 1'10`l O&"J3R.'2-'-%W!#" /)x,/ *} < ":+'10 D3V  "1jk10yU--1eq T2M*)Px+>q1V335! R֥ M, Y%-1N&a ^4)I9] #\13r,!h 5 ,+} C s )#* !Z)&*W*yzLp,")Pn q#L+z 1<, z6."-)L)]w@.dG0/ v /'&% ! .uoY1 @u22<:-!3&5'9)Z!3Z 2e/&5+ D d-+-\`1$10"011M;7"100"} p'K-}*vH3 3  #S BrYn '$F)'< 1H#11[p2 !#_r)X3y0*3a [3n33+23o/ 2L22p) e2.%(7,IZw 363  160u /[B&VW/3 J$33$3 03333R 3n0& %222'1(2,,"*Y #2B Lh#'f!qw2o /*1%2./ *.02 M u !M!240?3$&  a!# p#3(7 A*C  ,d-|)/ z @l  %#I2Y '38#y  3+*,04?W&Mk!ܥԦ,yll`kjf 2^ihgn [bR)R39'QT>/%'3(N!*"#'E3try3v! ql!5K -OXR!9$E+mM} W )" z{Cy @%v=&/8"]/;u[Z1/^]Y8MLKJkW#N)0 " DCBAGFE=O e0H{E&"2 En0N&Щm0 O,& PG$ q3))@Qd<=U;'sDik!. Zh"A[s'"0 +%s0t04 r0g"'>#u02,!}f00.`|\1!32>& 2k"l ̫mɦe#)p f92 -< (3r =h3'|20' d"/f.4 t 2>G)uJ3% 0!-) *1/ {Aڢ0k\*KokS"2i4!*9p Y1F228.6 "G2>)&3` )gg0\-Vl"-!j1 +9S1&2N O/C.B~/%"'Q?2ҨE0*"% ! 93,32!E`)/d, $32Rg lR$=9*G3K23O)?P): 2qL:To\!(I 3 a"7!7Ao Z ). ' pgF2,P+h~p"@L%">"06@aO3Sw*Nk-*$Q_!/Wcn 'i!H2p ^2!2y2u A!M@-=MN7LJIW"'*é#MLr3ImB' DJ's$^f ,RWVY SRUTm)c3` #3H*a3i3333dYQ%6! z3&%$#/32Z,+,V33362Wyb*/.y,)'13)}z 23@%]!K" / <E :|.% ʣ=<p9z6t1.:'/3Ҥ(0(̣,02ۤ4*#"/= 0:%/O3!1#&"-+ĨJ ]Bg-!3%Y3, 3/ C b 0x*127+$ Q Su )'f ?& sq!!%r-t3* " [<3" VK# .l3 z1w33^l)*, l @^#3'"B1='R231+35F1g,/3 -(\!` q805(&2t '$.Fd4"="-Tf]D2O v3 3+= gHr9Ӡu3:2(d(83!'&;0033]-K=2._!RH0C043(`331=t@1!&B3*(FG=!e y v2u. ( 33m Q 3G3333 z rCTU~3%0Pv%)t!^ `#-3" 31!"3 S&6G#**ΥˠP$Y3/-)N/$2332 ?. %"cJ&I!L*A0I0-ţ),ã1(0ĥ!" (L(j!! 2(3VM#'O9%aD22%sCq MB 4( -  \(/5H)5 7 *Jp2&(e I-D%+ &R''G2)~!!:+$"Y+"*`n' -i*C]5 9X'(C-, p1-d t" ,'~3)$3-,1fH32-"(nn"$$2f"!] 3(IZ~$3'/"#/4`9 - &=y!19/1+&3v }*'G*"* ?A$"v "H'33?P0Q0J#[':b(?.8As-2<&08$P>P!8"  cW9"2t*\"E1  H!Z3nB +2 Y|Q]{(&V/vw $ u "I)#"o&[2<&F#?:&:!-sP$"3U .s/@#J! G1bqH1++[,] 0L]&) (M(%:, k T1DuLr1-%,3ڥw%' ,B ,@ 8 #m {n.i?Uo xO1d) [(VIw!U&եD]%+)ǡ !=l,i..&P.(gl@r+)[3t3 ".&,sn"#,=",L!p0!m%i!8E 3b3"B, 5 $%&[-1 1æ~$c!+"-)Gk3e#n a",f#`X^,#"ʥh3Od&($b{HO*9!#Ԥ#3y$/)| {DKF".y* %Bs~ /u-%K"I)"3N15ګ#N%ߣ02d)H %;#> G M(}(ڣOs# #).,4gGH$6L +V_3#yG!"ǣV)Qdf3+$ Y>X *}#;0U,/} &2M //2(: %C $~*2>b @"2˦B$x/?)l%.|%m;-S1> cv$,(%.[)b3 #U \0<2%/V*p( M'`F*j  qe3@"(ǩ)8.42Y"1 7I_H%٩3i w"{E5$&M--AZ*Y-JF& *@)tq33 A 1"W <!%!&)#M/D))x ;.A3"K3w/3 3 3 333!!3 ,33Nm   أ&t )3*;`"<O Ψx #4c a, v!3 '"[y%%3L#3$3!3_ "#*Р' 13,3*3<+s$.$#OQHө-^/x(U%$&#%1-2, {J)p )}&SP#N#Wc$*   5,a|,*֨f1(&/ ( *1$!,C2D y0_,/"A3#YYu9]!M2J|" J,#."! ) F")<0!J"å O%J2NL0!Z|( ץ5O! + c ,>E(;1?'/ c38 &1j3i3h3g3"(dL/٦$S%S8*}^3X3%4Y 6 ѥbz.1,' \""h$Lm3e"~ v*m!.+8  %{48(!%(X(&Ʃ"H&#[(W*h(1'IBG C1/2:zU3Y1Nk"i )*"0=%(H=+H~o |EyW'x$"v B2*0,wWҡa*b  @"suy- "1 \"zKN"Ц.#B ceS a A %? %&&aI"q$sG I02|!H0G0J * %E0*Q!)31)! "'M0 !<L# .L l*_@] /\ "!".٥ CZ- FNXAV!!11D'7%u'j 1ġG>'% %2M~  2K.ĤX (0bi)G6i!3d$ 1% &"p2K2u!-0 &  ""&$:1Ab,H nO0p 1>h)l)F$+ -#O-R-c6-=-M-N-m@-!1-"x{L ?*c-}3D`-C0/)T-82X=M[*8D-V- B_rMA bpJx#+I,1<vd/9&ӥP.Ƞ"2$$3ť!R{3)$'2T3$'_ ;". UFo!3^-!ģ(7p n,0*ũMޥ-' Hr 30X|0k+{0x0(rq!'w%.~!2vvj'9;Gv*$$,$N!$$)Cw00i32)!1P-0 ] 2 0h?0W-*00#% <02$14 je+-]$A^(-0>(x'=)PE)0M T|M%5)%V0t3W0v&n(0000%0إ*00"'y c"$~O0=/W7 (3#:.X+[1Ҧn332{$$j*0M    ۥo!x / 7k&)/*B'= C % ƤMâ/ U@| krk +%0cS)p!02<0 ,ɥ"i- 1g$d W"~"o l @ r / RX*# 8 *E(!(A(ݥm"0)3&" arLU2z+4x 1Mvyǫ*K=%33)"R U>+% S*%2O/31`"+[K  j#&A-/0&3'3%?1&3'K*&#s!Z,(!{ c#k]#٫&+,02123f̥e D"&3/" E < KJ"tFI)0; '@&(^) _m,'!`$$#G#15[  .a# ݦ`p"*X*)O31!+ 5f'`! *#6+%G('.(nDTv_&E./d)$ 0. ~ ΢ 4z*M~M3)2 $*-ʢMϢ<  {>**L2i2*/B Q2Ңݢ]  /< -mةUo%S 3 v/0i/0$ %,000&0 00NܫS$mޠ  0%1)N*";- '1a2 I* V3YX Ud#,\D t-02 /G-i'#W;6?"u")3-  ,,Y' v )/ ī72"J !h$Aa-, z\-F !Y- .), @/7Er2L&*hf \3"SB)!9 9" 7#3Q{MU0 !0!"Pc>>3A]3.2]<,F!! :2$.c"  HТ--3 a$g% 2$02XB*&U2 !&S%!G2 #  X )  ; ImbR3= JSldp Ϧ{ 7*V%5C!!B2 Q!yA w"1 JI &2; Q 4"6!;2(2)J! `! )re l*g7-I3|#!"Q2j2%< h% " z  U$!X#"(5 1 V -%10$2%$ )+*U' *52B O"> 2 24Q,# !@ 2X!22< ٢!.#!q!>A J"آz ;D N,".l3). 05^fi'f !lgmno_c0%hdiejk5d S9)> 1q'/5%!B`;.$q%2}"6i"" F {""17NJ ߢo]y2vurf!onm*7\ihiedcb1  l#b 2[ k2:t !  J jb01ZtAR  ;9l&4-,% &F,>A1,,ZX\(b(#  81!)n&  @  )"^? .jZ*q]!JK \A bE"/* xt1b$mC/0'l6@h)%c$At&^X$"y2*2["4X9+ԫ!6X;"3!.3Mq2!iD PUx/!a)aR&%2o}'3"0 'r5!!e+*$?0>0)#@0zE*"%82 MĦj2Of DW5 ;|" +1 224! # \bOnB0 !R ai ],# q V "^&d' 8:G {&.c##q~ eբg)&Ԣ-( "JQR"T".#"V-"d#K *--y%}c (-fTV+j n!$1^o)@&#' $ ?* wkaF ) fcf#$*;/$4;S>+M! ="  :$  Zl G61!$ b c C . *!3K&* 1m 1"x iF kU c+$|2dbl"'hP A 38 m 3? ?1cF C*'0  S$!: |*wN6/@5.," mf>F+AI#Z?I+_1=2%Q%*H (b c +$ @93Y #S!A f2J!~&R#JT`30,!=L& "jF0]"\#x4 _ $T).@O'l1/6 .) Tb!#i Ϩ2T# }~R,/r!K#31E$"3Slxp!_I=>!}!&xU3= O3} E#1 ($3 C=!$19) K/*D$A3. =h1]$&dU3S B3!!@LRpji'J bl2 e22WJ18!|!'"w|HtVC:##/`##!&*  iF @7"dg!1 =.&zr9 !!{vy!  #@ ,"B")2v!&2 1^ R 92 $2#2"2!2 2( "*#(Tl,:? s;'cWi$[W&]9 ` !x wa% K .p G?k( VPdi$  %e/jps"$, !r&q,-#&&'mZ  +.9 26$& !{ -3g1 k ) "?+$U <1;1("N3.:'3"%B0b=';*2>g j:1q$N$ՠho<m%?sMl#;b@t-$~"<)נ tsrqp!Z/Lȫ ݠ8B# V""L(.(N(( ! "l3?""%QG1F-3+K')['&*4_@! GW&|{`%!?* r)& D-R%EU2 ;1>3,e$f((PP#"a jNR"(!LبU+f/;#.]2w# U9 6(V(j 2'Ǡ !M @ ,#2+111={)`1202/2.2-2,2+2g$R0 ` U#8w!%![  X01.- ! F ks 52ml| !n"!- T+&Ad*` #=131a$-1.g 8"(1i&h%$$$$N$2 $$$$$$ $-". $$$$$ $Mo ѫG )13 39)~ 5/>0d HbF jB^ 0 0K 0 0 00 0k*Ki((_0H Ť00 1 .3! (v!o($&!rUn[&K /*'`T23^Y(d#1zf!|g s K2f!{0 3}4&y!000000)ª"01#W27)*0+0(0)0&O&`%/I"j3 90s"vO g2j() x2R44(.0\> 4'+4&70mP"504$20-0/0ȥn|vu1j(( 4$ , gm#!#! `I$$TtS-wL)K$i-~)0q%& (+3p 0-Cb0i j Q *+*<%3W,'#%'0#W/000- H'+]8"3 '+ 3@$05 cI11. 11!} O bI""Q E+R/K5A) 1Q-!G!:(,\g!Dn2%+|B070Ѧmn.f2 thV) [J)r ! c3, ?$F/  ,k p>g/dpjV$XsT'\ x'w"+%","y!X[}O?3g21W D P~j#.B RI~2!g6'x%cG"2'hc'%%!#6( ^u  Oo0r$" , h% @"R!W9L2fO)\hU $$9 3G3!* a,C3' )P4$4`&4J4A &BZ2L/dwc0B,-Y2^1C$!%Q0 r D0x2C0!2E")'E n-)T&lʩ  #2_ G%S<0=03;0J/!(?2J0 2%_!1b8 k)>N0K0L0!\ z/Y ` 4$  %y#0Xg <  g"0>fjIP0>%f   *zӢi uf# , ] 0 -0` y$3e0 nQ(1(e(-20(a(| 3'0/&|)(+ {*-M1#g!,| 0'1/& #4 5Z(! .%I-~ }.RD1.< l-Q12P1N1zQV eLl2 $"jxUP[3qpuWsZ! +(/y X8;/-4.4A$F  #Si  E1 @]1_1 OZ1V1B2 Y 0?= Bd .# .  !))(Hf*yxw-0!E!4  4+c! 008600##W!000'b "O2Q5¥B#Q*p${'' & 4hU#(4M'4P2 #4)(w(Fw=& a  /( 1Mk & +  n.SIy} Rg v((H (*!P,~`o" hNm 3r)> $"$H |'= sW! #3[&!a:Y!, X{!֩% I'8xQ)YF,1 $ B++I)H # & T } g%( _(& !$x&ilh) k@ 5 <`1;  D '0e,    No*!d ' %00 ",!x3 (_z(2 Y% KG,F! 0 4 " (!2 s  y  P/ }U )B sIpe)Q- $- # M#NC%J$.d2á % 1)0f&z*aW5 _%SU%Y ,[%q*J#z3"F3K3J3G3.Y 2 M)C+32D)S3U0#("(C(V`30&3m1Nj1& /$ &>* ((#$*:X,&&- %(( (%(g1.Vd18 A{"zt1p1( n1 $x1y113-9&]?#q!(E?b YUޡߡ: )u$).&R}1~1|1/ 6 '40|-&- 03"v"!&a0 $#d_Y.i0 /71b 27r!$r"Z Nl%,y,7F#-# 2 Ui>!//5c *./+FX-6 3IQ3Q1 Z&'T(z ,#i.j a&0; |Q2<h %VR$ pXnr)/K.kS' }' [u# 2Yx\/  z&oc30" *+#J3~ev)F``2l6/Cf i,*@sA 1v22yHTf,SVT<c,/.!q"+1r1uv11t<fxgs"D73Ch!qu 32&7&ZS3b4i}39t*m- hnfj%.6k3%rf3xuv}? yz">%J/) |8\ #Ѥ"$&-O%/\PZ'F(!61h6mL"w@0p ^3f2:"/* Da> %)/$!'v=5B=0 G]>#* 3f.?- 5'[v=d4" / 1g)ܢ<Hb*gc"biW,9" &  ,/8 I3!~[ _*^'\ )*N*gb0m2/4c0ۢY"nn#; GMr "X@$C3^*z 'j %)$Q}1 #&;0|2,D*ӫ 21ts%89c""Z j--8C l$1)~ M; >2d11_b"35ޣ*$$%&2*1uJp197C1+ 6+R/f47e"k', C37 fg  +'4U 111'11 1(1 111 1<*4 z  6 pI  16, 111(!E $9$0%$$$$!$$$$$$$$$$$$$$$$%#6&#MCRT$V^"p5n)q((  2 "\)a 9R)E&F  N`Q--?_&.tE")$!M P%w!42 ib#n&Q-`*v'B 3 &,+*c!&Y&LU/W,)g#Ea2!X?Z-F1K!0YGfD0a0`ɫ2#be)|* :!1~6 1'yhxdDeaz3}_o2gu! "  9`r 3.  3Wod,dQ33j%2G k5331qM$n#JU+V& k19 <t R& 0* Ag)B-*q&"q/Z'2e% "?X2U })n 22E u1r((/( H*?n8"\9;o` B  D,a^hDr. "5~#z) '<W H"o9$Bޤ*1$(2 q1p$<1B"+E%1 ,\!,P 3Q"K (1Sl!F T Ik!. * 2gQ"Dd .!3 /UV0 E&(NI ~\XL t,H WMFGH> JK!7c(!}1x,J& x1G2* oe*!FK?-I0h1  Jy 0A- o'E!/ 2$> }ԨMMW cNTUuq!///1K()"O1BxP Mz ,p%(w"R1#$E C ;10RbQD I G3{xT)67(e g3Q!#f ("-| .m%i LI],C'~"qJ^# 0s% P3/j8"@ CUo !*" + 6# R"*R :&M./P/"/0(#s 9 61{-1!~0Ȣ' C<" 20[ :M,.| , V:X8 G (3,%b-d (k ~,T ~3 #q #N" Ӧ}!Ʀ""_12qiF.<# y x!l!o QS M[",f"aE2!E"$VC,}"hH2)j˥"m/o) #FtyL'v%Y@'V"3 3x3-_4!DJG(.eBL &| yz"[B N\a1/+*{3*([,+ y30"+..o0 Y*f#'%800#E(#0*..> !?~ <,G="1pq  ") 4r p/ 0DI " XeR-N!%ףˣ1#>&##$)1N$21P3T)/C*0,'' s"ef0*&$/(7:u1 ;2oL1 2s3*K#.!31,9d&3"=12+5"3& uq 2HI&'qH-!_#} s9%d2 '.U f)  F*'v (q1"26 !4#L"l0#s3D33`3"c13"L"v#3p R3 %)ު%ML301?&<3$2#,')22 22 -S!=!)! C\32 $2H t#'"2"v,1s1:w1/3   "" W_S++ +b!QO2L*T M#" "z,L]"v#D".r(4snE+)@),}W$c19Y03#33W13H+:#1,K lV#&#2#Rz"i G1:ФE#Q TQ|1X F@=AD,FEHI, o33C 3E-Ӥ8{Z"$@ ;  | %,s,S3D / A L y*/11C#<,4=u, 9 4  ,!%]t{3&D12X2!:-H#&$ !LvPw)~"dw,+# %x)!J%?&$Jz1:_"><;EG)_,V +**n-,˫\'(4 @ S! &%$#prA1R # I1 / #9O6$10m542|')0u)!*#1111Z011[03&3`0lơ2k 222,")[#4')z &< PNSTQ,WXy*s2 %oB J<* !M2W3K2222 22 d#b'#2 } oS_2%^ 1/b& K^'!ND )A$ A2gS.rpartition(sep) -> (head, sep, tail) Search for the separator sep in S, starting at the end of S, and return the part before it, the separator itself, and the part after it. If the separator is not found, return two empty strings and S.DN"H(k/PN"|!]N"-hN"ho-oN"3vN"J-}N"c3N"Q_9N" |6N".N"(!N" ``9s . A  $]+factorial(x) -> Integral Find x!. Raise a ValueError if x is negative or non-integral.S.strip([chars]) -> string or unicode Return a copy of the string S with leading and trailing whitespace removed. If chars is given and not None, remove characters in chars instead. If chars is unicode, S will be converted to unicode before strippingr@cc4dNddeABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/send(data[, flags]) -> count Send a data string to the socket. For the optional flags argument, see the Unix manual. Return the number of bytes sent; this may be less than len(data) if the network is busy.call_tracing(func, args) -> object Call func(*args), while tracing is enabled. The tracing state is saved, and restored afterwards. This is intended to be called from a debugger from a checkpoint, to recursively debug some other code.sss:symtableexecevalsinglesymtable() arg 3 must be 'exec' or 'eval' or 'single'symtableReturn symbol and scope dictionaries used internally by compiler._symtableUSEDEF_GLOBALDEF_LOCALDEF_PARAMDEF_FREEDEF_FREE_CLASSDEF_IMPORTDEF_BOUNDTYPE_FUNCTIONTYPE_CLASSTYPE_MODULEOPT_IMPORT_STAROPT_EXECOPT_BARE_EXECLOCALGLOBAL_EXPLICITGLOBAL_IMPLICITFREECELLSCOPE_OFFSCOPE_MASKB.partition(sep) -> (head, sep, tail) Searches for the separator sep in B, and returns the part before it, the separator itself, and the part after it. If the separator is not found, returns B and two empty bytearray objects.։6I6.I6|Ireadinto() -> Same as RawIOBase.readinto().abs(number) -> number Return the absolute value of the argument.unexpected binary operation %d on a constantunexpected unary operation %d on a constantNonecputype/%s/bin/ape/shsh-cb3b3)g/EI. +(@; seek(offset: int[, whence: int]) -> None. Move to new file position. Argument offset is a byte count. Optional argument whence defaults to 0 (offset from start of file, offset should be >= 0); other values are 1 (move relative to current position, positive or negative), and 2 (move relative to end of file, usually negative, although many platforms allow seeking beyond the end of a file). Note that not all file objects are seekable.@min(iterable[, key=func]) -> value min(a, b, c, ...[, key=func]) -> value With a single iterable argument, return its smallest item. With two or more arguments, return the smallest argument.D.keys() -> list of D's keys-DT! @inet_pton(af, ip) -> packed IP address string Convert an IP address from string format to a packed string suitable for use with low-level network functions.atan(x) Return the arc tangent of x.D.iterkeys() -> an iterator over the keys of Dsend(arg) -> send 'arg' into generator, return next yielded value or raise StopIteration.__name__GC object already tracked../Objects/funcobject.c../Objects/funcobject.c../Objects/funcobject.c../Objects/funcobject.c../Objects/funcobject.cnon-tuple default args../Objects/funcobject.c../Objects/funcobject.cexpected tuple for closure, got '%.100s'func_closure__closure__func_doc__doc__func_globals__globals____module__function attributes not accessible in restricted modefunction's dictionary may not be deletedsetting function's dictionary to a non-dict__code__ must be set to a code object%s() requires a code object with %zd free vars, not %zd__name__ must be set to a string object__defaults__ must be set to a tuple objectfunc_code__code__func_defaults__defaults__func_dict__dict__func_name__name__codeglobalsnameargdefsclosureO!O!|OOO:functionarg 3 (name) must be None or stringarg 4 (defaults) must be None or tuplearg 5 (closure) must be tuplearg 5 (closure) must be None or tuple%s requires closure of length %zd, not %zdarg 5 (closure) expected cell, found %sfunctionuninitialized classmethod objectclassmethodclassmethod__func__classmethoduninitialized staticmethod objectstaticmethodstaticmethod__func__staticmethodRemove and return an arbitrary set element. Raises KeyError if the set is empty.-DT!?getgid() -> gid Return the current process's group id.")"~3,8P'P7Oq87.Wq84]q8;fq8 r?iW @)))M$ yAB.expandtabs([tabsize]) -> copy of B Return a copy of B where all tab characters are expanded using spaces. If tabsize is not given, a tab size of 8 characters is assumed.sinh(x) Return the hyperbolic sine of x.readinto() -> Undocumented. Don't use this; it may go away.tcsetpgrp(fd, pgid) Set the process group associated with the terminal given by a fd.1pipe() -> (end0, end1) Create a pipe.B.rindex(sub [,start [,end]]) -> int Like B.rfind() but raise ValueError when the subsection is not found.ABq-G$HIq-dup() -> socket object Return a new socket object connected to the same system resource.[C]chain(*iterables) --> chain object Return a chain object whose .next() method returns elements from the first iterable until it is exhausted, then elements from the next iterable, until all of the iterables are exhausted.expandtabs(string, [tabsize]) -> string Expand tabs in a string, i.e. replace them by one or more spaces, depending on the current column and the given tab size (default 8). The column number is reset to zero after each newline occurring in the string. This doesn't understand other non-printing characters.B<~6setblocking(flag) Set the socket to blocking (flag is true) or non-blocking (false). setblocking(True) is equivalent to settimeout(None); setblocking(False) is equivalent to settimeout(0.0).a$ig$n$w$$$$ $6$ $ $4$5$@ 6set() -> new empty set object set(iterable) -> new set object Build an unordered collection of unique elements.gettimeout() -> timeout Returns the timeout in seconds (float) associated with socket operations. A timeout of None indicates that timeouts on socket operations are disabled.chmod(path, mode) Change the access permissions of a file.9194%-9ԍ89\!9Ύ\89 6 9X-9\.'9t</9 ';9qPO4F9x'(T9$0rect(r, phi) -> z: complex Convert from polar coordinates to rectangular coordinates.Read and return a line from the stream. If limit is specified, at most limit bytes will be read. The line terminator is always b'\n' for binary files; for text files, the newlines argument to open can be used to select the line terminator(s) recognized. D.viewitems() -> a set-like object providing a view on D's itemslog10(x) Return the base-10 logarithm of x."M/#"{7Issue a warning, or maybe ignore it or raise an exception.0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfaReturn whether this is an 'interactive' stream. Return False if it can't be determined. ?3OP@zipimporter(archivepath) -> zipimporter object Create a new zipimporter instance. 'archivepath' must be a path to a zipfile, or to a specific path inside a zipfile. For example, it can be '/tmp/myimport.zip', or '/tmp/myimport.zip/mydirectory', if mydirectory is a valid directory inside the archive. 'ZipImportError is raised if 'archivepath' doesn't point to a valid Zip archive. The 'archive' attribute of zipimporter objects contains the name of the zipfile targeted.stringstropuppercaseuppercaselowercaselowercaselettersi|z:setlocaleunsupported locale settinglocale query faileddecimal_pointthousands_sepgroupingint_curr_symbolcurrency_symbolmon_decimal_pointmon_thousands_sepmon_groupingpositive_signnegative_signint_frac_digitsfrac_digitsp_cs_precedesp_sep_by_spacen_cs_precedesn_sep_by_spacep_sign_posnn_sign_posnss:strcolls:strxfrmsetlocalelocaleconvstrcollstrxfrm_localeLC_CTYPELC_TIMELC_COLLATELC_MONETARYLC_NUMERICLC_ALLCHAR_MAXlocale.ErrorError__doc__H)-ŝ A4d!  (ylE q&TsY ) }$naninfinityinf7635118191655355242878388607671088631342177271251562519531251220703125152587890625190734863281251192092895507812514901161193847656257450580596923828125+ @B.lower() -> copy of B Return a copy of B with all ASCII characters converted to lowercase. (@0@0execfile(filename[, globals[, locals]]) Read and execute a Python script from a file. The globals and locals are dictionaries, defaulting to the current globals and locals. If only globals is given, locals defaults to it.{Qgy`qz=km    !"# $library version mismatchincomplete or truncated streaminconsistent stream stateinvalid input dataError %d %sError %d %s: %.200ss#|i:compressCan't allocate memory to compress data1.2.3Out of memory while compressing dataBad compression levelwhile compressing datawhile compressing datawhile finishing compressions#|in:decompress1.2.3Out of memory while decompressing datawhile preparing to decompress datawhile decompressing datawhile decompressing datawhile finishing data decompression|iiiii:compressobj1.2.3Can't allocate memory for compression objectInvalid initialization optionwhile creating compression object|i:decompressobj1.2.3Invalid initialization optionCan't allocate memory for decompression objectwhile creating decompression objects#:compresswhile compressings#|i:decompressmax_length must be greater than zerowhile decompressing|i:flushfrom deflateEnd()while flushingInconsistent stream stateCan't allocate memory for compression objectwhile copying compression objectInconsistent stream stateCan't allocate memory for decompression objectwhile copying decompression object|i:flushlength must be greater than zerofrom inflateEnd()compressflushcopydecompressflushcopyunused_dataunconsumed_tails#|I:adler32s#|I:crc32adler32compresscompressobjcrc32decompressdecompressobjzlib.Compresszlib.Decompresszlibzlib.errorerrorMAX_WBITSDEFLATEDDEF_MEM_LEVELZ_BEST_SPEEDZ_BEST_COMPRESSIONZ_DEFAULT_COMPRESSIONZ_FILTEREDZ_HUFFMAN_ONLYZ_DEFAULT_STRATEGYZ_FINISHZ_NO_FLUSHZ_SYNC_FLUSHZ_FULL_FLUSH1.2.3ZLIB_VERSION__version__1.0U8 U8decompress(data) -> decompressed data Decompress data in one shot. If you want to decompress data sequentially, use an instance of BZ2Decompressor instead. !3|@/proc/%d/notepg/proc/%d/notepg/proc/%d/noteSupport for POSIX locales.Simple type for treating strings as input file streamsB.isupper() -> bool Return True if all cased characters in B are uppercase and there is at least one cased character in B, False otherwise.B"fL"UR"ΨY"+h"u""+"polar(z) -> r: float, phi: float Convert a complex from rectangular coordinates to polar coordinates. r is the distance from 0 and phi the phase angle."g/7phase(z) -> float Return argument, also known as the phase angle, of a complex.AiAApqAAqqiA{DAA@@P@?reset() -- Reset the file position to the beginning-DT!? <B<01 N01#N01N01N01O01O015Odirreadall(path) -> list_of_dir_tuples Return a list containing tuple stat structures for the directory. path: path of directory to list /bin/ape/binPATHPATH=/bin:.igjk`p%ijget_source(fullname) -> source string. Return the source code for the specified module. Raise ZipImportError if the module couldn't be found, return None if the archive does contain the module, but has no source for it.no mem to build parser accelerators XXX too many states! XXX too high nonterminal number! XXX ambiguity! no mem to add parser accelerators A%d.%d.%d.%d:%s::%x%se#!e# (e#CDATA[/ysys.float_info A structseq holding information about the float type. It contains low level information about the precision and internal representation. Please study your system's :file:`float.h` for more information.#$A$$A%$Ax'$A($Ap*$A+$Ah-$A.$A`0$A1$AX3$A4$AP6$A7$AH9$A:$A@<$A=$A8?$A@$A0B$AC$A(E$AF$A H$AI$AK$AL$AN$AO$AQ$AR$ADS$AT$AT$AU$ADV$AW$AW$AX$ADY$AZ$AZ$A[$AD\$A]$A]$A^$AD_$A`$A`$Aa$ADb$Ac$Ac$Ad$ADe$Af$Af$Ag$ADh$Ai$Ai$Aj$ADk$Al$Al$Am$ADn$AR99 99999 9$9( 9, 90 94# 982 9<This module provides access to the garbage collector for reference cycles. enable() -- Enable automatic garbage collection. disable() -- Disable automatic garbage collection. isenabled() -- Returns true if automatic collection is enabled. collect() -- Do a full collection right now. get_count() -- Return the current collection counts. set_debug() -- Set debugging flags. get_debug() -- Get debugging flags. set_threshold() -- Set the collection thresholds. get_threshold() -- Return the current the collection thresholds. get_objects() -- Return a list of all objects tracked by the collector. is_tracked() -- Returns true if a given object is tracked. get_referrers() -- Return the list of objects that refer to an object. get_referents() -- Return the list of objects that an object refers to. &Lr.rE}htan(x) Return the tangent of x.file(name[, mode[, buffering]]) -> file object Open a file. The mode can be 'r', 'w' or 'a' for reading (default), writing or appending. The file will be created if it doesn't exist when opened for writing or appending; it will be truncated when opened for writing. Add a 'b' to the mode for binary files. Add a '+' to the mode to allow simultaneous reading and writing. If the buffering argument is given, 0 means unbuffered, 1 means line buffered, and larger numbers specify the buffer size. The preferred way to open a file is with the builtin open() function. Add a 'U' to mode to open the file for input with universal newline support. Any line ending in the input file will be seen as a '\n' in Python. Also, a file so opened gains the attribute 'newlines'; the value for this attribute is one of None (no newline read yet), '\r', '\n', '\r\n' or a tuple containing all the newline types seen. 'U' cannot be combined with 'w' or '+' mode. 6,E 6r$L`C@Retrieve the entire contents of the object.Q%?H1^%JqHD]+j%t8u%L).}%=#%6%.%7(<%rXy;%s$%+s3%zC)%W0;%\t8%yPO,%tX.%Ċ%%  6%Hz;%ȍ\/%W8print recursionNULL object : type : %s refcount: %ld address : %p NULL<%s object at %p>__repr__ returned non-string (type %.200s) while getting the str of an object__str__ returned non-string (type %.200s)strict__unicode____unicode__stricttp_compare didn't return -1 or -2 for exceptiontp_compare didn't return -1, 0 or 1../Objects/object.c in cmpcomparing unequal types not supported in 3.x in cmpunhashable type: '%.200s'attribute name must be string, not '%.200s''%.50s' object has no attribute '%.400s'attribute name must be string, not '%.200s''%.100s' object has no attributes (%s .%.100s)delassign to'%.100s' object has only read-only attributes (%s .%.100s)delassign to'%.200s' object is not iterableattribute name must be string, not '%.200s''%.50s' object has no attribute '%.400s'attribute name must be string, not '%.200s''%.100s' object has no attribute '%.200s''%.50s' object attribute '%.400s' is read-onlynumber coercion failed__call____dict____bases____members____methods____members__ and __methods__ not supported in 3.xframe does not existkeysdir(): expected keys() of locals to be a list, not '%.200s'__dict__%.200s.__dict__ is not a dictionary__dict____members____methods____class____dir____dir____dir__() must return a list, not %.200sNonedeallocating NoneNoneTypeNotImplementedNotImplementedTypeCan't initialize type typeCan't initialize weakref typeCan't initialize callable weakref proxy typeCan't initialize weakref proxy typeCan't initialize bool typeCan't initialize str typeCan't initialize bytearray typeCan't initialize list typeCan't initialize None typeCan't initialize NotImplemented typeCan't initialize traceback typeCan't initialize super typeCan't initialize object typeCan't initialize xrange typeCan't initialize dict typeCan't initialize set typeCan't initialize unicode typeCan't initialize slice typeCan't initialize static method typeCan't initialize complex typeCan't initialize float typeCan't initialize buffer typeCan't initialize long typeCan't initialize int typeCan't initialize frozenset typeCan't initialize property typeCan't initialize memoryview typeCan't initialize tuple typeCan't initialize enumerate typeCan't initialize reversed typeCan't initialize code typeCan't initialize frame typeCan't initialize builtin function typeCan't initialize method typeCan't initialize function typeCan't initialize class typeCan't initialize dict proxy typeCan't initialize generator typeCan't initialize get-set descriptor typeCan't initialize wrapper typeCan't initialize instance typeCan't initialize ellipsis typeCan't initialize member descriptor typeCan't initialize file typeCan't initialize capsule typeCan't initialize cell typeCan't initialize call iter typeCan't initialize sequence iterator typePy_ReprPy_ReprPy_ReprCDATA[coerce(x, y) -> (x1, y1) Return a tuple consisting of the two numeric arguments converted to a common type, using the same rules as used by arithmetic operations. If coercion is not possible, raise TypeError.# <, <1 <; <U <G <L <tanh(x) Return the hyperbolic tangent of x.)#)()-)ؗҜ<3#I9=D2[%Cod(hi3w{i3w~i3xxi3Dfsendto(data[, flags], address) -> count Like send(data, flags) but allows specifying the destination address. For IP sockets, the address is a pair (hostaddr, port).setattr(object, name, value) Set a named attribute on an object; setattr(x, 'y', v) is equivalent to ``x.y = v''.  _exit(status_string) Exit to the system with specified status, without normal exit processing.reverse() Reverse the order of the items in the array. 8fauth(fd, name) -> int Acquire an authentication fd.##B.decode([encoding[, errors]]) -> unicode object. Decodes B using the codec registered for encoding. encoding defaults to the default encoding. errors may be given to set a different error handling scheme. Default is 'strict' meaning that encoding errors raise a UnicodeDecodeError. Other possible values are 'ignore' and 'replace' as well as any other name registered with codecs.register_error that is able to handle UnicodeDecodeErrors.U#3$3J3T3s33333333pipe() -> (read_end, write_end) Create a pipe.#####%#4#>#G#h#l#S.capitalize() -> string Return a copy of the string S with only its first character capitalized.Capsule objects let you wrap a C "void *" pointer in a Python object. They're a way of passing data through the Python interpreter without creating your own custom type. Capsules are used for communication between extension modules. They provide a way for an extension module to export a C interface to other extension modules, so that extension modules can use the Python import mechanism to link to one another. sslwrap(socket, server_side, [keyfile, certfile, certs_mode, protocol, cacertsfile, ciphers]) -> sslobjectlist() -> new empty list list(iterable) -> new list initialized from iterable's itemsCSV parsing and writing. This module provides classes that assist in the reading and writing of Comma Separated Value (CSV) files, and implements the interface described by PEP 305. Although many CSV files are simple to parse, the format is not formally defined by a stable specification and is subtle enough that parsing lines of a CSV file with something like line.split(",") is bound to fail. The module supports three basic APIs: reading, writing, and registration of dialects. DIALECT REGISTRATION: Readers and writers support a dialect argument, which is a convenient handle on a group of settings. When the dialect argument is a string, it identifies one of the dialects previously registered with the module. If it is a class or instance, the attributes of the argument are used as the settings for the reader or writer: class excel: delimiter = ',' quotechar = '"' escapechar = None doublequote = True skipinitialspace = False lineterminator = '\r\n' quoting = QUOTE_MINIMAL SETTINGS: * quotechar - specifies a one-character string to use as the quoting character. It defaults to '"'. * delimiter - specifies a one-character string to use as the field separator. It defaults to ','. * skipinitialspace - specifies how to interpret whitespace which immediately follows a delimiter. It defaults to False, which means that whitespace immediately following a delimiter is part of the following field. * lineterminator - specifies the character sequence which should terminate rows. * quoting - controls when quotes should be generated by the writer. It can take on any of the following module constants: csv.QUOTE_MINIMAL means only when required, for example, when a field contains either the quotechar or the delimiter csv.QUOTE_ALL means that quotes are always placed around fields. csv.QUOTE_NONNUMERIC means that quotes are always placed around fields which do not parse as integers or floating point numbers. csv.QUOTE_NONE means that quotes are never placed around fields. * escapechar - specifies a one-character string used to escape the delimiter when quoting is set to QUOTE_NONE. * doublequote - controls the handling of quotes inside fields. When True, two consecutive quotes are interpreted as one during read, and when writing, each quote character embedded in the data is written as two quotes 6(-3E6[-~,8"q2L2$#$;$http://www.w3.org/XML/1998/namespacecollect([generation]) -> n With no arguments, run a full collection. The optional argument may be an integer specifying which generation to collect. A ValueError is raised if the generation number is invalid. The number of unreachable objects is returned. @combining(unichr) Returns the canonical combining class assigned to the Unicode character unichr as integer. Returns 0 if no combining class is defined.oct(number) -> string Return the octal representation of an integer or long integer.Mixing iteration and read methods would lose datathe bz2 library was not compiled correctlythe bz2 library has received wrong parametersinvalid data streamunknown IO errorcompressed file ended before the logical end-of-stream was detectedwrong sequence of bz2 library commands usedUnable to allocate buffer - output too largeline is longer than a Python string can hold|l:readI/O operation on closed filefile is not ready for readingrequested number of bytes is more than a Python string can hold|i:readlineI/O operation on closed filefile is not ready for reading|l:readlinesI/O operation on closed filefile is not ready for readingline is longer than a Python string can holds*:writeI/O operation on closed filefile is not ready for writingI/O operation on closed filefile is not ready for writingwritelines() requires an iterable argumentwritelines() argument must be a sequence of stringsO|i:seekI/O operation on closed fileseek works only while readingseek(i)I/O operation on closed filecloseI/O operation on closed fileclosereadreadlinereadlinesxreadlineswritewritelinesseektellclose__enter____exit__ (ss) (ss) (ss) (sss) Unknown newlines value 0x%x modenameclosedTrue if the file is closednewlinesend-of-line convention used in this filemodefile mode ('r', 'w', or 'U')namefile namesoftspaceflag indicating that a space needs to be printed; used by printfilenamemodebufferingcompresslevelrO|sii:BZ2Filecompresslevel must be between 1 and 9invalid mode char %crbwb(Osi)unable to allocate lockI/O operation on closed fileI/O operation on closed filebz2.BZ2Files*:compressthis object was already flushedobject was already flushedcompressflushcompresslevel|i:BZ2Compressorcompresslevel must be between 1 and 9unable to allocate lockbz2.BZ2Compressorunused_datas*:decompressend of stream was already founddecompress:BZ2Decompressorunable to allocate lockbz2.BZ2Decompressordatacompresslevels*|icompresslevel must be between 1 and 9s*:decompresscouldn't find end of streamcompressdecompressbz2__author__BZ2FileBZ2CompressorBZ2Decompressorn-ūv----y---9-Ǭ?-x-----<-6-c;-N7m(4S7 iK-X7kV"]7c8m2h7?f,S/n7dh;y7 \0/~7V:07V:07`17`-7Op$7]wq87] 87_`d37S`'7S`'̆7_]3҆7gl"ۆ7CqtB87a8+dsapuballocdsaprivallocdsasigallocD.popitem() -> (k, v), remove and return some (key, value) pair as a 2-tuple; but raise KeyError if D is empty.a2b_hex(hexstr) -> s; Binary data of hexadecimal representation. hexstr must contain an even number of hex digits (upper or lower case). This function is also available as "unhexlify()"CSV dialect The Dialect type records CSV parsing and generation options. tell() -> current file position, an integer heapreplace(heap, item) -> value. Pop and return the current smallest value, and add the new item. This is more efficient than heappop() followed by heappush(), and can be more appropriate when using a fixed-size heap. Note that the value returned may be larger than item! That constrains reasonable uses of this routine unless written as part of a conditional replacement: if item > heap[0]: item = heapreplace(heap, item) Return whether object was opened for reading. If False, read() will raise IOError.exp(x) Return e raised to the power of x.NOTATION(decompress(data) -> string Provide more data to the decompressor object. It will return chunks of decompressed data whenever possible. If you try to decompress data after the end of stream is found, EOFError will be raised. If any data was found after the end of stream, it'll be ignored and saved in unused_data attribute. Q$CDATA[S.isupper() -> bool Return True if all cased characters in S are uppercase and there is at least one cased character in S, False otherwise.classmethod(function) -> method Convert a function to be a class method. A class method receives the class as implicit first argument, just like an instance method receives the instance. To declare a class method, use this idiom: class C: def f(cls, arg1, arg2, ...): ... f = classmethod(f) It can be called either on the class (e.g. C.f()) or on an instance (e.g. C().f()). The instance is ignored except for its class. If a class method is called for a derived class, the derived class object is passed as the implied first argument. Class methods are different than C++ or Java static methods. If you want those, see the staticmethod builtin.S.pack(v1, v2, ...) -> string Return a string containing values v1, v2, ... packed according to this Struct's format. See struct.__doc__ for more on format strings.11‚11/1c1111K0123456789ABCDEFAB.extend(iterable int) -> None Append all the elements from the iterator or sequence to the end of B.H)r)!|+H  :new buffer size too largeI/O operation on closed file.I/O operation on closed file.I/O operation on closed file.I/O operation on closed file.I/O operation on closed file.I/O operation on closed file.|O:readinteger argument expected, got '%s'I/O operation on closed file.|O:readlineinteger argument expected, got '%s'I/O operation on closed file.|O:readlinesinteger argument expected, got '%s'I/O operation on closed file.w*I/O operation on closed file.|O:truncateinteger argument expected, got '%s'negative size value %zdI/O operation on closed file.I/O operation on closed file.O|i:seeknegative seek value %zdnew position too largenew position too largeinvalid whence (%i, should be 0, 1 or 2)I/O operation on closed file.I/O operation on closed file.(OnN)%.200s.__setstate__ argument should be 3-tuple, got %.200ssecond item of state must be an integer, not %.200sposition value cannot be negativethird item of state should be a dict, got a %.200sinitial_bytes|O:BytesIOclosedTrue if the file is closed.readableseekablewritablecloseflushisattytellwritewritelinesread1readintoreadlinereadlinesreadgetvalueseektruncate__getstate____setstate____sizeof___io.BytesIOinvalid distance too far backinvalid distance codeinvalid literal/length code)))$$$$$$$$%dbmF#C.<C.C.z@D.(D.<2D.eD.@qD.fork() -> pid Fork a child process. Return 0 to child process and PID of child to parent process.Remove an element from a set if it is a member. If the element is not a member, do nothing.@0U @0U @0U   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~fghijk mnopq  !"#$%&'()*+,-./0123456789:;<=>?@ABCDErstuvwxyz{|FGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcde>0////////////   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg..s4G4..566..n99&99s:9+,N;n<<.12.V@_A.7C...;CC.CDaFLFC#G)G|GG.GIzI}IIIIIIIIITULLLLwLLMMMMMMMMdhijklmnopqrstuvwxyz{|}~Gz?B.rjust(width[, fillchar]) -> copy of B Return B right justified in a string of length width. Padding is done using the specified fill character (default is a space)xb4bWeBJbecb fsphj^mH?kmij^mI?kmlj^mL?kmqkTnQdln?mpfl5odmostring must be of size 1an integer or string of size 1 is requiredbyte must be in range(0, 256)accessing non-existent bytes segmentaccessing non-existent bytes segmentaccessing non-existent bytes segmentType %.100s doesn't support the buffer APIExisting exports of data: object cannot be re-sizedNegative size passed to PyByteArray_FromStringAndSizecan't concat %.100s to %.100scan't concat %.100s to %.100sbytearray index out of rangebytearray index out of rangebytearray indices must be integerscan't set bytearray slice from %.100sbytearray index out of rangebytearray index out of rangebytearray indices must be integercan assign only bytes, buffers, or iterables of ints in range(0, 256)attempt to assign bytes of size %zd to extended slice of size %zdsourceencodingerrors|Oss:bytearrayencoding or errors without sequence argumentunicode argument without an encodingencoding or errors without a string argumentnegative count0123456789abcdefbytearray(b)bytearray object is too large to make reprComparison between bytearray and stringdeallocated bytearray object has exported buffersempty separatorempty separatorempty separatorempty separator|i:expandtabsresult is too longresult is too longresult is too longn|c:ljustn|c:rjustn|c:centern:zfillfind/rfind/index/rindexcountsubsection not foundsubsection not foundbyte must be in range(0, 256)startswithendswithtranslatetranslation table must be 256 characters longreplace string is too longreplace string is too longreplace bytes is too longreplace bytes is too longreplace bytes is too longreplace bytes is too longOO|n:replace|On:split|On:rsplitnO:insertcannot add more objects to bytearraycannot add more objects to bytearray|n:poppop from empty bytearraypop index out of rangevalue not found in bytearray|O:strip |O:lstrip |O:rstrip encodingerrors|ss:decodecan only join an iterablecan only join an iterable of bytes (item %ld has type '%.100s')|i:splitliness#:fromhexnon-hexadecimal number found in fromhex() arg at position %zd__dict__(O(Ns)N)latin-1__alloc____reduce____sizeof__appendcapitalizecentercountdecodeendswithexpandtabsextendfindfromhexindexinsertisalnumisalphaisdigitislowerisspaceistitleisupperjoinljustlowerlstrippartitionpopremovereplacereverserfindrindexrjustrpartitionrsplitrstripsplitsplitlinesstartswithstripswapcasetitletranslateupperzfillbytearray__length_hint__bytearray_iterator../Objects/bytearrayobject.cGC object already trackedd1d1d1d1d1$}$?$&-2QY_`dghim~*,CEGILNjl23456789PUR`b !.%PP3R 4       $ ' / 1 1 4 4 6 : <  !~!!!! !!! !"!_!l!o!, z!!0 !!F !"H "" "" "" "" "" !""" $"$" &"&" ,"-" /"3" 8"<" >"G" I"K" M"Q" S"_" b"c" h"m" p"" """!""%!""0!"#I!#_$!j$s$"$$"L%O%V#t%%Z#%%g#%%j#%%t#%%#%%#%%#%%#%%#%&#&&# &?&#A&A&$C&.$..A,..C,..F,..H,..R,..a,..c,..f,..j,..l,..o,./},//-00-00-0 0-*0=0-?0@0-00-00-00-01-*12-*202.222.23F/330033<033>033`033i033k03F4m0H4r40t45 15 6326626929m95o99599_69r:m6t:M;7O;m<7o<<8<U@j9W@^A<`A6C=8CC?CC2@CC6@CDa@DKFYAMF`FBbF"GB$G(GC*G{GC}GGCGFI DHIyIE{I|IE~IIEIIEIIEIIFIIFIvL)FxLLHLMIMM~IMMJcJll̂͂%҂'*ق-0݂3:<BDSVce+-xՓz!< ""%&*/22ĘEHŘSSɘXXʘgg˘l̘_aHetextacomplex_as_numberPtwo_tupleastartswith__doc__bwarnings_functionsPPy_InteractiveFlagbindex1index2/marshal.c__big5hkscs_bmp_encmap4keywords$280marshal.hP_pythread_stacksizeP expr_typepu2johabjamoPmissing_str$149textiobase_errors_doc$rindex__doc__sizes$2uvneginfmath_cosh_docPPyExc_BytesWarning_STAT.sgetpath.cinflate_copyrightmpaux.cPPy_Py3kWarningFlag_p9ssl.csetmalloctag.cPyDateTime_TimeTypefileno_doc0iobase_truncate_docxmlparse.cPyByteArrayIter_Typereadline_docPPow_singletonlphrasebook!|$97a5848d.40337b20multibytecodec.c!|stringio_close_doc!}Assert_fieldsmultibytecodec.h!}dfas!usedpools!imap_docstrpbrk.cP unicode_emptyP$Lambda_typebind.cP(pkgstr$251!atypeCDATA$341!.stringrepeat_type#>$0.404e00001unicodeobject.hymyreadline.cT_PyOS_optarg#>popleft_doc#>dmsizeTdummy#?import_doc#BPyArrayIter_Type=J|end#Cplength_hint_doc7memccpy.c#Cmodule_docUPyExc_EOFError#DHbin_doc#Dimporthookdescr#Dunicode_methods#Gposix_fpathconf__doc__\malloc.cUblock_listUstmt_type#HPySSL_RAND_status_docU field_limitUfree_list#H.stringU_PyOS_opterr#LdMultibyteCodec_Encode__doc__#Nnext_doc#NTreeBuilder_Type#Op.stringU_PyOS_optind#Oisalpha__doc__#Pcallstats_doc'fileno.c#Rselect_docUcomplexstr$33#VIfExp_fields#VPyByteArray_Type#Wreadable_doc#Wdoc_load_moduleerrcode.h#Xmatch_members#Y$lstrip__doc__#Yset_methods#[kwlist$543#[kwlist$546fmod.c#[ kwlist$626U codec_listerrnomodule.c#[0kwlist$627U$modstr$1#[@kwlist$565U(delstr#[Pkwlist$581#[\.stringU,append$214#^math_atanh_doc#_Dstringio_truncate_doc#_.string#`connect_doc#`.stringchmod.cU0elementtree_copyelement_obj#`iobase_seekable_docatan2.c#a0kwlist$972U4Tuple_typegethostbyaddr.c#a8kwlist$977#a@PySet_Type;dtoa.c#breduce_docU8nstackcdtoa.hUt64e&pystrtod.c+?(mbstreamwriter_methods+?hposix_link__doc__apystrtod.h+?pwd_getpwnam__doc__gettimeofday.c+@lisatty_doc+@gettrace_doc+A,csv_writerows_docXModule_type+Ainsert_doc+BPyGen_Type+Bbufferedreader_getsetXno_grouping+Ccount_reduce_doc+Ctupleobject.h.]x__big5_decmapZZipImportErrorLmatch_groups_doc0? intersection_docbzread.c0?|$0.400000000?readall_docpermutations_type<_fdinfo1?$0.401000001?PyModule_Typebzlib_stdio_private.hposixmodule.cmain9.s1@pjohabidx_jungseongposixmodule.h1@sys_clear_type_cache__doc__1@index_methods1ATsocket_methods[PyStructSequence_UnnamedField<free_list1B$0.3ff00000kdescrobject.cabs.c1Boid_title1Bclear_doc1Bbl_order%utfrune.cOdescrobject.h1C.string1GMonthNames$831GatypeENTITY$341\delitem_str$7321Hposix__exit__doc__1H\tab11Htab2\fpe_error$fputc.c\delitem_str$747\ global$3141ILSyntaxError_members1I$fefa39ef.3fe62e421I__cp950ext_decmapreadcert.c1Ku2johabidx_jungseong`listobject.cmd5block.s1Kposix_pathconf__doc__1LHPyNullImporter_Type?listobject.h\_PyIO_str_reset1M stringio_methods1M_PyExc_OverflowError1Nunicodedata_mirrored__doc__1O$0.400400001Orelease_doc1Pdivmod_doc1Pdump_doc1Sisdisjoint_doc1SH.string1s`.string1s$0.3fe400001sPyST_Type1tLdoc_crc321tposix_tcgetpgrp__doc__1t.string\mapping_list1uLposix_getpid__doc__1u|posix_umask__doc__mpveccmp.clibauth.a1uBZ2Decomp__doc__bzwrite.c1vPyWrapperDescr_Type1wxinvpi1wcontains_doc\Or_singleton\Py_DivisionWarningFlag1w$0.401200001wmath_cos_doc1w.stringcodecs.c\debug3~oid_md5WithRSAEncryption3Dict_fields3getfilesystemencoding_docRcodecs.htimefuncs.h3Exec_fields config-386.carraymodule.c3_mptwo3partition__doc__3xlsecfuncssymtablemodule.c3$0.404000003$0.403300003$0.402600003date_kws3$93f2ed0.40302755fmt.c3input_doc3\PyFieldNameIter_Type3 generationsjfmt.h3\rsplit__doc__3statvfs_result__doc__\PyExc_SyntaxWarning= prefix3expandtabs__doc__3|O_close__doc__udup.c3.string3 module_doc30math_atan2_docunicodename_db.h3compress_type\_PyIO_str_write3t.string\next_str$9443bufferedrwpair_getset3.string3 count__doc__3posix_getlogin__doc__3.string3Ptreebuilder_methods\dictcomp3KW_FIXED3dropwhile_type3|truncate_doc3Diobase_tell_doclibap.a3d__methods3MultibyteCodec_Decode__doc__3$enum_doc3alarm_docfpython.c3KW_EMPTY>utime.c\pending_lock3$0.404100003$0.40340000utime.hbzip2= acos_special_valuesttransmogrify.h3gaitabjgetgrgid.c\jisx0208_decmap3L.string3PySSL_Type3Xmlparsetype3drstrip__doc__3jisx0213_1_bmp_decmap3.string3.string3module_doc3Tamon3ampm3KW_IDREF\nextstr=pendingcallszconf.h3CAPI3listen_doc\UnpicklingError3oid_dnQualifier\Break_type3getprofile_doc34PySSL_RAND_add_doc3__gb2312_decmap_fdinfo.cstrftime.c\extension_registry3`weakref_getweakrefcount__doc__listen.c Python.h3math_gamma_doc=StructPwdType3apply_doc3 $0.404780006>$0.406180002mpvecsub.s_FAUTH.sCtmpfile.c6>ljust__doc__vsnprint.c^4numfree6>spamlist_getsets6>getter_docstrcoll.c6?arraytype_doc^8parser_errortas.s6Deval_doc6F .string/objimpl.h6]$36d28a98.411adc9c getcallerpc.s6]proxy_as_number_sock_ingetaddr.ctcp.h.fclose.c6^Unpicklertype^`.string9?x$6753134.c152db0f9?reversed_docunicodedata.c9?_PyExc_Warning_CONST_md4_name_obj9@readlines_doc_Num_type_Invert_typeadler32.c9A|module_methods_BitAnd_typedeflate.c9A_PyParser_TokenNames9Bt.string x509.hdeflate.h9N$count_doc_csv.c9Nhreduce_doc9P $bbb55516.40026bb1@bltinmodule.c|bdiff.c_len_str$7109Pspeedups_methods9PD$0.40d388009PLdialect_kws9Ptlistiter_methodssetjmp.h9Plittle2_encoding_assert.c=8xtime$7_len_str$796setjmp.s_string$170un.h9RBZ2Comp_methods`gb2312_decmap`unicode_space$214`IsNot_singleton9R4.string` string$187Hunicodedefs.h9_remove_doc9_time_getset9``sort_docGstringlib`Interactive_type9`jisx0213_emp_encmap9hkwlist$173=8shortbranch9hisspace__doc__strcpy.s9iLlong_info_descpathencode.c9i\staticmethod_doc`netdb_lock9k`issubclass_doc9lPcode_hash;lPrpartition__doc__`USub_singleton`_PyIO_str_readinto;mDlist_methods;ndequereviter_type;nmath_factorial_doc` format_cache$124`$module$133`(_PyIO_str_readline=9 private_mem`,PyExc_StopIteration;o0strip__doc__`0not_yet_string$305;p,$0.4072c000;p4bytearray_as_buffer;pLtable_b2a_base64;psend_doc;qdcall_tracing_doc`4UnaryOp_type;rT.string;spartition__doc__Qtypeobject.c;tmatch_getset;ureadinto_doc;uDabs_doc;u.stringstrncat.c`8PyDateTimeAPI;u.string` % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4ff44ff4gg45g g59g;g5Off5Pii5ff5jj55jj55jj5ll5ll6 jj6eff6fnn6vnn6f f7+ main@.frameargvargc0ta4.safe pqr  pqr  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 pqr  pqr4225 pqr  pqr552 pqr  pqr535e pqr pqr5 pqsm pqs56 pqs pqs68tuBtu6]tuktu6{tutu6tutu6 pqs pqs6&&6 pqs pqs6 pqr pqr6 pqr# pqr6 pqr= pqr7 pqr pqr8 pqrK pqr8, pqrv pqr82 pqr pqr8^ pqr pqr8p pqr pqr8 pqr pqr98 pqr pqr9V pqr pqr9 pqr) pqr:? pqr pqr:N pqr pqr; pqr pqr;, pqr pqr; pqr pqr< pqr pqr<= pqr pqr<} pqr pqr< pqr  pqr< pqr^ pqr< pqrz pqr= pqr2 pqr>getbe32.framec/putbe32.framecxihexdigit.frameoffpunhexlify .framehi istrdretlenparse_manifestP.frame,nlen filecur(flags$nodezerostartlen strfdictmfdictargstparse_dirstateh.frame,cpos@flen 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 pqv  pqv4ww45w w5M pqv  pqv5n55 pqv pqv56 pqv pqv6!!6a pqv pqv6gxx6lxx6xx6 pqv pqv6* *6 pqv pqv67 pqv pqv7##7 pqv pqv8& pqsm pqs8>8m pqs pqs8tuBtu8tuktu8tutu8tutu8 pqs pqs8&&9 pqs pqs96 pqv( pqv9K pqv@ pqv9 pqv pqv; pqv pqv;Lgetbe32.framecLFputbe32.framecxLlistdir_stat_st_dev.frameselfLlistdir_stat_st_mode.frameselfLlistdir_stat_st_nlink.frameselfLlistdir_stat_st_size.frameselfLlistdir_stat_st_mtime.frameselfLlistdir_stat_st_ctime.frameselfM listdir_stat_new .frametM*listdir_stat_dealloc.frameoMCentkind.frameMImakestat.frameststatM_listdir`.frameelem skipDstkeepstat kindHentlistLdirfullpathpathlenretpathPstatfilesP.frame4stD.safe istatscountnamesargsR,listdir<.framewantstatplen pathkwargsargsskipskipobjstatobjSinitosutil.frame pqy pqy  - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 pqy pqy4""5 pqy pqy55N pqy pqy5 pqsm pqs55 pqs pqs6!tuBtu6Ftuktu6dtutu6ktutu6 pqs pqs6&&6 pqs pqs6 pqy pqy6 pqyP pqy7< pqy pqy8HSagetbe32.framecSputbe32.framecxSlalloc .frameasizeT3lfree.frameaTYlsize.frameaTigather.frame offsetsrcddestcutUbdiscard.framesrcoffsetcutUcombine(.framebhc.safeaoffsetbWUdecode.frameltl.safeend datalenbinXycalcsize.framelenlXapply.framelastforig plenbuf lYfold(.frame.safelenblen bufferstartbinsendZpatches8.frame resultpatch$inleninlenbinstextargs\patchedsize@.frame endstart(data$binendpatchlen binorigargslastoutlen]2initmpatch.frame pqz  pqz  - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 pqz  pqz5C pqsm pqs5[5 pqs pqs5tuBtu5tuktu5tutu5tutu6 pqs pqs6&&6, pqs pqs6M pqz pqz6k pqz9 pqz6 pqz pqz7b]getbe32.framec]putbe32.framecx]_finddir.framepathpos^_addpath(.framevaldirsret keyposcpathpath__delpath .framedirs retkeypospath`dirs_fromdict$.framedirsskipcharvaluekeysource posadirs_fromiter.frame retdirsitemitersourcebdirs_init$.framedirsargsselfret skipcharsourcecdirs_addpath.frameselfpathargsdJdirs_delpath.frameselfpathargsddirs_contains .frameselfvalueddirs_dealloc.frameselfe dirs_iter.frameselfe6dirs_module_init.framemod pq{  pq{  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 pq{  pq{4""5 pq{  pq{55M pq{  pq{5 pqsm pqs55 pqs pqs6 tuBtu6Etuktu6ctutu6jtutu6 pqs pqs6&&6 pqs pqs6 pq{ pq{6 pq{H pq{7  pq{h pq{7$ pq{ pq{7gegetbe32.framecfputbe32.framecxfQ_fix_newline4.framehline szcblenbalena lshunkszhunkgfix_newline$.frame bahunkargsgaddlines\.frame8l0s1cxi$num(todoab a lenblenahunkfpargsj^testhunk8.framesaialen bstartbaargskinitdiffhelpers.frame pq|  pq|  - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 pq| pq|4""5 pq| pq|55N pq| pq|5O5 pq| pq|6  pqsm pqs6"6Q pqs pqs6ztuBtu6tuktu6tutu6tutu6 pqs pqs6&&6 pqs pqs7 pq| pq|8 pq| pq|8kgetbe32.frameclputbe32.framecxl 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 pq} pq}5D pqsm pqs5\5 pqs pqs5tuBtu5tuktu5tutu5tutu6 pqs pqs6&&6- pqs pqs6K pq} pq}6 pq} pq}6{getbe32.framec{putbe32.framecx|*b85prep.frame|nb85encode@.frame,.safeoutolenlentextargs(pad}b85decode@.frameoutolen,.safelentextargsinitbase85.frame ~ ~  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ~ ~4  45   55 G 5S ~ ~5Y ~ ~5 ~I ~6S ~  ~6] ~ ~6o spamlist_getstate .frameselfargs@spamlist_setstate.frameselfstateargsspamlist_specialmeth .framekwselfargsspamlist_init.framekwdsargsselfspamlist_state_get.frameself)spamdict_getstate .frameselfargs_spamdict_setstate.frameselfstateargsspamdict_init.framekwdsargsselfspam_bench0.frame.safet0nameobjargsninitxxsubtype.framem ~ ~  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ~ ~59 ^b ^5D ~ ~5E ] ]5n ~ ~5o  5r  5  5 ) 5  7 ~ ~7  7 & 7 + 7 M 8 ~ ~89 ~/ ~8asymtable_symtable0.framesttstartstrfilename strargsinit_symtable.framem ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4  45   58 G 5V ~ ~5W  5 ~ ~5  5 ~ ~5((5 ~  ~6 ~ ~6& ~? ~6 ~ ~7 ~ ~7; ~U ~7l ~ ~7 ~  ~7 ~ ~7 ~ ~7 ~ ~7 ~% ~7 ~, ~7 ~2 ~8 ~Y ~8N ~ ~8^ ~ ~8 ~2 ~8 ~< ~8 ~Q ~9d ~ ~9p ~ ~9 ~ ~9 ~ ~9 ~% ~9 ~+ ~9 ~@ ~9 ~M ~9 ~X ~: ~u ~:B ~ ~:T ~ ~:zipimporter_initH.frameselffiles4statbuf prefixbufpathargskwdsVzipimporter_traverse.framevisitargobjzipimporter_dealloc.frameself1zipimporter_repr.framebufprefixarchiveself4get_subname.framefullname`make_filename.framepathnamelenprefixget_module_info$.framezso lenpath.safeselfsubnamefullnamezipimporter_find_module$.frame fullnameargspathselfobjzipimporter_load_moduleL.frame0err pkgpath$fullpath4.safe,subname(prefixdict modcodemodpathispackagefullnameargsselfobjzipimporter_get_filename(.framemodpathispackage fullnameargsselfobjzipimporter_is_package.framefullnameargsselfobj8zipimporter_get_data$.frame toc_entry.safelenpathargsselfobjMzipimporter_get_code.framefullnameargsselfobjzipimporter_get_source0.frametoc_entrypath .safesubnamemi fullnameargsselfobjPget_long.framebuf}read_directory.framexerrtt8iTpNnamefile_offset|.safe,name_sizefile_sizedata_sizecrc date$time compress@countDlengthfiles(header_offsetparc_offset0header_sizejendof_central_dir4header_positionfpIpatharchiveget_decompress_func.framedecompresszlibbget_datal.frame decompressbytes_readerrbufraw_dataD.safefparchive@crc % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ~ ~4 ~  ~4 ~  ~5 ~@ ~59 ~b ~5Hweakref_getweakrefcount.frame .safeobject weakref_getweakrefs.frame countlistobjectweakref_proxy(.frameobjectargs resultcallbackinit_weakref.framem ~% ~  - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 ~( ~4 ~2 ~4 ~A ~5 ~V ~5 ~x ~6 ~d ~6c ~ ~7] ~ ~7 ~ ~8 ~ ~8 ~ ~8codec_register.framesearch_functioncodec_lookup.frameencodingargs-codec_encode$.frame vargserrorsencodingcodec_decode$.frame vargserrorsencoding#codec_tuple.framevlenunicodetescape_decode(.frame.safe sizedataargserrorsescape_encode(.framelenconsumedstrargserrorsunicode_internal_decode$.frame.safesize dataobjargserrorsutf_7_decode\.frameDdecoded@consumed4pbufargs  LRS]` ay z5$ " ).Fk  + ' !! )  ""&""Z + \##  6## J 8 K$$ ] 9 _ % %w   % %&& % % % %n %; %s"" %@ %'' %J %(( %M %(($<(( %Z %)) %u %*** * % % % %++ % % G  , ,  , , , , , N  - -H % %_ -3 - -s - O  .j . . . . . . .4 . . . . . . . . . .  . .? . .H . .  .= . .F . .P .% .^ .7 . .H . .N Q Q / / -s - /a / / /  / / / / / /B /0 /e /^ /k R m 0 0 0 0 0" 0 T  1 1 18 122 ( 1 1 0 1 1!1 1 1!? 1 1!^ 1 1!l 1 1!r 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"> 1 1"E 1' 1"M 10 1"R 15 1"Y 1I 1"e 1i 1"l 1q 1"t 1z 1"y 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#' 1x 1#1 1 1#: 1 1#I 1 1#Q 1 1#Z 1 1#c 1 1#k 1 1#v 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $  3 3$ 3  3$4 3< 3$< 3F 3$@ 3J 3$I W $J 4 4$[ 4 4$o X $p 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6% 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6%% 6 6%. Z %0 7 7%T 7' 7%h 7; 7%q \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&% 9 9&* 9 9&2 9 9&< 9 9&E _ &F : :&^ :5 :&h :@ :&t ` &u ; ;& a & < <& b & = =&& = =& =2 =& c ' > >' >  >'  >& >'& d ', ? ?': ?& ?'A ?- ?'Z e 'q @7 @'x @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(( h (4 C  C(J C# C(Q C* C(j CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)# FK F)- l ). G G)@ G G)L G G)g G; G)k G@ G)q GG G)v GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*$ K K*= q *> L L*[ r *\ M M*t s *u N N* t * O O* O, O* u * P P+  P P+ v + Q Q+# Q Q+( Q Q+/ Q Q+3 Q% Q+E Q9 Q+V QP Q+] w +j R R+q R/ R+x R= R+ RM R+ R[ R+ R R+ R R+ y + S S,? Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S- z -  T T-a TC T-u T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-. V V.5 Vm V.F V V.N  .Z W  W. W5 W. We W. W W/  / X X/ X X/' X% X/6 X5 X/K Xt X/_ X X/q  /r Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0/ \- \07 \9 \0= \E \0C \R \0J \_ \0V \p \0h \ \0m \ \0r \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1( \ \1- \ \13 \ \18 \ \1= \ \1B \ \1G \  \1L \ \1Q \ \1V \) \1[ \3 \1f \T \1k \[ \1p \f \1w \r \1| \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2  \g \2 \o \2 \v \2 \} \20 \ \25 \ \29 \ \2A \ \2K \ \2P \ \2W \ \2\ \ \2c \ \2h \ \2u \ \2{ \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3  ^Y ^3 ^b ^3 ] ]3A  3B _ _3\  3^ ` `3m ` `3}  3~ a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4M d d4N4i d d4j''4 d d4 d d4  4 ~- ~4  45  5? G 5] ~. ~5a ~  ~5h ~  ~5 ~ ~6 ~0 ~6226H ~2 ~6 ~ ~6 ~ ~8r ~O ~9 ~ ~9" ~ ~9H ~% ~9x ~U ~9 ~ ~9 ~& ~: ~D ~:! ~U ~:' ~] ~:5 ~k ~:@ ~v ~:Z ~ ~: ~ ~: ~ ~: ~ ~: ~ ~: ~ ~: ~ ~: ~% ~: ~1 ~; ~B ~; ~T ~; ~Y ~;? ~{ ~;T ~ ~;W ~ ~;u ~ ~; ~ ~; ~ ~; ~ ~; ~ ~; ~ ~; ~ ~; ~ ~; ~$ ~; ~1 ~<  ~I ~<% ~a ~<= ~y ~ 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4  5 % 5  ~ ~5  ~ ~55E ~  ~5U ~ ~5W5^55 ~  ~5 ~ ~5 ~+ ~5 ~f ~6  ~ ~6! ~ ~6YOsets.framevivalPmkpwent.framepvsetIndexQMpwd_getpwuid.frameuidargsRpwd_getpwnam.framenameargsRinitpwd.framem ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4 ~ ~5 ~6 ~5 ~J ~7S9_inscode.framededv codeunameSiniterrno$.frame ded ~ ~  . , /  0  :N   k ( s     a   9  GMNX[ \t u5 " $)Af  + ' !! ) "" !""U + W##  1## E 8 F$$ X 9 Z % %r   % %&& % % % %i %; %n"" %@ %'' %J %(( %M %((7(( %Z %)) %u %*** * % % % %++ % % G  , ,  ' , , , , N  - -C % %Z -3 - -s - O  .j . . . . . . ./ . . . . . . . . . . . .: . .C . . .= .  .F . .P .  .^ .2 . .C . .I Q L / / -s - /a / / / / / / / / /= /0 /` /^ /f R h 0 0 0 0 0" 0 T  1 1 18 122 # 1 1 + 1 1!, 1 1!: 1 1!Y 1 1!g 1 1!m 1 1!} 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"9 1 1"@ 1' 1"H 10 1"M 15 1"T 1I 1"` 1i 1"g 1q 1"o 1z 1"t 1 1"{ 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#" 1x 1#, 1 1#5 1 1#D 1 1#L 1 1#U 1 1#^ 1 1#f 1 1#q 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$/ 3< 3$7 3F 3$; 3J 3$D W $E 4 4$V 4 4$j X $k 5 5$z 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%  6 6%) Z %+ 7 7%O 7' 7%c 7; 7%l \ %| 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9&  9 9&% 9 9&- 9 9&7 9 9&@ _ &A : :&Y :5 :&c :@ :&o ` &p ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'! d '' ? ?'5 ?& ?'< ?- ?'U e 'l @7 @'s @E @'{ @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(# h (/ C  C(E C# C(L C* C(e CF C(~ i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)( l )) G G); G G)G G G)b G; G)f G@ G)l GG G)q GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K* K K*8 q *9 L L*V r *W M M*o s *p N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+# Q Q+* Q Q+. Q% Q+@ Q9 Q+Q QP Q+X w +e R R+l R/ R+s R= R+| RM R+ R[ R+ R R+ R R+ y + S S,: Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-\ TC T-p T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.0 Vm V.A V V.I  .U W  W.} W5 W. We W. W W.  . X X/ X X/" X% X/1 X5 X/F Xt X/Z X X/l  /m Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0* \- \02 \9 \08 \E \0> \R \0E \_ \0Q \p \0c \ \0h \ \0m \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1( \ \1. \ \13 \ \18 \ \1= \ \1B \  \1G \ \1L \ \1Q \) \1V \3 \1a \T \1f \[ \1k \f \1r \r \1w \{ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2+ \ \20 \ \24 \ \2< \ \2F \ \2K \ \2R \ \2W \ \2^ \ \2c \ \2p \ \2v \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3  ^b ^3 ] ]3<  3= _ _3W  3Y ` `3h ` `3x  3y a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4H d d4I4d d d4e''4 d d4 d d4  4 ~ ~4 Z Z4 ~ ~5ee5X ~ ~5f* *5 ~ ~5((5 ~L ~56 ~O ~6  6@ ~P ~6T ~f ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~7/ ~T ~7N ~{ ~7 ~ ~7 ~ ~7 ~: ~91 ~ ~9? ~ ~9N ~ ~9 ~ ~9 ~ ~9^qsignal_default_int_handler.frame^checksignals_witharg.frame^trip_signal.framesig_num^signal_handler .framesig_numsave_errno_)signal_alarm.frame.safetargs_tsignal_pause .frame_save_signal_signal$.frameobjsig_numargsasignal_getsignal.framesig_numargsasignal_set_wakeup_fd8.frame buf$fdargsb3PySignal_SetWakeupFd.framefdbVinitsignal,.framei xdkIfinisignal.framefuncilPyErr_CheckSignals .framearglisti resultfmPyErr_SetInterrupt.framenPyOS_InitInterrupts .framen5PyOS_FiniInterrupts.framen;PyOS_InterruptOccurred.frameng_clear_pending_signals.framenPyOS_AfterFork.frame ~ ~  - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 ~ ~4  45  59 G 5W ~ ~5_  5 ~ ~5 ~D ~5 ~[ ~5 ~k ~6] G 6~ ~ ~6 ~ ~6 ~4 ~7  ~j ~7C ~ ~7e ~ ~7 ~B ~8a ~ ~8k ~ ~8v ~ ~8 ~ ~8 ~  ~8 ~ ~8 ~Q ~8 ~s ~8 ~ ~9 nlock_dealloc .frameselfo/lock_PyThread_acquire_lock.frameself_saveargsiolock_PyThread_release_lock .frameselfplock_locked_lock .frameselfpVnewlockobject.frameselfplocaldummy_dealloc.frameselfp_local_create_dummy(.frameselftdictdummy wrldictrlocal_new.framewrselfkwtypeargstslocal_traverse.framevisitargselftlocal_clear.frametstateselfvQlocal_dealloc.frameselfv_ldict.frameldictselftdictwlocal_setattro.framevnameldictselfx+local_getattro.framenameldictselfx_localdummy_destroyed.framedummyweakrefselfobjlocalweakrefyt_bootstrap,.frametbvalueexctstatebootboot_raw{thread_PyThread_start_new_thread4.framebootargsfuncfargs keyw}thread_PyThread_exit_thread.frame}thread_PyThread_interrupt_main.frame}thread_PyThread_allocate_lock.frame~thread_get_ident.frame~:thread__count.frame~Othread_stack_size.frameold_sizeargsnew_sizeinitthread .framedm ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4  4  4 % 5 . 5 < 52 ~ ~5@ ~% ~5_ ~G ~5c ~M ~5t ~ ~5 ~ ~5 ~ ~5 ~0 ~5 ~F ~5 ~_ ~5 ~n ~6 ~z ~6  ~ ~6% ~ ~6* ~ ~6- ~ ~64 ~ ~6; ~ ~6B ~ ~6Q ~ ~6[ ~ ~6z ~ ~6 ~! ~6 ~? ~6 ~X ~6 ~l ~6 ~~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~7 ~ ~7) ~  ~7B ~$ ~7` ~E ~7 ~g ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~8 ~ ~8 ~ ~8 ~ ~8( ~% ~83 ~2 ~8> ~? ~8G ~M ~8d ~w ~8q ~ ~8z ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~9 ~5 ~9! ~T ~9N ~ ~9y ~ ~9 ~ ~9ngc_list_init.framelistxgc_list_is_empty.framelistgc_list_remove.framenodegc_list_move.framenodelistgc_list_merge .frametofromgc_list_size .framelist*append_objects.framegcgc_listpy_listzupdate_refs.framecontainersvisit_decref .frameopsubtract_refs.framegccontainers-visit_reachable.framereachablegcopmove_unreachable .frameunreachablenext opgcyoungChas_finalizer .frameopuntrack_dicts.framenextheadmove_finalizers.framefinalizersgcnextunreachableQvisit_move.frametolistgcopmove_finalizer_reachable.framegcfinalizershandle_weakrefs8.frameold(callbackopgc wr$wrlistnextunreachablewrcb_to_call num_freedndebug_instance.framemsginstdebug_cycle.frameopmsg&handle_finalizers.frameoldopgcfinalizersdelete_garbage.frameold opgccollectableclear_freelists.frameget_time.frame fresultJcollectP.frame@t20gc,finalizers unreachableyoungoldD.safei8t1 nmgenerationHcollect_generations.framegc_enable.framegc_disable.framegc_isenabled.framegc_collect .framekwsargsgenarggc_set_debug.frameargsgc_get_debug .framegc_set_thresh.frameargs\gc_get_thresh.framegc_get_count.framereferrersvisit.frameobjsobjgc_referrers_for.frameobjresultlistobjsgclistxgc_get_referrers.frameresultiargsreferentsvisit .frameobjlist$gc_get_referents .frameobjiargsresultgc_get_objects.frameiresultqgc_is_tracked .frameobjinitgc.framemPyGC_Collect .frame_PyGC_Dump.framegPyObject_GC_Track .framegop/_PyObject_GC_Track.frameopBPyObject_GC_UnTrack.frameopv_PyObject_GC_UnTrack.frameop_PyObject_GC_Malloc.framegbasicsize._PyObject_GC_New .frametpZ_PyObject_GC_NewVar.framenitemstp_PyObject_GC_Resize.framenitemsopPyObject_GC_Del .framegop?_PyObject_GC_Del.frameop ~ ~  + , ,  -  7K   h ( p  ~   a   6  DJKUX Yq r5 " !&>c  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 ~ ~4  5  ~ ~5{ ^b ^5 ~ ~5 [A [5 ~ ~5  5 ~! ~6  ~2 ~6 ~E ~6 ~R ~6 ~\ ~6 ~f ~6  ~l ~6" ~r ~6 ~ ~6 ~  ~6 ~ ~6 ~ ~6 ~+ ~6 ~8 ~7 ~a ~7 ~ ~7 ~7 ~8  ~g ~80 ~ ~8F ~ ~8Q ~ ~8]Rusage.frameprogramfexitcodeQRunStartupFile .frame save_errnocffpstartupRunModule .frameresult runargsset_argv0modulerunmodulerunpyRunMainFromImporter.frameargv0filenameimporterPy_Mainx.frameXsbsts(stdin_is_interactive 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 ~  ~4  45  59 G 5W ~  ~5Z ~ ~5q ~ ~5x ~& ~5| ~* ~5 ~8 ~5 ~@ ~5 ~] ~5 ~ ~56" ~ ~61* *6z ~ ~6 ~_ ~6 ~ ~6 ~ ~6 ~ ~7 ~ ~8  ~4 ~8 ~9 ~89 ~e ~8R ~ ~8h ~ ~8blockingioerror_init(.framekwds baseargsargsselfwrittenstrerrormyerrnoio_open.framelline_bufferingpisattyresxmodeobjtrawarawmode@irepr$filekwdsargswrapper|buffer\universalXbinaryTtextPupdatingLappendingHwritingDreading 6% 6E 6%  6g 6% 6v 6% 6~ 6%  6 6%) Z %+ 7 7%O 7' 7%c 7; 7%l \ %| 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9&  9 9&% 9 9&- 9 9&7 9 9&@ _ &A : :&Y :5 :&c :@ :&o ` &p ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'! d '' ? ?'5 ?& ?'< ?- ?'U e 'l @7 @'s @E @'{ @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(# h (/ C  C(E C# C(L C* C(e CF C(~ i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)( l )) G G); G G)G G G)b G; G)f G@ G)l GG G)q GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K* K K*8 q *9 L L*V r *W M M*o s *p N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+# Q Q+* Q Q+. Q% Q+@ Q9 Q+Q QP Q+X w +e R R+l R/ R+s R= R+| RM R+ R[ R+ R R+ R R+ y + S S,: Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-\ TC T-p T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.0 Vm V.A V V.I  .U W  W.} W5 W. We W. W W.  . X X/ X X/" X% X/1 X5 X/F Xt X/Z X X/l  /m Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0* \- \02 \9 \08 \E \0> \R \0E \_ \0Q \p \0c \ \0h \ \0m \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1( \ \1. \ \13 \ \18 \ \1= \ \1B \  \1G \ \1L \ \1Q \) \1V \3 \1a \T \1f \[ \1k \f \1r \r \1w \{ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2+ \ \20 \ \24 \ \2< \ \2F \ \2K \ \2R \ \2W \ \2^ \ \2c \ \2p \ \2v \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3  ^b ^3 ] ]3<  3= _ _3W  3Y ` `3h ` `3x  3y a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4H d d4I4d d d4e''4 d d4 d d4  4 ~  ~4  45  5: G 5X ~ ~5[ ~ ~5r ~ ~5y ~& ~5} ~* ~5 ~8 ~5 ~@ ~5 ~] ~5 ~ ~6 ~? ~6 ~V ~6 ~_ ~6# ~k ~6. ~x ~6< ~ ~6D ~ ~6a ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~1 ~6 ~M ~7 ~j ~7? ~ ~7H ~ ~7U ~ ~7t ~ ~7 ~ ~7 ~G ~7 ~Z ~8 ~ ~8 ~ ~8 ~ ~8 ~. ~8 ~? ~9iobase_unsupported .framemessage:iobase_seek.frameNiobase_tell.frameselfiobase_truncate.frameiobase_flush .frameselfiobase_closed.frameclosedresself7iobase_closed_get.frame.safeselfc_PyIOBase_check_closed .frameargsselfiobase_close.frameresself\_PyIOBase_finalize,.framerestb vtpis_zombieclosedselfœiobase_traverse.framevisitargselfiobase_clear .frameselfiobase_dealloc .frameselfiobase_seekable.frame_PyIOBase_check_seekable.frameresargsselfiiobase_readable.frameu_PyIOBase_check_readable.frameresargsselfiobase_writable.frame_PyIOBase_check_writable.frameresargsselfŹiobase_enter .frameselfiobase_exit.frameself iobase_fileno.frame!iobase_isatty .frameselfSiobase_readline<.frameresultold_sizeb readaheadnreadahead bufferselfargshas_peeklimitiobase_iter .frameselfiobase_iternext.framelineselfsiobase_readlines$.framelineself resultargslengthhintiobase_writelines$.frame reslineiterselflinesargs͚rawiobase_read .frame.safe resbselfargsn+rawiobase_readall$.frame resultrdataselfchunks ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~45 ~ ~5* *5h ~  ~5kww5s5w w5 ~  ~55 ~ ~5 ~ ~6  ~ ~6 ~& ~6 ~* ~6 ~8 ~6# ~@ ~6: ~] ~6 ~ ~6 ~ ~7 ~k ~8o ~ ~8w ~  ~9 ~< ~:' ~ ~:* ~ ~:- ~ ~:0 ~ ~:3 ~ ~:6 ~ ~:: ~ ~:> ~ ~:A ~ ~:D ~ ~:G ~ ~:J ~ ~:M ~ ~:P ~ ~:_PyFileIO_closed.frameself+internal_close.frameerr_save fdsave_errnoselfѶfileio_close.frameself%fileio_new.frametypeҨdircheck,.framenameobj bufselfcheck_fd<.frame$exc buffdӱfileio_init\.frame<_saves % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ~ ~4  45   55 G 5S ~ ~5V ~ ~5m ~ ~5t ~& ~5x ~* ~5 ~8 ~5 ~@ ~5 ~] ~5 ~ ~5 ~ ~6 ~: ~6! ~? ~6( ~F ~6P ~n ~6_ ~ ~6e ~ ~6} ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~' ~7 ~T ~7U ~ ~7u ~ ~7 ~ ~7 ~ ~7 ~/ ~8 ~K ~8" ~l ~8/ ~ ~8T ~ ~8\ ~ ~8a ~ ~8h ~ ~8 ~ ~8 ~ ~9  ~d ~93xget_line.frameoutputselfresize_buffer.framealloc .safesizeselfwrite_bytes.framebyteslenselfZbytesio_get_closed.frameself~return_not_closed .frameselfbytesio_flush .frameselfbytesio_getvalue .frameself6bytesio_isatty .frameselfqbytesio_tell .frameselfbytesio_read .framesizeargsselfargbytesio_read1.frameresargselfn.bytesio_readline .frame outputsizeargsselfargQbytesio_readlines,.frameline noutputresultsizemaxsizeargsselfarg,bytesio_readintoL.frame8len4bufargsselfbytesio_truncate.framesizeargsselfarg-bytesio_iternext.framenextselfbytesio_seek .frameposposobjargsself modebytesio_writeL.frame8bufobjself 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 ~  ~4  45  59 G 5W ~  ~5X  5 ~ ~5 ~ ~5 ~ ~5 ~& ~5 ~* ~5 ~8 ~5 ~@ ~5 ~] ~6 ~ ~6  ~" ~6L ~Q ~6U ~i ~6^ ~v ~6g ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~7 ~k ~7O ~ ~7 ~T ~8  ~c ~8y ~ ~8 ~ ~8 ~ ~9 ~z ~9V ~ ~9 ~Q ~:| ~ ~: ~ ~: ~ ~;) ~ ~;; ~ ~;] ~ ~;w ~ ~; ~ ~< ~{ ~< ~ ~r ~ ~>u ~  ~>bufferediobase_readintoP.frame8lenbufferedrwpair_init0.frameselfwriterreaderargsmax_buffer_size buffer_size?bufferedrwpair_traverse.framevisitargself@,bufferedrwpair_clear .frameself@bufferedrwpair_dealloc .frameselfAw_forward_call.frameretargsfuncnameselfAbufferedrwpair_read.frameargsselfBbufferedrwpair_peek.frameargsselfB7bufferedrwpair_read1.frameargsselfB^bufferedrwpair_readinto.frameargsselfBbufferedrwpair_write.frameargsselfBbufferedrwpair_flush.frameargsselfBbufferedrwpair_readable.frameargsselfBbufferedrwpair_writable.frameargsselfC!bufferedrwpair_close.frameargsselfCbufferedrwpair_isatty.frameargsselfCbufferedrwpair_closed_get .frameselfD 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 ~  ~4  45  59 G 5W ~  ~5Z ~ ~5 ~M ~5 ~V ~5 ~_ ~5 ~ ~5 ~  ~5 ~  ~5 ~) ~6} ~ ~6 ~ ~7 ~ ~8 ~ ~9& ~m ~9 ~ ~: ~ ~; ~ ~<  ~U ~< ~ ~<F%make_tuple.framelenvobjectFinternal_error_callback .frameerrorsG)call_error_callback.frame rargsexccberrorsGcodecctx_errors_get .frameselfH$codecctx_errors_set.framecbselfvalueHexpand_encodebuffer.frameorgposbufesizeI_expand_decodebuffer.frameorgposbufesizeImultibytecodec_encerrorT.framenewposretstrsize(uraw endcodecstate,inbuf(replchar errorsesize$reasonretstrretobjbufeNmultibytecodec_decerror<.framenewpos retunisizeretunicodec endesizereasonretobjbufe errorsRmultibytecodec_encodeL.frame$rerrorsstatecodecdatabufflags datalenUyMultibyteCodec_Encode@.framerstateerrorcbself$datalen dataucvtargkwargsargs errorsWMultibyteCodec_Decode.framestateself$buf|.safe(errorcbhdatalen`data\pdatakwargsargsderrors[multibytecodec_dealloc.frameself[encoder_encode_stateful8.framefinalinbuf_end inbufdatalenorigpendingucvtinbuf_tmprctxunistr^decoder_append_pending.framenpendingsctxbuf_=decoder_prepare_buffer .framebufsizedata_decoder_feed_buffer(.framebufctx`Wmbiencoder_encode$.frameselfdatakwargsargsfinal`mbiencoder_reset .frameselfambiencoder_new$.framecodecselftypekwdsargs errorsbmbiencoder_init.framebmbiencoder_traverse.framevisitargselfbmbiencoder_dealloc.frameselfc8mbidecoder_decode.frame\wsizedsizehorigpendingbuf dataselfXpdatakwargsargslfinal$wdatafzmbidecoder_reset .frameselffmbidecoder_new$.framecodecselftypekwdsargs errorshJmbidecoder_init.framehMmbidecoder_traverse.framevisitargselfhmbidecoder_dealloc.frameselfhmbstreamreader_ireadL.frame(finalsize$rsize4ctrdata0ctr,endoffile cresmethodbufsizehintselflmbstreamreader_read .frameselfargssizeobjmmbstreamreader_readline .frameselfargssizeobjnOmbstreamreader_readlines(.frame srrselfargssizehintobjoUmbstreamreader_reset .frameselfombstreamreader_new,.frame codecselftypestreamkwdsargserrorsq:mbstreamreader_init.frameq=mbstreamreader_traverse.framevisitargselfqmbstreamreader_dealloc.frameselfr3mbstreamwriter_iwrite.framewrstrunistrselfrmbstreamwriter_write .framestrobjselfsmbstreamwriter_writelines.frame rstrobjselfilinessmbstreamwriter_reset(.framepwrtpendingselftmbstreamwriter_new,.frame codecselftypestreamkwdsargserrorsv7mbstreamwriter_init.framev:mbstreamwriter_traverse.framevisitargselfvmbstreamwriter_dealloc.frameselfw0__create_codec.framecodecargwinit_multibytecodec4.frameimtypelist ~ ~ ~ ~  4 , 5  6  @T   q ( y     a   ?  MST^a bz {5% " */Gl  + ' !! )  ""'""[ + ]##   7## K 8 L$$ ^ 9 ` % %x   % %&&  % % % %o %; %t"" %@ %'' %J %(( %M % ((%=(( %Z %)) %u %*** * % % % %++ % % G  , ,  - , , , , N  - -I % %` -3 - -s - O  .j . . . . .  . .5 . . . . . . . . . . . .@ . .I . .  .= . .F . .P .& .^ .8 . .I . .O Q R / / -s - /a / / /  / / / / / /C /0 /f /^ /l R n 0 0 0 0 0" 0 T  1 1 18 122 ) 1 1 1 1 1!2 1 1!@ 1 1!_ 1 1!m 1 1!s 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"? 1 1"F 1' 1"N 10 1"S 15 1"Z 1I 1"f 1i 1"m 1q 1"u 1z 1"z 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#( 1x 1#2 1 1#; 1 1#J 1 1#R 1 1#[ 1 1#d 1 1#l 1 1#w 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $  3 3$ 3  3$5 3< 3$= 3F 3$A 3J 3$J W $K 4 4$\ 4 4$p X $q 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6% 6> 6% 6E 6% 6g 6% 6v 6%  6~ 6%& 6 6%/ Z %1 7 7%U 7' 7%i 7; 7%r \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9& 9 9& 9 9&  9 9&& 9 9&+ 9 9&3 9 9&= 9 9&F _ &G : :&_ :5 :&i :@ :&u ` &v ; ;& a & < <& b & = =&& = =& =2 =& c ' > >' >  >' >& >'' d '- ? ?'; ?& ?'B ?- ?'[ e 'r @7 @'y @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B() h (5 C  C(K C# C(R C* C(k CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)$ FK F). l )/ G G)A G G)M G G)h G; G)l G@ G)r GG G)w GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*% K K*> q *? L L*\ r *] M M*u s *v N N* t * O O* O, O* u * P P+  P P+ v + Q Q+$ Q Q+) Q Q+0 Q Q+4 Q% Q+F Q9 Q+W QP Q+^ w +k R R+r R/ R+y R= R+ RM R+ R[ R+ R R+ R R+ y + S S,@ Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S- z -! T T-b TC T-v T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-. V V.6 Vm V.G V V.O  .[ W  W. W5 W. We W. W W/  / X X/ X X/( X% X/7 X5 X/L Xt X/` X X/r  /s Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \00 \- \08 \9 \0> \E \0D \R \0K \_ \0W \p \0i \ \0n \ \0s \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1. \ \14 \ \19 \ \1> \ \1C \ \1H \  \1M \ \1R \ \1W \) \1\ \3 \1g \T \1l \[ \1q \f \1x \r \1} \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2  \g \2 \o \2 \v \2 \} \21 \ \26 \ \2: \ \2B \ \2L \ \2Q \ \2X \ \2] \ \2d \ \2i \ \2v \ \2| \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3  ^Y ^3 ^b ^3 ] ]3B  3C _ _3]  3_ ` `3n ` `3~  3 a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4N d d4O4j d d4k''4 d d4 d d4  4 ~  ~4 ~ ~5/ ~M ~56 ~V ~5= ~_ ~5^ ~ ~5j ~  ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~@ ~  ~A+ ~D ~Alxgetmultibytecodec.framemodygetcodec$.framercodecobjcodecenc cofuncencodingz7register_maps.framemodule .safehmhname{big5_encode .frame inleftoutbufoutleftinbuf|big5_decode.frameoutleft inleftinbufoutbuf}cp950_encode .frameinbuf inleftoutbufoutleft~cp950_decode.frameoutleft inleftinbufoutbuf(init_codecs_tw.frame ~ ~ ~ ~  4 , 5  6  @T   q ( y     a   ?  MST^a bz {5% " */Gl  + ' !! )  ""'""[ + ]##   7## K 8 L$$ ^ 9 ` % %x   % %&&  % % % %o %; %t"" %@ %'' %J %(( %M % ((%=(( %Z %)) %u %*** * % % % %++ % % G  , ,  - , , , , N  - -I % %` -3 - -s - O  .j . . . . .  . .5 . . . . . . . . . . . .@ . .I . .  .= . .F . .P .& .^ .8 . .I . .O Q R / / -s - /a / / /  / / / / / /C /0 /f /^ /l R n 0 0 0 0 0" 0 T  1 1 18 122 ) 1 1 1 1 1!2 1 1!@ 1 1!_ 1 1!m 1 1!s 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"? 1 1"F 1' 1"N 10 1"S 15 1"Z 1I 1"f 1i 1"m 1q 1"u 1z 1"z 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#( 1x 1#2 1 1#; 1 1#J 1 1#R 1 1#[ 1 1#d 1 1#l 1 1#w 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $  3 3$ 3  3$5 3< 3$= 3F 3$A 3J 3$J W $K 4 4$\ 4 4$p X $q 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6% 6> 6% 6E 6% 6g 6% 6v 6%  6~ 6%& 6 6%/ Z %1 7 7%U 7' 7%i 7; 7%r \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9& 9 9& 9 9&  9 9&& 9 9&+ 9 9&3 9 9&= 9 9&F _ &G : :&_ :5 :&i :@ :&u ` &v ; ;& a & < <& b & = =&& = =& =2 =& c ' > >' >  >' >& >'' d '- ? ?'; ?& ?'B ?- ?'[ e 'r @7 @'y @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B() h (5 C  C(K C# C(R C* C(k CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)$ FK F). l )/ G G)A G G)M G G)h G; G)l G@ G)r GG G)w GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*% K K*> q *? L L*\ r *] M M*u s *v N N* t * O O* O, O* u * P P+  P P+ v + Q Q+$ Q Q+) Q Q+0 Q Q+4 Q% Q+F Q9 Q+W QP Q+^ w +k R R+r R/ R+y R= R+ RM R+ R[ R+ R R+ R R+ y + S S,@ Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S- z -! T T-b TC T-v T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-. V V.6 Vm V.G V V.O  .[ W  W. W5 W. We W. W W/  / X X/ X X/( X% X/7 X5 X/L Xt X/` X X/r  /s Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \00 \- \08 \9 \0> \E \0D \R \0K \_ \0W \p \0i \ \0n \ \0s \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1. \ \14 \ \19 \ \1> \ \1C \ \1H \  \1M \ \1R \ \1W \) \1\ \3 \1g \T \1l \[ \1q \f \1x \r \1} \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2  \g \2 \o \2 \v \2 \} \21 \ \26 \ \2: \ \2B \ \2L \ \2Q \ \2X \ \2] \ \2d \ \2i \ \2v \ \2| \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3  ^Y ^3 ^b ^3 ] ]3B  3C _ _3]  3_ ` `3n ` `3~  3 a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4N d d4O4j d d4k''4 d d4 d d4  4 ~  ~4 ~ ~5/ ~M ~56 ~V ~5= ~_ ~5^ ~ ~5j ~  ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~C_ ~  ~C ~< ~C ~E ~C ~ ~D. ~ ~D ~ ~D ~ ~D ~ ~D ~ ~Ekgetmultibytecodec.framemodgetcodec$.framercodecobjcodecenc cofuncencodingregister_maps.framemodule .safehmhnameeuc_kr_encode.frame.safeinbuf inleftoutbufoutlefteuc_kr_decode .framejungoutleft inleftinbufoutbufPcp949_encode .frame inleftoutbufoutleftinbufcp949_decode.frameoutleft inleftinbufoutbuf6johab_encode.frame.safeinbuf inleftoutbufoutleftjohab_decode .framec_jongc_jungc_chooutleft inleftoutbufinbufXinit_codecs_kr.frame ~ ~  ~ ~  7 , 8  9  CW   t ( |     a   B  PVWad e} ~5( " -2Jo  + ' !!  )  ""*""^ + `##   :## N 8 O$$ a 9 c % %{   % %&&  % %" % %r %; %w"" %@ %'' %J % ((" %M %#(((@(( %Z %)) %u %*** * % % % %++ % % G  , ,  0 , , , , N  - -L % %c -3 - -s - O  .j . . . . .  . .8 . . . . . . . .  . . . .C . .L . . .= . .F . .P .) .^ .; . .L . .R Q U / / -s - /a / / / / / / / / /F /0 /i /^ /o R q 0 0 0 0 0" 0 T  1 1 18 122 , 1 1 4 1 1!5 1 1!C 1 1!b 1 1!p 1 1!v 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1" 1 1"B 1 1"I 1' 1"Q 10 1"V 15 1"] 1I 1"i 1i 1"p 1q 1"x 1z 1"} 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1#! 1k 1#+ 1x 1#5 1 1#> 1 1#M 1 1#U 1 1#^ 1 1#g 1 1#o 1 1#z 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$  V $ 3 3$  3  3$8 3< 3$@ 3F 3$D 3J 3$M W $N 4 4$_ 4 4$s X $t 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6% 67 6% 6> 6%  6E 6% 6g 6% 6v 6%# 6~ 6%) 6 6%2 Z %4 7 7%X 7' 7%l 7; 7%u \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9& 9 9& 9 9&# 9 9&) 9 9&. 9 9&6 9 9&@ 9 9&I _ &J : :&b :5 :&l :@ :&x ` &y ; ;& a & < <& b & = =&& = =& =2 =& c ' > >'  >  >' >& >'* d '0 ? ?'> ?& ?'E ?- ?'^ e 'u @7 @'| @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B( B3 B( BR B(, h (8 C  C(N C# C(U C* C(n CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)' FK F)1 l )2 G G)D G G)P G G)k G; G)o G@ G)u GG G)z GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*( K K*A q *B L L*_ r *` M M*x s *y N N* t * O O* O, O+ u + P P+ P P+ v + Q Q+' Q Q+, Q Q+3 Q Q+7 Q% Q+I Q9 Q+Z QP Q+a w +n R R+u R/ R+| R= R+ RM R+ R[ R+ R R+ R R+ y + S S,C Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S-" z -$ T T-e TC T-y T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V.. V V.9 Vm V.J V V.R  .^ W  W. W5 W. We W. W W/  / X X/ X X/+ X% X/: X5 X/O Xt X/c X X/u  /v Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \03 \- \0; \9 \0A \E \0G \R \0N \_ \0Z \p \0l \ \0q \ \0v \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1, \ \11 \ \17 \ \1< \ \1A \ \1F \ \1K \  \1P \ \1U \ \1Z \) \1_ \3 \1j \T \1o \[ \1t \f \1{ \r \1 \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \2 \V \2 \^ \2  \g \2 \o \2 \v \2 \} \24 \ \29 \ \2= \ \2E \ \2O \ \2T \ \2[ \ \2` \ \2g \ \2l \ \2y \ \2 \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3  ^S ^3 ^Y ^3 ^b ^3! ] ]3E  3F _ _3`  3b ` `3q ` `3  3 a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4Q d d4R4m d d4n''4 d d4 d d4  4 ~  ~4 ~ ~52 ~M ~59 ~V ~5@ ~_ ~5a ~ ~5m ~  ~6 ~ ~6 ~ ~6 ~  ~6 ~ ~II ~  ~IJ ~ ~I ~  ~I ~ ~I ~ ~I ~, ~I ~ ~J ~ ~J- ~ ~J ~; ~K> ~ ~KI ~ ~K ~ ~L+ ~ ~L0 ~ ~LD ~ ~LF ~ ~Ltgetmultibytecodec.framemodgetcodec$.framercodecobjcodecenc cofuncencodingregister_maps.framemodule .safehmhnamefind_pairencmap.framehaystackmodifierbody haystacksizeUcp932_encode.frame .safec2inbuf inleftoutbufoutleftcp932_decode.frameoutleftinbuf inleftoutbufeuc_jis_2004_encode .framecflagsconfig insizeoutleftinbuf inleftoutbufeuc_jis_2004_decode.frameconfigoutleftinbuf inleftoutbufeuc_jp_encode .frameinbuf inleftoutbufoutlefteuc_jp_decode.frameoutleft inleftoutbufinbuffshift_jis_encode .framec2inbuf inleftoutbufoutleftshift_jis_decode.framec1outleft inleftoutbufinbufshift_jis_2004_encode(.framecflagsconfiginsizeoutleftinbuf inleftoutbuf+shift_jis_2004_decode .frameconfigoutleftinbuf inleftoutbufSinit_codecs_jp.frame ~ ~ ~ ~  : , ;  <  FZ   w (      a   E  SYZdg h 5+ " 05Mr  + ' !! ) ""-""a + c##   =## Q 8 R$$ d 9 f % %~   % %&& % %% % %u %; %z"" %@ %''  %J %((% %M %&((+C(( %Z %)) %u %*** * % % % %++ % % G  , ,  3 , , , , N  - -O % %f -3 - -s - O  .j . . . . . . .; . . . . . . . .  . . . .F . .O . . .= . .F . .P ., .^ .> . .O . .U Q X / / -s - /a / / / / / / /! / /I /0 /l /^ /r R t 0 0 0 0 0" 0 T  1 1 18 122 / 1 1 7 1 1!8 1 1!F 1 1!e 1 1!s 1 1!y 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1" 1 1"E 1 1"L 1' 1"T 10 1"Y 15 1"` 1I 1"l 1i 1"s 1q 1"{ 1z 1" 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1#$ 1k 1#. 1x 1#8 1 1#A 1 1#P 1 1#X 1 1#a 1 1#j 1 1#r 1 1#} 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$  V $ 3 3$# 3  3$; 3< 3$C 3F 3$G 3J 3$P W $Q 4 4$b 4 4$v X $w 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6% 67 6%  6> 6% 6E 6% 6g 6% 6v 6%& 6~ 6%, 6 6%5 Z %7 7 7%[ 7' 7%o 7; 7%x \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9& 9z 9&  9 9& 9 9& 9 9&& 9 9&, 9 9&1 9 9&9 9 9&C 9 9&L _ &M : :&e :5 :&o :@ :&{ ` &| ; ;& a & < <& b & = =&& = =& =2 =& c ' > >' >  >' >& >'- d '3 ? ?'A ?& ?'H ?- ?'a e 'x @7 @' @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B( B- B( B3 B( BR B(/ h (; C  C(Q C# C(X C* C(q CF C( i ( D D( j ( E E( E& E( EA E( k ( F F)  FA F)* FK F)4 l )5 G G)G G G)S G G)n G; G)r G@ G)x GG G)} GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*+ K K*D q *E L L*b r *c M M*{ s *| N N* t * O O* O, O+ u + P P+ P P+ v + Q Q+* Q Q+/ Q Q+6 Q Q+: Q% Q+L Q9 Q+] QP Q+d w +q R R+x R/ R+ R= R+ RM R+ R[ R+ R R+ R R+ y + S S,F Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S-% z -' T T-h TC T-| T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V..  V V.< Vm V.M V V.U  .a W  W. W5 W. We W. W W/   /  X X/ X X/. X% X/= X5 X/R Xt X/f X X/x  /y Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0! \ \06 \- \0> \9 \0D \E \0J \R \0Q \_ \0] \p \0o \ \0t \ \0y \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1* \ \1/ \ \14 \ \1: \ \1? \ \1D \ \1I \ \1N \  \1S \ \1X \ \1] \) \1b \3 \1m \T \1r \[ \1w \f \1~ \r \1 \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \2 \M \2 \V \2  \^ \2 \g \2 \o \2 \v \2 \} \27 \ \2< \ \2@ \ \2H \ \2R \ \2W \ \2^ \ \2c \ \2j \ \2o \ \2| \ \2 \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3  ^S ^3 ^Y ^3 ^b ^3$ ] ]3H  3I _ _3c  3e ` `3t ` `3  3 a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee4ee4T d d4U4p d d4q''4 d d4 d d4  4 ~  ~4 ~ ~55 ~M ~5< ~V ~5C ~_ ~5d ~ ~5p ~  ~6 ~ ~6 ~_ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~, ~6 ~ ~6 ~ ~75 ~E ~7 ~ ~7 ~ ~7 ~ ~7 ~  ~8m ~ ~8u ~ ~8 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~  ~: ~* ~;, ~` ~;8getmultibytecodec.framemodgetcodec$.framercodecobjcodecenc cofuncencodingregister_maps.framemodule .safehmhnamefind_pairencmap.framehaystackmodifierbody haystacksizePimportmap.frame decmapencmaposymbolmodmodnameTiso2022_codec_init.framedesigconfigiso2022_encode_init.framestateiso2022_encode_reset.frameoutbuf outleftstate iso2022_encode .frameflagsdsglengthconfiginsize cinbuf inleftoutbufoutleftstateiso2022_decode_init.framestateiso2022_decode_reset.framestateiso2022processesc.framestate inleftinbuf esclenconfig&iso2022processg2.frameoutleft inleftinbufoutbufstateiso2022_decode4.framedsgconfigoutleft inleftdsgcacheinbufoutbufstateksx1001_init.frameBksx1001_decoder.framedataͱksx1001_encoder.framedataYjisx0208_init.framejisx0208_decoder.framedata`jisx0208_encoder.framedatajisx0212_init.frameИjisx0212_decoder.framedatajisx0212_encoder.framedataѷjisx0213_init.frame/jisx0213_2000_1_decoder.framedatajisx0213_2000_2_decoder.framedata,jisx0213_2004_1_decoder.framedataIjisx0213_2004_2_decoder.framedataAjisx0213_encoder.framelengthdataconfig:jisx0213_2000_1_encoder.framelengthdataޘjisx0213_2000_1_encoder_paironly.framedatailengthlengthjisx0213_2000_2_encoder.framelengthdataxjisx0213_2004_1_encoder.framelengthdatajisx0213_2004_1_encoder_paironly.framedatailengthlengthNjisx0213_2004_2_encoder.framelengthdatajisx0201_r_decoder.framedatajisx0201_r_encoder.framedatacjisx0201_k_decoder.framedatajisx0201_k_encoder.framedatagb2312_init.frameXgb2312_decoder.framedatagb2312_encoder.framedataodummy_decoder.frameudummy_encoder.frame{init_codecs_iso2022.frame ~ ~  ~ ~  6 , 7  8  BV   s ( {     a   A  OUV`c d| }5' " ,1In  + ' !!  )  "")""] + _##   9## M 8 N$$ ` 9 b % %z   % %&&  % %! % %q %; %v"" %@ %'' %J % ((! %M %"(('?(( %Z %)) %u %*** * % % % %++ % % G  , ,  / , , , , N  - -K % %b -3 - -s - O  .j . . . . .  . .7 . . . . . . . .  . . . .B . .K . . .= . .F . .P .( .^ .: . .K . .Q Q T / / -s - /a / / / / / / / / /E /0 /h /^ /n R p 0 0 0 0 0" 0 T  1 1 18 122 + 1 1 3 1 1!4 1 1!B 1 1!a 1 1!o 1 1!u 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1" 1 1"A 1 1"H 1' 1"P 10 1"U 15 1"\ 1I 1"h 1i 1"o 1q 1"w 1z 1"| 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1#  1k 1#* 1x 1#4 1 1#= 1 1#L 1 1#T 1 1#] 1 1#f 1 1#n 1 1#y 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$  V $ 3 3$ 3  3$7 3< 3$? 3F 3$C 3J 3$L W $M 4 4$^ 4 4$r X $s 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6% 67 6% 6> 6%  6E 6% 6g 6% 6v 6%" 6~ 6%( 6 6%1 Z %3 7 7%W 7' 7%k 7; 7%t \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9& 9 9& 9 9&" 9 9&( 9 9&- 9 9&5 9 9&? 9 9&H _ &I : :&a :5 :&k :@ :&w ` &x ; ;& a & < <& b & = =&& = =& =2 =& c ' > >'  >  >' >& >') d '/ ? ?'= ?& ?'D ?- ?'] e 't @7 @'{ @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B( B3 B( BR B(+ h (7 C  C(M C# C(T C* C(m CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)& FK F)0 l )1 G G)C G G)O G G)j G; G)n G@ G)t GG G)y GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*' K K*@ q *A L L*^ r *_ M M*w s *x N N* t * O O* O, O* u + P P+ P P+ v + Q Q+& Q Q++ Q Q+2 Q Q+6 Q% Q+H Q9 Q+Y QP Q+` w +m R R+t R/ R+{ R= R+ RM R+ R[ R+ R R+ R R+ y + S S,B Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S-! z -# T T-d TC T-x T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-. V V.8 Vm V.I V V.Q  .] W  W. W5 W. We W. W W/  / X X/ X X/* X% X/9 X5 X/N Xt X/b X X/t  /u Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \02 \- \0: \9 \0@ \E \0F \R \0M \_ \0Y \p \0k \ \0p \ \0u \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1+ \ \10 \ \16 \ \1; \ \1@ \ \1E \ \1J \  \1O \ \1T \ \1Y \) \1^ \3 \1i \T \1n \[ \1s \f \1z \r \1 \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \2 \V \2 \^ \2  \g \2 \o \2 \v \2 \} \23 \ \28 \ \2< \ \2D \ \2N \ \2S \ \2Z \ \2_ \ \2f \ \2k \ \2x \ \2~ \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3  ^Y ^3 ^b ^3  ] ]3D  3E _ _3_  3a ` `3p ` `3  3 a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4P d d4Q4l d d4m''4 d d4 d d4  4 ~  ~4 ~ ~51 ~M ~58 ~V ~5? ~_ ~5` ~ ~5l ~  ~6 ~ ~6~ ~_ ~6 ~ ~6 ~  ~6 ~ ~? ~ ~@ ~% ~@getmultibytecodec.framemod!getcodec$.framercodecobjcodecenc cofuncencoding 6% 6E 6% 6g 6% 6v 6%  6~ 6%& 6 6%/ Z %1 7 7%U 7' 7%i 7; 7%r \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9& 9 9& 9 9&  9 9&& 9 9&+ 9 9&3 9 9&= 9 9&F _ &G : :&_ :5 :&i :@ :&u ` &v ; ;& a & < <& b & = =&& = =& =2 =& c ' > >' >  >' >& >'' d '- ? ?'; ?& ?'B ?- ?'[ e 'r @7 @'y @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B() h (5 C  C(K C# C(R C* C(k CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)$ FK F). l )/ G G)A G G)M G G)h G; G)l G@ G)r GG G)w GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*% K K*> q *? L L*\ r *] M M*u s *v N N* t * O O* O, O* u * P P+  P P+ v + Q Q+$ Q Q+) Q Q+0 Q Q+4 Q% Q+F Q9 Q+W QP Q+^ w +k R R+r R/ R+y R= R+ RM R+ R[ R+ R R+ R R+ y + S S,@ Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S- z -! T T-b TC T-v T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-. V V.6 Vm V.G V V.O  .[ W  W. W5 W. We W. W W/  / X X/ X X/( X% X/7 X5 X/L Xt X/` X X/r  /s Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \00 \- \08 \9 \0> \E \0D \R \0K \_ \0W \p \0i \ \0n \ \0s \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1. \ \14 \ \19 \ \1> \ \1C \ \1H \  \1M \ \1R \ \1W \) \1\ \3 \1g \T \1l \[ \1q \f \1x \r \1} \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2  \g \2 \o \2 \v \2 \} \21 \ \26 \ \2: \ \2B \ \2L \ \2Q \ \2X \ \2] \ \2d \ \2i \ \2v \ \2| \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3  ^Y ^3 ^b ^3 ] ]3B  3C _ _3]  3_ ` `3n ` `3~  3 a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4N d d4O4j d d4k''4 d d4 d d4  4 ~  ~4 ~ ~5/ ~M ~56 ~V ~5= ~_ ~5^ ~ ~5j ~  ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~F ~* ~F ~b ~G2 ~ ~G ~8 ~HRgetmultibytecodec.framemodgetcodec$.framercodecobjcodecenc cofuncencodingregister_maps.framemodule .safehmhnamegb2312_encode .frame inleftoutbufoutleftinbufgb2312_decode.frameoutleft inleftinbufoutbuf?gbk_encode .frame inleftoutbufoutleftinbufgbk_decode.frameoutleft inleftinbufoutbufgb18030_encode.frame.safeinbuf inleftoutbufoutleftgb18030_decode.frameoutleftinbuf inleftoutbufhz_encode_init.framestatehz_encode_reset.frameoutbuf outleftstatehz_encode .framestate inleftoutbufoutleftinbufhz_decode_init.framestatehz_decode_reset.framestatehz_decode.framestateoutleft inleftinbufoutbufinit_codecs_cn.frame ~ ~   / , 0  1  ;O   l ( t     a   :  HNOY\ ]u v5  " %*Bg  + ' !! ) "" """V + X##  2## F 8 G$$ Y 9 [ % %s   % %&& % % % %j %; %o"" %@ %'' %J %(( %M %(( 8(( %Z %)) %u %*** * % % % %++ % % G  , ,  ( , , , , N  - -D % %[ -3 - -s - O  .j . . . . . . .0 . . . . . . . . . .  . .; . .D . . .= .  .F . .P .! .^ .3 . .D . .J Q M / / -s - /a / / / / / / / / /> /0 /a /^ /g R i 0 0 0 0 0" 0 T  1 1 18 122 $ 1 1 , 1 1!- 1 1!; 1 1!Z 1 1!h 1 1!n 1 1!~ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1": 1 1"A 1' 1"I 10 1"N 15 1"U 1I 1"a 1i 1"h 1q 1"p 1z 1"u 1 1"| 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1## 1x 1#- 1 1#6 1 1#E 1 1#M 1 1#V 1 1#_ 1 1#g 1 1#r 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$0 3< 3$8 3F 3$< 3J 3$E W $F 4 4$W 4 4$k X $l 5 5${ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%! 6 6%* Z %, 7 7%P 7' 7%d 7; 7%m \ %} 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&! 9 9&& 9 9&. 9 9&8 9 9&A _ &B : :&Z :5 :&d :@ :&p ` &q ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'" d '( ? ?'6 ?& ?'= ?- ?'V e 'm @7 @'t @E @'| @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B($ h (0 C  C(F C# C(M C* C(f CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)) l )* G G)< G G)H G G)c G; G)g G@ G)m GG G)r GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*  K K*9 q *: L L*W r *X M M*p s *q N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+$ Q Q++ Q Q+/ Q% Q+A Q9 Q+R QP Q+Y w +f R R+m R/ R+t R= R+} RM R+ R[ R+ R R+ R R+ y + S S,; Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-] TC T-q T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.1 Vm V.B V V.J  .V W  W.~ W5 W. We W. W W.  / X X/ X X/# X% X/2 X5 X/G Xt X/[ X X/m  /n Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0+ \- \03 \9 \09 \E \0? \R \0F \_ \0R \p \0d \ \0i \ \0n \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1/ \ \14 \ \19 \ \1> \ \1C \  \1H \ \1M \ \1R \) \1W \3 \1b \T \1g \[ \1l \f \1s \r \1x \{ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2, \ \21 \ \25 \ \2= \ \2G \ \2L \ \2S \ \2X \ \2_ \ \2d \ \2q \ \2w \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3=  3> _ _3X  3Z ` `3i ` `3y  3z a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4I d d4J4e d d4f''4 d d4 d d4  4 ~ ~4 ~ ~5 ~ ~6( ~L ~6G ~m ~6V ~| ~6r ~ ~6 ~ ~6 ~F ~6 ~i ~6 ~ ~6 ~ ~6 ~@ ~6 ~R ~6 ~] ~6 ~r ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~. ~6 ~l ~7 ~ ~7  ~ ~7 ~ ~7 ~ ~7 ~ ~7# ~ ~7( ~( ~7/ ~< ~73 ~I ~77 ~Q ~7; ~Y ~7@ ~a ~7D ~n ~7H ~u ~7L ~~ ~7P ~ ~7T ~ ~7X ~ ~7\ ~ ~7a ~ ~7e ~ ~7i ~ ~7m ~ ~7q ~ ~7u ~ ~7y ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~% ~7 ~' ~7 ~) ~7 ~- ~7 ~/ ~7 ~? ~7 ~  ~7  7 ~ ~7 ~% ~8 ~N ~88 ~i ~8; ~n ~8S ~ ~8k ~ ~8 ~ ~8 ~ ~8 ~ ~9Z ~ ~9y ~ ~9~ ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~  ~9 ~3 ~9 ~7 ~9 ~D ~: ~S ~:  ~Y ~: ~n ~:) ~| ~:= ~ ~:B ~ ~:L ~ ~:Y ~ ~:k ~ ~:w ~ ~: ~ ~: ~ ~: ~, ~: ~L ~; ~a ~;7 ~ ~;R ~ ~;^ ~ ~;d ~ ~;p ~ ~; ~ ~;zlib_error.framezst8err 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4  4  4  5 ~ ~5  5 5.  5Y G 5w ~ ~5} ~ ~5 ~ ~5 ~ ~5 ~ ~M ~, ~N ~u ~N@ ~ ~N^ ~ ~N ~ ~N ~ ~N ~7 ~N ~T ~N ~r ~O  ~ ~O0 ~ ~O7 ~ ~O] ~ ~O ~  ~O ~0 ~O ~7 ~O ~~ ~P ~ ~P ~ ~P5 ~ ~P^ ~ ~Pc ~ ~Pw ~ ~P ~  ~P ~ ~ ~6 ~ ~ ~ ~# ~- ~N ~M ~r ~ ~ ~ ~ ~ ~ ~ ~ ~ get_change_3_2_0.framen!=normalization_3_2_0.framen!_getrecord_ex.framecode!new_previous_version .framenormalizationgetrecordname!getuchar.frameobj"4unicodedata_decimal0.framecrcselfvargs have_olddefobj#Aunicodedata_digit(.framevargsdefobj#unicodedata_numeric4.frame .saferccselfvargs have_olddefobj%unicodedata_category$.frameindexself cvargs%unicodedata_bidirectional$.frameindexself cvargs&[unicodedata_combining$.frameindexself cvargs&unicodedata_mirrored$.frameindexself cvargs'unicodedata_east_asian_width$.frameindexself cvargs(*unicodedata_decomposition4.frameidecompprefix_index indexcountcodeselfvargs)get_decomp_record.frame prefixcountindexcodeself*nfd_nfkd.framezcuryprevktcountpprefixlindexself.safeLnewsizecode`stacko endiresultdspacehisizeinputxstackptr.find_nfc_index.framenfccode/nfc_nfkc.framecomb1 i1(combfiskippedoendresultkinputselfcskipped2eis_normalized.frameiend quickcheck_mask knfcself prev_combininginput30unicodedata_normalize .frameselfinputformargs5r_gethash.framelensscale5is_unified_ideograph.framecode6)_getucname4.framebuffer buflen TV,.safeLcodeself8_cmpname.frame namelennamebuffercodeself9find_syllable.frameposlen1str scolumni countlen:5_getcode@.frameincrselfihv codenamelenlen(pos$T VLname mask=Aunicodedata_name$.framenameselfvargs defobj>%unicodedata_lookup(.frame strcodeselfnamelennameargs>initunicodedata .framem ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4 ~ ~4((5 ~# ~5((5E ~$ ~5\ ~? ~5_ ~  ~5 ~; ~5?start_timing .frame?finish_timing .frame@=seconds.frame.safe@milli.frame.safe@micro.frame@inittiming.frame ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4  5 % 5  ~ ~5  5* ~ ~5/225g ~ ~5j5 ~6 ~5((6  ~K ~6 ww66Dw w6x ~L ~6 ~{ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~7H ~/ ~7e ~P ~7q ~` ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~8 ~ ~8# ~4 ~8> ~S ~8^ ~w ~8k ~ ~8 ~ ~8 ~ ~9 ~w ~9+ ~ ~96 ~ ~9K ~ ~9h ~ ~9 ~ ~9A`_PyTime_DoubleToTimet.frame diff.safexAtime_time.framesecsBtime_clock.frame .safeB8time_sleep.framesecsargsBtmtotuple.frame .safepvCtime_convert.framefunctionwhentwhenD7parse_time_double_args.frame whenpwhenformatargsotDtime_gmtime.framewhenargsDtime_localtime.framewhenargsECgettmarg8.frame .safeyargspFtime_strftimeT.frame@ret8outbuf 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4225 ~ ~5% ~ ~5e ~_ ~5 ~ ~5 ~ ~6% ~. ~6J ~Y ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~7* ~L ~7x ~ ~7 ~ ~7 ~ ~7 ~3 ~8' ~a ~8L ~ ~8l ~ ~8 ~ ~8 ~ ~8 ~> ~9" ~ ~96 ~ ~9Qssplit_whitespace$.framemaxsplit erritemlistlenscountsplitiSstrop_splitfieldsL.frameerr,item ij(listlen sargsmaxsplitsplitcountn$subVstrop_joinfieldsH.frame,getitemfuncsleni(p0item seqlenseqargs$res szreslenseplensep\ strop_find<.framensub lensargslasti]strop_rfind@.framejnsub lensargslasti_ do_strip .framestriptypelensargs_strop_strip.frameargs`strop_lstrip.frameargs`_strop_rstrip.frameargs`strop_lower,.frame ichangeds_newnewstrnsargsastrop_upper,.frame ichangeds_newnewstrnsargscstrop_capitalize,.frame ichangeds_newnewstrnsargsdstrop_expandtabs@.framee$stringlen stringargs(tabsizef?strop_countD.frame rmnsub lensargslastigstrop_swapcase,.frame ichangeds_newnewstrnsargsi strop_atoi$.framebufferendsargs basekstrop_atol$.framebufferxendsargs basemstrop_atof$.framebuffer.safexendsargspOstrop_maketrans8.frameargstolenfromlen tofromqCstrop_translateX.frame8trans_tablei$output_start output8result,inlentable0tablen table1input_objargs4dellen(del_tablechangedtmymemfind.frameiilen pat_lenmempatu%mymemcnt.framepatmemnfound pat_lenlenumymemreplace(.frameout_lensuboffsetnew_sout_snew_lensub_lencountpatstrlen pat_lenw]strop_replaceP.frame(newstrnew_s out_lensub_len subpat_lenpatlenstrargs$countxinitstrop(.framebufm  ~Z ~  4 , 5  6  @T   q ( y     a   ?  MST^a bz {5% " */Gl  + ' !! )  ""'""[ + ]##   7## K 8 L$$ ^ 9 ` % %x   % %&&  % % % %o %; %t"" %@ %'' %J %(( %M % ((%=(( %Z %)) %u %*** * % % % %++ % % G  , ,  - , , , , N  - -I % %` -3 - -s - O  .j . . . . .  . .5 . . . . . . . . . . . .@ . .I . .  .= . .F . .P .& .^ .8 . .I . .O Q R / / -s - /a / / /  / / / / / /C /0 /f /^ /l R n 0 0 0 0 0" 0 T  1 1 18 122 ) 1 1 1 1 1!2 1 1!@ 1 1!_ 1 1!m 1 1!s 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"? 1 1"F 1' 1"N 10 1"S 15 1"Z 1I 1"f 1i 1"m 1q 1"u 1z 1"z 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#( 1x 1#2 1 1#; 1 1#J 1 1#R 1 1#[ 1 1#d 1 1#l 1 1#w 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $  3 3$ 3  3$5 3< 3$= 3F 3$A 3J 3$J W $K 4 4$\ 4 4$p X $q 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6% 6> 6% 6E 6% 6g 6% 6v 6%  6~ 6%& 6 6%/ Z %1 7 7%U 7' 7%i 7; 7%r \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9& 9 9& 9 9&  9 9&& 9 9&+ 9 9&3 9 9&= 9 9&F _ &G : :&_ :5 :&i :@ :&u ` &v ; ;& a & < <& b & = =&& = =& =2 =& c ' > >' >  >' >& >'' d '- ? ?'; ?& ?'B ?- ?'[ e 'r @7 @'y @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B() h (5 C  C(K C# C(R C* C(k CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)$ FK F). l )/ G G)A G G)M G G)h G; G)l G@ G)r GG G)w GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*% K K*> q *? L L*\ r *] M M*u s *v N N* t * O O* O, O* u * P P+  P P+ v + Q Q+$ Q Q+) Q Q+0 Q Q+4 Q% Q+F Q9 Q+W QP Q+^ w +k R R+r R/ R+y R= R+ RM R+ R[ R+ R R+ R R+ y + S S,@ Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S- z -! T T-b TC T-v T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-. V V.6 Vm V.G V V.O  .[ W  W. W5 W. We W. W W/  / X X/ X X/( X% X/7 X5 X/L Xt X/` X X/r  /s Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \00 \- \08 \9 \0> \E \0D \R \0K \_ \0W \p \0i \ \0n \ \0s \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1. \ \14 \ \19 \ \1> \ \1C \ \1H \  \1M \ \1R \ \1W \) \1\ \3 \1g \T \1l \[ \1q \f \1x \r \1} \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2  \g \2 \o \2 \v \2 \} \21 \ \26 \ \2: \ \2B \ \2L \ \2Q \ \2X \ \2] \ \2d \ \2i \ \2v \ \2| \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3  ^Y ^3 ^b ^3 ] ]3B  3C _ _3]  3_ ` `3n ` `3~  3 a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4N d d4O4j d d4k''4 d d4 d d4  4 ~^ ~4  45  5@ G 5^ ~_ ~5m  5x ~` ~5 ~ ~55 ~ ~5  6  ~ ~6'6V ~ ~6[ ~ ~6c6A6m6v67 ~  ~79B7^k7|77 ~  ~77 ~ ~77 ~% ~8 ~{ ~8 ~ ~8 ~ ~8" ~ ~87 ~ ~8U ~ ~8\8n(8y58i9 ~  ~9|tutu9 ~ ~9ww99w w: ~ ~::< ~< ~: ~ ~;? ~ ~;K ~ ~;Z ~ ~;q ~ ~;y ~ ~; ~p ~<& ~ ~<9 ~ ~ ~< ~Z ~= ~ ~=! ~ ~=_ ~ ~># ~ ~>. ~ ~? ~F ~@( ~ ~@C ~ ~@Y ~ ~@v ~1 ~@ ~_ ~@ ~ ~@ ~ ~@ ~ ~A ~ ~A& ~ ~AR ~$ ~Af ~9 ~A ~q ~A ~ ~A ~ ~A ~ ~A ~ ~A ~ ~B ~ ~B* ~  ~B; ~ ' ~Br ~ g ~B ~  ~B ~  ~B ~  ~B ~  ~C ~  ~C, ~ 5 ~C ~  ~C ~  ~C ~  ~C ~  ~C ~  ~D" ~ 4 ~D; ~ R ~D| ~  ~D ~  ~E ~ . ~E  ~ A ~E ~  ~E ~  ~Fu ~  ~F ~  ~F ~  ~F ~  ~F ~* ~G ~N ~G4 ~q ~Gf ~ ~G{ ~ ~G ~ ~G ~  ~G ~  ~G ~L ~H ~T ~H1 ~ ~HI ~ ~Hd ~ ~H ~ ~I3 ~ ~I ~ ~I ~ ~I ~ ~JV ~ ~J` ~ ~Jc ~ ~Jo ~ ~N8zJselect_error .framezjset_error.framezset_herror.framevh_errorzset_gaierror.framev.safeerror{Xinternal_setblocking.frameblocks_save{internal_select_ex0.framewritingfdstv .safeintervals}internal_select.framewritings}7init_sockobject .frameproto typefamilyfds}new_sockobject.frame prototypefamilyfds}setipaddrd.frame9ch8d44d30d2,d1@sin@siz(error$resD_save af hintsnameaddr_ret_sizeaddr_retmakeipaddr(.framebufaddrlenaddrJmakesockaddr .frame ret.safeaddrobjaddrlenaddr-getsockaddrarg(.frameresultaddr porthost len_retsaddr_ret lenpathargsgetsockaddrlen .frameslen_retisock_accept.frame|socktimeout_savedeadlinehas_timeoutintervaltnewfdpaddrbufxaddrlensresaddr'sock_setblocking.framesblockargsock_settimeout.framestimeoutarg#sock_gettimeout .framesYsock_setsockopt4.framesbuflenbufflagoptnamelevelargs7sock_getsockopt .frameWsock_bind.framexres|_savetaddrlenpaddrbufaddrossock_close.frame_savefdsFinternal_connect$.frame timeoutp res_sizeresaddrlenaddrstimeoutsock_connect.framexres|timeout_savetaddrlenpaddrbufaddrosSsock_connect_ex.framexres|timeout_savetaddrlenpaddrbufaddrossock_fileno.framessock_dup.framesocknewfdszsock_getsockname.frametres|_savepaddrbufxaddrlens?sock_getpeername.frametres|_savepaddrbufxaddrlenssock_listen.frameress _savebacklogargsock_makefile(.framef fdsargsbufsizemode^sock_recv_guts4.frame flagslencbuftimeout _savedeadlinehas_timeoutintervaloutlenssock_recv$.framesbufrecvlenargsflagssock_recv_intod.frame readlens@bufkwdsargsflagsrecvlensock_recvfrom_guts.frame flagslencbufttimeoutpaddrbuf_savedeadlinehas_timeoutinterval|addrlensaddrxnsock_recvfrom0.framesrecvlenargsflags retaddrbuf{sock_recvfrom_intoh.frame readlens@bufkwdsargsHaddrflagsrecvlensock_sendt.frametimeout`_savePdeadline\has_timeoutXintervallenbufsHpbufargsflags nsock_sendallx.framesaved_errnotimeout nd_saveTdeadline`has_timeout\intervallenbufsLpbufargsflagssock_sendto.frametimeout_savedeadlinehas_timeoutintervaladdrlenaddrbuf@len 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~  ~4  45   58 G 5_ ~ ~5p5 ~* ~5 ~T ~64 ~ ~6m ~ ~6 ~ ~; ~ ~; ~ ~; ~ ~ % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ~ ~4225 ~ ~5  51  56 % 5< . 5J < 5i ~ ~5s ~  ~5z""5 ~ ~5 ~  ~5 ~% ~6* ~8 ~6k ~ ~6z ~- ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7/ ~# ~75 ~* ~7> ~5 ~7B ~I ~7S ~a ~7] ~m ~7f ~z ~7q ~ ~7u ~ ~7~ ~ ~7 ~ ~7 ~ ~7 ~> ~7 ~F ~7 ~x ~7 ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8! ~ ~8) ~ ~8. ~ ~8C ~  ~8N ~1 ~8S ~@ ~8d ~T ~8i ~g ~8v ~ ~8| ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8  8  9# ~ ~9W ~H ~9v ~h ~9 ~x ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~ ~: ~ ~: ~ ~: ~ ~; ~ ~;O ~g ~;R ~k ~;U ~q ~;X ~} ~;m ~ ~;q ~ ~; ~ ~; ~ ~; ~ ~; ~" ~; ~' ~; ~+ ~; ~/ ~; ~3 ~; ~B ~; ~H ~; ~M ~; ~Z ~; ~d ~<  ~{ ~< ~ ~>i ~ ~> ~~ ~?1 ~ ~?I ~ ~?_ ~ ~?y ~ ~? ~< ~? ~` ~@ ~ ~@Шset_error_attr.framevnameerrvalue#set_error,.frameerrbuffer.safecodecolumn linenoparserselfthave_handler.frametypeselfҙget_handler_name .framehinfoconv_string_to_unicode.frame.safestrconv_string_len_to_unicode.framelenstrJconv_string_to_utf8.framestrqconv_string_len_to_utf8 .framelenstrӠerror_external_entity_ref_handler.frameӣnoop_character_data_handler.frameӤflag_error .frameselfgetcode.framelinenofunc_nameslot-trace_frame.frame valcodeftstate trace_frame_exc(.frameerrargf tracebackvaluetypetstate֎call_with_frame$.frame self resargsfuncf.safectstatestring_intern.framevalueresultselfstrؽcall_character_handler .frametemp .safeargslenbufferself[flush_character_buffer.frameselfڡmy_CharacterDataHandler.frameselfuserDatalendatakmy_StartElementHandler8.frame rv$.safeargsname vnicontainermaxattsselfuserDatamy_EndElementHandler$.frame rvargs.safenameselfuserDatamy_ProcessingInstructionHandler$.frame rvargsdata.safetargetselfuserDatanmy_UnparsedEntityDeclHandler<.frame rvargsnotationNamepublicId systemIdbase .safeentityNameselfuserDatamy_EntityDeclHandlerH.frame rvargsis_parameter_entity notationNamepublicIdsystemIdbase$.safevalue_length valueentityNameselfuserDatamy_XmlDeclHandler(.frame rv.safeargs standaloneencodingversionselfuserData{conv_content_model,.frameconv_string ichildrenmodelresultMmy_ElementDeclHandler,.frame.safenamemodelobjmodelselfargsuserData.my_AttlistDeclHandler8.frame rvargsisrequireddflt att_typeattname.safeelnameselfuserDatamy_SkippedEntityHandler$.frame rvargsis_parameter_entity.safeentityNameselfuserData my_NotationDeclHandler4.frame rvargspublicId systemIdbase.safenotationNameselfuserDatamy_StartNamespaceDeclHandler$.frame rvargsuri.safeprefixselfuserDatamy_EndNamespaceDeclHandler$.frame rvargs.safeprefixselfuserDatamy_CommentHandler$.frame rv.safeargsdataselfuserDataOmy_StartCdataSectionHandler$.frame rv.safeargsselfuserData]my_EndCdataSectionHandler$.frame rv.safeargsselfuserDatakmy_DefaultHandler$.frame rvargs.safelensselfuserDatamy_DefaultHandlerExpandHandler$.frame rvargs.safelensselfuserData my_NotStandaloneHandler(.frame rv.safeargsselfrcuserData?my_ExternalEntityRefHandler8.frame rvargscontextpublicId systemId.safebaseselfrcparsermy_StartDoctypeDeclHandler0.frame rvargshas_internal_subset pubidsysid.safedoctypeNameselfuserDataxmy_EndDoctypeDeclHandler$.frame rv.safeargsselfuserDataget_parse_result.frame.safervselfxmlparse_Parse(.frame.safeselfslensargs isFinaltreadinst(.framebuf.safemethbytesbuf_sizelen strargxmlparse_ParseFile .framerv bytes_readselfreadmethodf{xmlparse_SetBase.frameselfbaseargsxmlparse_GetBase.frame.safeself xmlparse_GetInputContext.framesizeoffsetselfuxmlparse_ExternalEntityParserCreate(.framei new_parserselfcontextargsencodingxmlparse_SetParamEntityParsing.framepflagargsxmlparse_UseForeignDTD.frameselfargsflagflagobjinit_template_buffer.framePyUnknownEncodingHandler$.frameinfonameresultnewxmlparseobject.frameinternselfencodingnamespace_separatorbxmlparse_dealloc.frameiselfkhandlername2int.frameinameget_pybool.frameistruexmlparse_getattr .frameoi rc.safeselfnamesethandler.framehandlernumc_handlervselfnamexmlparse_setattrx.frameherrmsgnew_buffer_sizeselfnamevxmlparse_traverse.framevisitargiopxmlparse_clear.frameopDpyexpat_ParserCreate4.frameresultkwargsintern_decref internnamespace_separatorencodingpyexpat_ErrorString.frame.safeargscodeinitpyexpatP.frame4ok8item0i,list(featuresmodel_moduleerrors_moduledsys_modules0info<.safemmodelmod_name errmod_name%clear_handlers.frameiinitialself ~' ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~) ~5 ~c ~5 ~g ~5+ ~z ~7 ~7 ~7 ~y ~80 ~ ~89 ~ ~8A ~ ~8R&ycall_voidarg_function.framefuncargs&call_stringarg_function.framefuncstringargargs'call_stringorint_function.frame stringargfuncintargargs'call_printfish_function.framefuncargstringargs'call_intasaddr_function.framefuncmemrepargs(.call_stringandint_function .framefuncsizesrcrepargs(ins.framevnamedval(initpure .framed  ~ ~  : , ;  <  FZ   w (      a   E  SYZdg h 5+ " 05Mr  + ' !! ) ""-""a + c##   =## Q 8 R$$ d 9 f % %~   % %&& % %% % %u %; %z"" %@ %''  %J %((% %M %&((+C(( %Z %)) %u %*** * % % % %++ % % G  , ,  3 , , , , N  - -O % %f -3 - -s - O  .j . . . . . . .; . . . . . . . .  . . . .F . .O . . .= . .F . .P ., .^ .> . .O . .U Q X / / -s - /a / / / / / / /! / /I /0 /l /^ /r R t 0 0 0 0 0" 0 T  1 1 18 122 / 1 1 7 1 1!8 1 1!F 1 1!e 1 1!s 1 1!y 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1" 1 1"E 1 1"L 1' 1"T 10 1"Y 15 1"` 1I 1"l 1i 1"s 1q 1"{ 1z 1" 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1#$ 1k 1#. 1x 1#8 1 1#A 1 1#P 1 1#X 1 1#a 1 1#j 1 1#r 1 1#} 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$  V $ 3 3$# 3  3$; 3< 3$C 3F 3$G 3J 3$P W $Q 4 4$b 4 4$v X $w 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6% 67 6%  6> 6% 6E 6% 6g 6% 6v 6%& 6~ 6%, 6 6%5 Z %7 7 7%[ 7' 7%o 7; 7%x \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9& 9z 9&  9 9& 9 9& 9 9&& 9 9&, 9 9&1 9 9&9 9 9&C 9 9&L _ &M : :&e :5 :&o :@ :&{ ` &| ; ;& a & < <& b & = =&& = =& =2 =& c ' > >' >  >' >& >'- d '3 ? ?'A ?& ?'H ?- ?'a e 'x @7 @' @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B( B- B( B3 B( BR B(/ h (; C  C(Q C# C(X C* C(q CF C( i ( D D( j ( E E( E& E( EA E( k ( F F)  FA F)* FK F)4 l )5 G G)G G G)S G G)n G; G)r G@ G)x GG G)} GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*+ K K*D q *E L L*b r *c M M*{ s *| N N* t * O O* O, O+ u + P P+ P P+ v + Q Q+* Q Q+/ Q Q+6 Q Q+: Q% Q+L Q9 Q+] QP Q+d w +q R R+x R/ R+ R= R+ RM R+ R[ R+ R R+ R R+ y + S S,F Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S-% z -' T T-h TC T-| T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V..  V V.< Vm V.M V V.U  .a W  W. W5 W. We W. W W/   /  X X/ X X/. X% X/= X5 X/R Xt X/f X X/x  /y Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0! \ \06 \- \0> \9 \0D \E \0J \R \0Q \_ \0] \p \0o \ \0t \ \0y \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1* \ \1/ \ \14 \ \1: \ \1? \ \1D \ \1I \ \1N \  \1S \ \1X \ \1] \) \1b \3 \1m \T \1r \[ \1w \f \1~ \r \1 \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \2 \M \2 \V \2  \^ \2 \g \2 \o \2 \v \2 \} \27 \ \2< \ \2@ \ \2H \ \2R \ \2W \ \2^ \ \2c \ \2j \ \2o \ \2| \ \2 \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3  ^S ^3 ^Y ^3 ^b ^3$ ] ]3H  3I _ _3c  3e ` `3t ` `3  3 a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee4ee4T d d4U4p d d4q''4 d d4 d d4  4 ~ ~4  5 % 5 ~ ~5 ~ ~5%5T ~  ~5d ~  ~5p ~/ ~55 ~F ~5* *6 ~J ~666 ~N ~6Bee6 ~R ~6ww66w w7 ~V ~777>7 ~ ~77 ~ ~78 ~ ~88& ~ ~8*8B ~ ~8Fxx8Kxx8bxx8 ~N ~89X ~c ~:! ~C ~: ~  ~ ~N ~>! ~q ~>C ~ ~>c ~ ~> ~ ~> ~ ~> ~ ~> ~  ~> ~( ~?z ~ ~? ~ ~? ~ ~? ~9 ~@ ~t ~@$ ~ ~@I ~ ~@T ~ ~@ ~ K ~A} ~  ~A ~ ! ~A ~ 5 ~A ~ S ~B B< ~  ~BL ~  ~By ~  ~B ~  ~B ~  ~B ~  ~B ~  ~B ~  ~B ~ $ ~B ~ O ~C ~ c ~CO ~  ~C ~  ~C ~ ( ~C ~ 4 ~D ~ p ~D ~  ~FQ ~ ~Fp ~ ~F ~- ~F ~v ~G ~ ~G ~ ~G& ~ ~G1 ~ ~G< ~ ~GL ~ ~G ~7 ~G ~J ~G ~[ ~G ~o ~G ~| ~H ~ ~H  ~ ~H ~: ~M ~ ~M ~ ~N# ~Y ~N8 ~o ~NJ ~ ~N ~ ~N ~ ~N ~ ~N ~ ~N ~ ~O ~O ~O) ~e ~O< ~y ~On ~ ~Oz ~ ~O ~ ~O ~ ~O ~* ~O ~9 ~P ~M ~P ~a ~P. ~u ~PE ~ ~PY ~ ~Pn ~ ~P ~ ~P ~ ~P ~ ~P ~+ ~Q ~N ~Q! ~p ~QA ~ ~Qs ~ ~Q{ ~ ~Q ~ ~Q ~  ~R ~\ ~R ~l ~R7 ~ ~Ra ~ ~Rm ~ ~R ~ ~R ~ ~R ~1 ~R ~C ~R ~U ~S ~h ~S ~z ~S$ ~ ~S5 ~ ~S ~ ~S ~= ~S ~E ~S ~S ~S ~\ ~S ~` ~T  ~ ~Tw ~ ~T ~  ~UL ~ ~Wk ~  ~W ~! ~W ~!L ~X ~! ~X# ~! ~X{ ~" ~Zy ~$ ~Z ~$ ~[2 ~$ ~[T)_PyInt_FromUid.frameuid)_PyInt_FromGid.framegid)_Py_Uid_Converter.frame uresultpoverflowobj+*_Py_Gid_Converter.frame uresultpoverflowobj,Yconvertenviron$.framev kped-posix_error.frame-posix_error_with_filename .framename-posix_error_with_allocated_filename.framercname.posix_fildes.frameresfunc _savefdfdobj.yposix_1str .frameresfunc _saveformatargspath1/ posix_2str,.frame resfunc_saveformatargspath2path1/statresult_new.frameresultikwdsargstype0^stat_float_times.frameargsnewval0fill_time.framevindex .safe nsecivalsec1I_pystat_fromstructstat$.framemnsec cnsecstv2posix_do_statH.frame0result,res statfunc st4_save(pathfreeformatargs$path3wposix_access(.frame res_savemodepathargs4 posix_ttyname.frameidargs4Zposix_ctermid,.frame$buffer4posix_chdir.frameargs4posix_chmod(.frame res_saveiargspath5Pposix_chown4.frame res_savegiduidargspath6posix_getcwd$.framedynamic_return tmpbuf_saveresbufsizebufsize_incr6posix_getcwdu$.frame.saferesbuf _save7_posix_link.frameargs7posix_listdir0.framew .safeepddirp_save vargsarg_is_unicodename:posix_mkdir(.frameres_saveargs modepath;posix_rename.frameargs;posix_rmdir.frameargs;posix_stat.frameargsself<posix_system.framests _savecommandargsposix_utime@.frame$bufmusec mtimeausecatimeres(_saveargargspath@Pposix__exit.framestsargs@free_string_array .framearrayicount@posix_execv0.frame.safei argvlistargcgetitemargvpathargsC$posix_execveh.frame@pLlenHvDkvalkey,pos4envcenvlist 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  44 45 5 * *5i 5j55ee55ww56"w w6V6W6^66666666ww7-7.7P7o%7777""77##88!!889%9F599:%:&:8:w:xjj::jj::jj:ll:ll:jj;B;t;;;<+ >'>/A>DW>]r>i>>>>?Vpplan9_error.framepplan9_error_with_filename .framenameqdir2pystatD.framedqgetvlong .framepoqpystat2dirH.frameo2odtdrplan9_bind,.frameres_saveoldnameargs flags`posix_fork.framepidresultsmakedir.framemodestmplan9_mkdir,.framepsargs modepathuplan9_dirread(.framevi npddfdargswwplan9_dirreadall,.framevi npddfdnameargsyplan9_mount<.frameres_saveanameflagoldafd fdargsznplan9_stat .frameretd_save pathargszplan9_fstat .frameretd_save fdargs{rplan9_wstat`.frameHretL_save@ddtDpathargs|plan9_fwstat`.frameHretL_save@ddtDfdargs|plan9_remove.frameres _savepathargs}plan9__exit.framestsargs}Zplan9_execv,.frame.safei argvlistargcgetitemargvpathargsOplan9_rfork.framepidflagsargsplan9_await.framebufargsplan9_open$.frame fd_saveomodefileargsplan9_create,.framefd_saveperm omodepathargs%plan9_close.frameres _savefdargsplan9_fauth$.frameres_save namefdargsplan9_fd2path.frameresbuf _savefdargsplan9_dup$.frame_savenewoldargs.plan9_seek0.frame_saveoffhowofdargsplan9_pread8.frame n .safe_savebufferoffsizefdargsplan9_pwrite4.frame_saveoffsizebufferfdargsplan9_fdopen0.frameffp_savefdargs bufsizemode}plan9_pipe .frame resfds_saveargsplan9_putenv(.framenewstr.safe fdbufvalkeyargsAplan9_unmount$.frame ret_saveoldargsnameplan9_abort .frameargsAplan9_sleep.frameret _savenargsqtoken.frametsepquotings^plan9_gettokens8.frame$vos ms pdsepsargs initplan9$.framem ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4  4  4  5 ) 5   7! ~ ~7"  7z ~ ~7{  7 ~  ~7  7 ~! ~7  8 ~" ~8   8*  8K  8 ~# ~8  8 ~$ ~8 ] ]9  ~& ~9  9 ~( ~94 U8 U9< ~) ~9G ~5 ~9J ~: ~9N ~> ~9Y ~O ~9 ~ ~: ~ ~:  ~' ~:3 ~= ~:= ~K ~:^ ~n ~:o ~ ~: ~ ~: ~ ~: ~ ~; ~$ ~;  ~1 ~;* ~V ~;= ~v ~;F ~ ~;Z ~ ~;z ~ ~; ~ ~; ~2 ~< ~d ~< ~m ~<8 ~ ~ ~ ~>& ~ ~>: ~ ~>N ~ ~>l ~ ~> ~ ~> ~9 ~? ~ ~?q ~ ~? ~ ~? ~  ~? ~3 ~? ~t ~@ ~ ~@N ~ ~@f ~ ~@ ~. ~Ab ~ ~A ~  ~B ~  ~B] ~  ~Bj ~  ~B ~  ~B ~ ! ~B ~ 8 ~B ~ Q ~B ~ a ~B ~ r ~B ~  ~B ~  ~C2 ~  ~CV ~  ~C ~ $ ~C ~ ; ~C ~ a ~C ~ m ~C ~  ~D ~  ~D  ~  ~D+ ~  ~D1 ~  ~D9 ~  ~Dx ~ * ~D ~ : ~D ~ B ~D ~ V ~D ~ _ ~D ~  ~E6 ~  ~EF ~  ~E~ ~ > ~E ~ | ~E ~  ~Enode2tuple$.frameresult.safecol_offset linenoiaddelemvnmkseqparser_compare_nodes.framejleftrightZparser_compare .framerightleftparser_newstobject .frametypeostparser_free.framestparser_st2tuple<.framecol_offsetlinenoself rescol_optionline_optionkwargs8parser_ast2tuple.framekwargsselfparser_st2list<.framecol_offsetlinenoself rescol_optionline_optionkwargsparser_ast2list.framekwargsself(parser_compilest4.framearenaselfstrreskwargs.parser_compileast.framekwargsselfparser_isexpr$.frameselfreskwargs%parser_issuite$.frameselfreskwargsparser_getattr.framenameselferr_string .framemessageparser_do_parseH.frame(err typeargspeckwargs flagsresstringparser_expr.framekwargsparser_suite.framekwargs2parser_tuple2st(.frame treetuplekwargsstparser_tuple2ast.framekwargsselfparser_sizeof .framest3build_node_children@.frame new_childrootline_num(o$temp errokstrntypeelemi lentuple build_node_tree(.frameerrlenencodingline_numtemp numtupleresvalidate_ntype.frametnvalidate_numnodes.framenamenumn(validate_terminal.frameresstringtypeterminalvalidate_repeating_list.frame pos nameresvfuncntypenchtreevalidate_class.frameresnchtree7validate_if.frame jresnchtreevalidate_parameters.frameresnchtreevalidate_suite.frame inchtreevalidate_testlist.frametreevalidate_testlist1.frametreevalidate_testlist_safe.frametree4validate_varargslist_trailer.frameresstarttreevalidate_varargslist .frameresinchtreeYvalidate_list_iter.frametreevalidate_comp_iter.frametree[validate_list_for.frametree2validate_comp_for.frametree validate_list_if.frametreevalidate_comp_if.frametree)validate_fpdef.framenchtree validate_fplist.frametree;validate_stmt.frametreevalidate_simple_stmt.frame inchtreeHvalidate_small_stmt.frameresnchtree'validate_compound_stmt.framerestreevalidate_yield_or_testlist.frametree)validate_expr_stmt .framej ressnchtree validate_print_stmt$.frameallow_trailing_commainchtreeKvalidate_del_stmt.frametree»validate_return_stmt.framenchtreeHvalidate_raise_stmt.frameresnchtree6validate_yield_expr.framenchtreevalidate_yield_stmt.frametree$validate_import_as_name.framenchtree validate_dotted_name.frame inchtreevalidate_dotted_as_name.frameresnchtreevalidate_dotted_as_names.frame inchtreeɴvalidate_import_as_names.frame inchtreeQvalidate_import_name.frametreecount_from_dots.frametree validate_import_from$.frameoffset havenamendotsnchtree+validate_import_stmt.frameresnchtreevalidate_global_stmt.framej resnchtree9validate_exec_stmt.frameresnchtreeоvalidate_assert_stmt.frameresnchtreevalidate_while.framenchtree$validate_for.framenchtreevalidate_try$.frame res.safeposnchtreeٴvalidate_except_clause.framenchtreevalidate_test.framenchtree&validate_old_test.framenchtreeܙvalidate_or_test.frame posnchtreepvalidate_and_test.frameposnchtree:validate_not_test.framenchtreevalidate_comparison.frameposnchtreeߦvalidate_comp_op.framenchrestreevalidate_expr.framejnchtreevalidate_xor_expr.framejnchtreevalidate_and_expr.frameposnchtreewvalidate_chain_two_ops.frame op2op1termvalidnchpostreeKvalidate_shift_expr.frametreevalidate_arith_expr.frametreevalidate_term.framenchpostreevalidate_factor.framenchtreevalidate_power.framenchpostreevalidate_atom.framepos resnchtreevalidate_listmaker.frame inchoktreevalidate_testlist_comp.frame inchoktreeCvalidate_decorator.framenchtreevalidate_decorators.frameinchtreevalidate_with_item.framenchtreevalidate_with_stmt.frameinchtreevalidate_funcdef.framenchtreevalidate_decorated.framenchtreevalidate_lambdef.frameresnchtreevalidate_old_lambdef.frameresnchtree9validate_arglist .frame okinchtreevalidate_argument.framenchtreevalidate_trailer.frameresnchtreeFvalidate_subscriptlist.frametreetvalidate_subscript .frameremnchoffsettreevalidate_sliceop.frameresnchtreevalidate_exprlist.frametreevalidate_dictorsetmaker .frameokcheck_trailing_comma inchtreevalidate_eval_input.frameposnchtreevalidate_node.frameres nextnchtree validate_expr_tree .framerestree Cvalidate_file_input.frame resjnchtree =validate_encoding_decl.framerestree parser__pickler(.frametuplenewargsargs empty_dictstresult initparser,.framepickler funccopyregmodule ~ ~  * , +  ,  6J   g ( o  }   a   5  CIJTW Xp q5 "  %=b  + ' !! ) """"Q + S##  -## A 8 B$$ T 9 V % %n   % %&& % % % %e %; %j"" %@ %'' %J %(( %M %((3(({ %Z %)) %u %*** * % % % %++ % % G  , ,  # , , , , N  - -? % %V -3 - -s - O  .j . . . . . . .+ . . . . . . . . . . . .6 . .? . . .= . .F . .P . .^ .. . .? . .E Q H / / -s - /a / / / / /  / / / /9 /0 /\ /^ /b R d 0 0| 0 0 0" 0 T  1 1 18 122  1 1 ' 1 1!( 1 1!6 1 1!U 1 1!c 1 1!i 1 1!y 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"5 1 1"< 1' 1"D 10 1"I 15 1"P 1I 1"\ 1i 1"c 1q 1"k 1z 1"p 1 1"w 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#( 1 1#1 1 1#@ 1 1#H 1 1#Q 1 1#Z 1 1#b 1 1#m 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$+ 3< 3$3 3F 3$7 3J 3$@ W $A 4 4$R 4 4$f X $g 5 5$v 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%% Z %' 7 7%K 7' 7%_ 7; 7%h \ %x 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&! 9 9&) 9 9&3 9 9&< _ &= : :&U :5 :&_ :@ :&k ` &l ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '# ? ?'1 ?& ?'8 ?- ?'Q e 'h @7 @'o @E @'w @O @'{ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (+ C  C(A C# C(H C* C(a CF C(z i ({ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)$ l )% G G)7 G G)C G G)^ G; G)b G@ G)h GG G)m GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*4 q *5 L L*R r *S M M*k s *l N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+& Q Q+* Q% Q+< Q9 Q+M QP Q+T w +a R R+h R/ R+o R= R+x RM R+ R[ R+ R R+ R R+ y + S S,6 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-X TC T-l T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V., Vm V.= V V.E  .Q W  W.y W5 W. We W. W W.  . X X/  X X/ X% X/- X5 X/B Xt X/V X X/h  /i Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0& \- \0. \9 \04 \E \0: \R \0A \_ \0M \p \0_ \ \0d \ \0i \ \0s \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1* \ \1/ \ \14 \ \19 \ \1> \  \1C \ \1H \ \1M \) \1R \3 \1] \T \1b \[ \1g \f \1n \r \1s \{ \1x \ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2' \ \2, \ \20 \ \28 \ \2B \ \2G \ \2N \ \2S \ \2Z \ \2_ \ \2l \ \2r \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]38  39 _ _3S  3U ` `3d ` `3t  3u a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4D d d4E4` d d4a''4 d d4 d d4  4 ~ ~4 ~C ~5 ~J ~5 ~S ~5 ~ ~5 ~ ~5 ~ ~5 ~ ~5 ~ ~5 ~ ~5 ~ ~5 ~ ~5 ~ ~5 ~ ~5 ~& ~5 ~( ~5 ~* ~5 ~, ~5 ~. ~5 ~0 ~5 ~2 ~5 ~6 ~5 ~8 ~5 ~: ~6Y ~ ~7  ~W ~7 ~ ~7op_isCallable.framexop_sequenceIncludes.frameobseqVisCallable .framea1|isNumberType .framea1truth .framea1op_add$.framea2a1a%op_sub$.framea2a1aop_mul$.framea2a1aop_div$.framea2a1a 3J 3$G W $H 4 4$Y 4 4$m X $n 5 5$} 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6% 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%# 6 6%, Z %. 7 7%R 7' 7%f 7; 7%o \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&# 9 9&( 9 9&0 9 9&: 9 9&C _ &D : :&\ :5 :&f :@ :&r ` &s ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'$ d '* ? ?'8 ?& ?'? ?- ?'X e 'o @7 @'v @E @'~ @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(& h (2 C  C(H C# C(O C* C(h CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)! FK F)+ l ), G G)> G G)J G G)e G; G)i G@ G)o GG G)t GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*" K K*; q *< L L*Y r *Z M M*r s *s N N* t * O O* O, O* u * P P+  P P+ v + Q Q+! Q Q+& Q Q+- Q Q+1 Q% Q+C Q9 Q+T QP Q+[ w +h R R+o R/ R+v R= R+ RM R+ R[ R+ R R+ R R+ y + S S,= Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S-- S@ S- z - T T-_ TC T-s T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-. V V.3 Vm V.D V V.L  .X W  W. W5 W. We W. W W/  / X X/ X X/% X% X/4 X5 X/I Xt X/] X X/o  /p Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0- \- \05 \9 \0; \E \0A \R \0H \_ \0T \p \0f \ \0k \ \0p \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1+ \ \11 \ \16 \ \1; \ \1@ \ \1E \  \1J \ \1O \ \1T \) \1Y \3 \1d \T \1i \[ \1n \f \1u \r \1z \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2 \g \2  \o \2 \v \2 \} \2. \ \23 \ \27 \ \2? \ \2I \ \2N \ \2U \ \2Z \ \2a \ \2f \ \2s \ \2y \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3?  3@ _ _3Z  3\ ` `3k ` `3{  3| a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4K d d4L4g d d4h''4 d d4 d d4  4 ~8 ~4 ~ ~5 ~) ~5 ~E ~50 ~] ~5A ~ ~5n ~ ~5 ~ ~5 ~  ~5 ~I ~5 ~m ~6 ~ ~6$ ~ ~6, ~ ~6E ~ ~6q ~ ~6 ~6 ~6 ~h ~6 ~ ~6 ~ ~6 ~ ~7  ~ ~76 ~( ~79 ~+ ~7; ~- ~7= ~/ ~7? ~1 ~7A ~3 ~7C ~6 ~7E ~8 ~7G ~; ~7I ~= ~7K ~? ~7M ~A ~7O ~C ~7Q ~E ~7S ~G ~7U ~K ~7W ~M ~7Y ~P ~7[ ~R ~7] ~T ~7_ ~W ~7a ~Y ~7c ~[ ~7e ~] ~7g ~_ ~7l ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~% ~8 ~> ~8: ~w ~8C ~ ~8M ~ ~8Z ~ ~8h ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~  ~8 ~6 ~8 ~? ~9 ~a ~9= ~ ~9N ~ ~9t ~ ~9z ~ ~9 ~ ~9 ~ ~9 ~ ~9 ~  ~9 ~ ~9 ~I ~9-sinpi0.framery.safex/%lanczos_sum.framexdennum/m_tgammaT.frame(sqrtpow z0qyrabsx@.safex3nm_lgammaL.framer@.safeabsxx5m_erf_series4.frame result(saved_errnofkaccx2x60m_erfc_contfracd.frameHresultPsaved_errnoXtemp@b8q_last0q(p_last pdaax2x7Dm_erf.framecfabsxx7m_erfc.framecfabsxx8Dm_atan2.frameyx9m_log.framex:em_log10.framex;#is_error.framexresult;math_1 .framecan_overflow.saferfuncxarg=5math_2<.frame(.safe rfuncyxoyoxfuncnameargs@emath_acos.frameargs@math_acosh.frameargs@math_asin.frameargs@math_asinh.frameargs@math_atan.frameargsAmath_atan2.frameargsA>math_atanh.frameargsAbmath_ceil.frameargsAmath_copysign.frameargsAmath_cos.frameargsAmath_cosh.frameargsAmath_erf .frameargsBmath_erfc .frameargsB,math_exp.frameargsBQmath_expm1.frameargsBvmath_fabs.frameargsBmath_floor.frameargsBmath_gamma .frameargsBmath_lgamma .frameargsBmath_log1p.frameargsCmath_sin.frameargsC?math_sinh.frameargsCdmath_sqrt.frameargsCmath_tan.frameargsCmath_tanh.frameargsC_fsum_realloc.framevmpsp_ptrn m_ptrDmath_fsum|.framehlo`yrXhi4tp.safe,yji@xsave$xitemiterseqPinf_sumHspecial_sum8p4psmn sumJ math_factorial0.framenewresultiobji resultxlx dxargL math_trunc.framenumberL.math_frexp .frame.safei xargMXmath_ldexp8.frame$.saferexpoverflowoexpxargsOmath_modf0.framey.safexargQiloghelper$.frame.safefuncx eargRlmath_log0.frameansden numargargsbaseSmath_log10.frameargSmath_fmod<.frame(.safer yxoyoxargsUmath_hypot<.framer(.safe yxoyoxargsXZmath_pow@.frame,.safer yxoyoxargs\math_degrees.framexarg]'math_radians.framexarg]pmath_isnan.frame .safexarg]math_isinf.frame .safexarg^initmath .frame.safem ~ ~  * , +  ,  6J   g ( o  }   a   5  CIJTW Xp q5 "  %=b  + ' !! ) """"Q + S##  -## A 8 B$$ T 9 V % %n   % %&& % % % %e %; %j"" %@ %'' %J %(( %M %((3(({ %Z %)) %u %*** * % % % %++ % % G  , ,  # , , , , N  - -? % %V -3 - -s - O  .j . . . . . . .+ . . . . . . . . . . . .6 . .? . . .= . .F . .P . .^ .. . .? . .E Q H / / -s - /a / / / / /  / / / /9 /0 /\ /^ /b R d 0 0| 0 0 0" 0 T  1 1 18 122  1 1 ' 1 1!( 1 1!6 1 1!U 1 1!c 1 1!i 1 1!y 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"5 1 1"< 1' 1"D 10 1"I 15 1"P 1I 1"\ 1i 1"c 1q 1"k 1z 1"p 1 1"w 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#( 1 1#1 1 1#@ 1 1#H 1 1#Q 1 1#Z 1 1#b 1 1#m 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$+ 3< 3$3 3F 3$7 3J 3$@ W $A 4 4$R 4 4$f X $g 5 5$v 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%% Z %' 7 7%K 7' 7%_ 7; 7%h \ %x 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&! 9 9&) 9 9&3 9 9&< _ &= : :&U :5 :&_ :@ :&k ` &l ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '# ? ?'1 ?& ?'8 ?- ?'Q e 'h @7 @'o @E @'w @O @'{ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (+ C  C(A C# C(H C* C(a CF C(z i ({ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)$ l )% G G)7 G G)C G G)^ G; G)b G@ G)h GG G)m GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*4 q *5 L L*R r *S M M*k s *l N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+& Q Q+* Q% Q+< Q9 Q+M QP Q+T w +a R R+h R/ R+o R= R+x RM R+ R[ R+ R R+ R R+ y + S S,6 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-X TC T-l T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V., Vm V.= V V.E  .Q W  W.y W5 W. We W. W W.  . X X/  X X/ X% X/- X5 X/B Xt X/V X X/h  /i Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0& \- \0. \9 \04 \E \0: \R \0A \_ \0M \p \0_ \ \0d \ \0i \ \0s \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1* \ \1/ \ \14 \ \19 \ \1> \  \1C \ \1H \ \1M \) \1R \3 \1] \T \1b \[ \1g \f \1n \r \1s \{ \1x \ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2' \ \2, \ \20 \ \28 \ \2B \ \2G \ \2N \ \2S \ \2Z \ \2_ \ \2l \ \2r \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]38  39 _ _3S  3U ` `3d ` `3t  3u a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4D d d4E4` d d4a''4 d d4 d d4  4 ~ ~4  45   56 G 5W ~  ~5 ~ ~6 ~G ~7 ~R ~7 ~ ~8_ ~ ~8 ~ ~9u ~8 ~:* ~ ~:2 ~ ~: ~ ~;* ~  ~;I ~2 ~; ~ ~; ~ ~< ~ ~< ~ ~< ~ ~< ~ ~= ~ ~= ~ ~= ~ ~= ~ ~= ~ ~= ~ ~= ~ ~>d ~ ~ ~>h ~  ~>m ~  ~>r ~  ~>x ~  ~> ~  ~> ~  ~?q ~  ~?~ ~  ~? ~  ~? ~ 4 ~@  ~ O ~@ ~  ~A( ~ p ~Aa ~  ~A ~  ~A ~  ~B  ~ i ~B  B ~  ~Ck ~" ~C ~ ~D  D ~ ~E ~ ~E ~ ~E^groupby_new(.framegbotypeitkwdsargs keyfunc_groupby_dealloc.framegbo`groupby_traverse.framevisitarggboa{groupby_next(.frame rgroupernewvaluegboc9_grouper_create .frameigotgtkeyparentc{_grouper_dealloc.frameigoc_grouper_traverse.framevisitargigod;_grouper_next(.framernewvaluegboigoe;teedataobject_new .frametdoiteteedataobject_jumplink.frametdoeteedataobject_getitem .frametdoifteedataobject_traverse.frameivisitargtdofteedataobject_safe_decref .framenextlinkobjgteedataobject_clear.frameitdogteedataobject_dealloc.frametdogtee_next.framelinktohjtee_traverse.framevisitargtohtee_copy .framenewtotohtee_fromiterable.frametoititerableitee_new.frameiterableargsj&tee_clear .frametojotee_dealloc.frametojtee,.frameicopyable itresultiterableargsnlFcycle_new(.frame savedititerableargskwdstypemocycle_dealloc.framelzmcycle_traverse.framevisitarglznEcycle_next.frameitemlzo:dropwhile_new,.frame itseqfuncargskwdstypep$dropwhile_dealloc.framelzpdropwhile_traverse.framevisitarglzpdropwhile_next$.frameokgooditemiternext itlzqtakewhile_new,.frame itseqfuncargskwdstypertakewhile_dealloc.framelzs`takewhile_traverse.framevisitarglzstakewhile_next .frameokgooditemlztislice_newL.frameitseqargskwdstype a3a2a1step stopstartwLislice_dealloc.framelzwislice_traverse.framevisitarglzwislice_next.frameiternext stopitlzxstarmap_new,.frame itseqfuncargskwdstypeystarmap_dealloc.framelzystarmap_traverse.framevisitarglzzYstarmap_next .frameresultnewargsargslz{imap_new$.frameiitersnumargsargskwdstype|5imap_dealloc.framelz|imap_traverse.framevisitarglz} imap_next$.frame resultiargtuplenumargslz}chain_new_internal.framesourcetype~1chain_new.frameargskwdstype~chain_new_from_iterable.frametypearg~chain_dealloc.framelz3chain_traverse.framevisitarglzchain_next.frameiterablelzproduct_new@.frametypeiindices npoolsnargsargs(tmpargs$kwlistkwdspoolsrepeatproduct_dealloc.framelzproduct_traverse.framevisitarglzproduct_next,.frameiresult$old_result indicesnpoolspoolslzcombinations_new8.frametypenpool rkwdsargsindicesiterable)combinations_dealloc.framecocombinations_traverse.framevisitargcocombinations_next4.frame iresult,old_resultrnindices poolcocwr_new8.frametypenpool rkwdsargsindicesiterableHcwr_dealloc.framecocwr_traverse.framevisitargco5cwr_next4.frame iresult,old_resultrnindices poolcopermutations_new@.frametype rnpoolkwdsargs cyclesindicesiterablerobjpermutations_dealloc.framepopermutations_traverse.framevisitargpopermutations_next<.frameelem,k$i0indexresult4old_result rncyclesindices poolpo=compress_new0.frametype dataseq2seq1kwdsargsselectors3compress_dealloc.framelzcompress_traverse.framevisitarglz compress_next$.frameokselector datumselectornextselectorsdatanextdatalzifilter_new,.frame itseqfuncargskwdstypeifilter_dealloc.framelzPifilter_traverse.framevisitarglzifilter_next$.framegood okitemiternextitlzifilterfalse_new,.frame itseqfuncargskwdstypeifilterfalse_dealloc.framelz#ifilterfalse_traverse.framevisitarglz~ifilterfalse_next$.framegood okitemiternextitlzcount_new4.frametype cntkwdsargslong_steplong_cntslow_modecount_dealloc.framelzmcount_traverse.framevisitarglzcount_nextlong.framelong_cntlz$count_next.framelzScount_repr.framecnt_repr resultstep_reprlztcount_reduce.framelzizip_new,.frameresulti ittuplekwdstypetuplesizeargsizip_dealloc.framelzizip_traverse.framevisitarglz\izip_next .framei resulttuplesizelzrepeat_new(.frametypeelementkwdsargs cnt6repeat_dealloc.framerorepeat_traverse.framevisitargrorepeat_next.framerorepeat_repr.frameresultobjreprroqrepeat_len .frameroizip_longest_new0.frameresulttypei ittupletuplesizekwdsargsfillvalueizip_longest_dealloc.framelzoizip_longest_traverse.framevisitarglzizip_longest_next .frameitemiti resulttuplesizelzUinititertoolst.frameim\typelist ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4  5 % 5  ~ ~5  ~ ~55E ~  ~5U ~ ~5W5^55 ~  ~5 ~ ~67 ~ ~6: ~ ~6= ~ ~6B ~ ~6Q mkgrent .framexmemberp wvsetIndexgrp_getgrgid.framegidpy_int_idpyo_idgrp_getgrnam.frame pnamepy_str_namepyo_nameHgrp_getgrall.frame vdinitgrp .framed ~+ ~   / , 0  1  ;O   l ( t     a   :  HNOY\ ]u v5  " %*Bg  + ' !! ) "" """V + X##  2## F 8 G$$ Y 9 [ % %s   % %&& % % % %j %; %o"" %@ %'' %J %(( %M %(( 8(( %Z %)) %u %*** * % % % %++ % % G  , ,  ( , , , , N  - -D % %[ -3 - -s - O  .j . . . . . . .0 . . . . . . . . . .  . .; . .D . . .= .  .F . .P .! .^ .3 . .D . .J Q M / / -s - /a / / / / / / / / /> /0 /a /^ /g R i 0 0 0 0 0" 0 T  1 1 18 122 $ 1 1 , 1 1!- 1 1!; 1 1!Z 1 1!h 1 1!n 1 1!~ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1": 1 1"A 1' 1"I 10 1"N 15 1"U 1I 1"a 1i 1"h 1q 1"p 1z 1"u 1 1"| 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1## 1x 1#- 1 1#6 1 1#E 1 1#M 1 1#V 1 1#_ 1 1#g 1 1#r 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$0 3< 3$8 3F 3$< 3J 3$E W $F 4 4$W 4 4$k X $l 5 5${ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%! 6 6%* Z %, 7 7%P 7' 7%d 7; 7%m \ %} 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&! 9 9&& 9 9&. 9 9&8 9 9&A _ &B : :&Z :5 :&d :@ :&p ` &q ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'" d '( ? ?'6 ?& ?'= ?- ?'V e 'm @7 @'t @E @'| @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B($ h (0 C  C(F C# C(M C* C(f CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)) l )* G G)< G G)H G G)c G; G)g G@ G)m GG G)r GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*  K K*9 q *: L L*W r *X M M*p s *q N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+$ Q Q++ Q Q+/ Q% Q+A Q9 Q+R QP Q+Y w +f R R+m R/ R+t R= R+} RM R+ R[ R+ R R+ R R+ y + S S,; Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-] TC T-q T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.1 Vm V.B V V.J  .V W  W.~ W5 W. We W. W W.  / X X/ X X/# X% X/2 X5 X/G Xt X/[ X X/m  /n Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0+ \- \03 \9 \09 \E \0? \R \0F \_ \0R \p \0d \ \0i \ \0n \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1/ \ \14 \ \19 \ \1> \ \1C \  \1H \ \1M \ \1R \) \1W \3 \1b \T \1g \[ \1l \f \1s \r \1x \{ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2, \ \21 \ \25 \ \2= \ \2G \ \2L \ \2S \ \2X \ \2_ \ \2d \ \2q \ \2w \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3=  3> _ _3X  3Z ` `3i ` `3y  3z a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4I d d4J4e d d4f''4 d d4 d d4  4 ~- ~5qtest.frameryprinterr .framernest1.frame.safexai*nest2.frame.safexainest3.frame.saferesultxdb0.frame.safeax%overflow.frame.safeabinitfpetest .framed ~? ~   3 , 4  5  ?S   p ( x     a   >  LRS]` ay z5$ " ).Fk  + ' !! )  ""&""Z + \##  6## J 8 K$$ ] 9 _ % %w   % %&& % % % %n %; %s"" %@ %'' %J %(( %M %(($<(( %Z %)) %u %*** * % % % %++ % % G  , ,  , , , , , N  - -H % %_ -3 - -s - O  .j . . . . . . .4 . . . . . . . . . .  . .? . .H . .  .= . .F . .P .% .^ .7 . .H . .N Q Q / / -s - /a / / /  / / / / / /B /0 /e /^ /k R m 0 0 0 0 0" 0 T  1 1 18 122 ( 1 1 0 1 1!1 1 1!? 1 1!^ 1 1!l 1 1!r 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"> 1 1"E 1' 1"M 10 1"R 15 1"Y 1I 1"e 1i 1"l 1q 1"t 1z 1"y 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#' 1x 1#1 1 1#: 1 1#I 1 1#Q 1 1#Z 1 1#c 1 1#k 1 1#v 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $  3 3$ 3  3$4 3< 3$< 3F 3$@ 3J 3$I W $J 4 4$[ 4 4$o X $p 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6% 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6%% 6 6%. Z %0 7 7%T 7' 7%h 7; 7%q \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&% 9 9&* 9 9&2 9 9&< 9 9&E _ &F : :&^ :5 :&h :@ :&t ` &u ; ;& a & < <& b & = =&& = =& =2 =& c ' > >' >  >'  >& >'& d ', ? ?': ?& ?'A ?- ?'Z e 'q @7 @'x @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(( h (4 C  C(J C# C(Q C* C(j CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)# FK F)- l ). G G)@ G G)L G G)g G; G)k G@ G)q GG G)v GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*$ K K*= q *> L L*[ r *\ M M*t s *u N N* t * O O* O, O* u * P P+  P P+ v + Q Q+# Q Q+( Q Q+/ Q Q+3 Q% Q+E Q9 Q+V QP Q+] w +j R R+q R/ R+x R= R+ RM R+ R[ R+ R R+ R R+ y + S S,? Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S- z -  T T-a TC T-u T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-. V V.5 Vm V.F V V.N  .Z W  W. W5 W. We W. W W/  / X X/ X X/' X% X/6 X5 X/K Xt X/_ X X/q  /r Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0/ \- \07 \9 \0= \E \0C \R \0J \_ \0V \p \0h \ \0m \ \0r \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1( \ \1- \ \13 \ \18 \ \1= \ \1B \ \1G \  \1L \ \1Q \ \1V \) \1[ \3 \1f \T \1k \[ \1p \f \1w \r \1| \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2  \g \2 \o \2 \v \2 \} \20 \ \25 \ \29 \ \2A \ \2K \ \2P \ \2W \ \2\ \ \2c \ \2h \ \2u \ \2{ \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3  ^Y ^3 ^b ^3 ] ]3A  3B _ _3\  3^ ` `3m ` `3}  3~ a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4M d d4N4i d d4j''4 d d4 d d4  4 ~E ~4ee5O ~S ~5 ~ ~6$Eturnon_sigfpe.framedfpe_reset .frameturnoff_sigfpe .framesigfpe_handler .frameinitfpectl .framed ~ ~  . , /  0  :N   k ( s     a   9  GMNX[ \t u5 " $)Af  + ' !! ) "" !""U + W##  1## E 8 F$$ X 9 Z % %r   % %&& % % % %i %; %n"" %@ %'' %J %(( %M %((7(( %Z %)) %u %*** * % % % %++ % % G  , ,  ' , , , , N  - -C % %Z -3 - -s - O  .j . . . . . . ./ . . . . . . . . . . . .: . .C . . .= .  .F . .P .  .^ .2 . .C . .I Q L / / -s - /a / / / / / / / / /= /0 /` /^ /f R h 0 0 0 0 0" 0 T  1 1 18 122 # 1 1 + 1 1!, 1 1!: 1 1!Y 1 1!g 1 1!m 1 1!} 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"9 1 1"@ 1' 1"H 10 1"M 15 1"T 1I 1"` 1i 1"g 1q 1"o 1z 1"t 1 1"{ 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#" 1x 1#, 1 1#5 1 1#D 1 1#L 1 1#U 1 1#^ 1 1#f 1 1#q 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$/ 3< 3$7 3F 3$; 3J 3$D W $E 4 4$V 4 4$j X $k 5 5$z 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%  6 6%) Z %+ 7 7%O 7' 7%c 7; 7%l \ %| 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9&  9 9&% 9 9&- 9 9&7 9 9&@ _ &A : :&Y :5 :&c :@ :&o ` &p ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'! d '' ? ?'5 ?& ?'< ?- ?'U e 'l @7 @'s @E @'{ @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(# h (/ C  C(E C# C(L C* C(e CF C(~ i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)( l )) G G); G G)G G G)b G; G)f G@ G)l GG G)q GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K* K K*8 q *9 L L*V r *W M M*o s *p N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+# Q Q+* Q Q+. Q% Q+@ Q9 Q+Q QP Q+X w +e R R+l R/ R+s R= R+| RM R+ R[ R+ R R+ R R+ y + S S,: Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-\ TC T-p T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.0 Vm V.A V V.I  .U W  W.} W5 W. We W. W W.  . X X/ X X/" X% X/1 X5 X/F Xt X/Z X X/l  /m Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0* \- \02 \9 \08 \E \0> \R \0E \_ \0Q \p \0c \ \0h \ \0m \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1( \ \1. \ \13 \ \18 \ \1= \ \1B \  \1G \ \1L \ \1Q \) \1V \3 \1a \T \1f \[ \1k \f \1r \r \1w \{ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2+ \ \20 \ \24 \ \2< \ \2F \ \2K \ \2R \ \2W \ \2^ \ \2c \ \2p \ \2v \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3  ^b ^3 ] ]3<  3= _ _3W  3Y ` `3h ` `3x  3y a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4H d d4I4d d d4e''4 d d4 d d4  4 ~ ~44 ~  ~5ww557w w5k ~ ~5 ~[ ~5 ~q ~6  ~ ~6X ~0 ~6 ~ ~6 ~ ~7|yconv_descriptor .frametargetobjectfcntl_fcntl<.frame argret_savebuflenstrcodefdargsfcntl_ioctlL.frameret(_save$argbuflenstrcodefdargsmutate_argfcntl_flock@.frame ret(_save$lcodefdargsZfcntl_lockfX.frame ret4_save0lcodefdargsstartobjlenobjwhenceĜins.framevsymboldvalueall_ins.framedinitfcntl .frame ~ ~  . , /  0  :N   k ( s     a   9  GMNX[ \t u5 " $)Af  + ' !! ) "" !""U + W##  1## E 8 F$$ X 9 Z % %r   % %&& % % % %i %; %n"" %@ %'' %J %(( %M %((7(( %Z %)) %u %*** * % % % %++ % % G  , ,  ' , , , , N  - -C % %Z -3 - -s - O  .j . . . . . . ./ . . . . . . . . . . . .: . .C . . .= .  .F . .P .  .^ .2 . .C . .I Q L / / -s - /a / / / / / / / / /= /0 /` /^ /f R h 0 0 0 0 0" 0 T  1 1 18 122 # 1 1 + 1 1!, 1 1!: 1 1!Y 1 1!g 1 1!m 1 1!} 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"9 1 1"@ 1' 1"H 10 1"M 15 1"T 1I 1"` 1i 1"g 1q 1"o 1z 1"t 1 1"{ 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#" 1x 1#, 1 1#5 1 1#D 1 1#L 1 1#U 1 1#^ 1 1#f 1 1#q 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$/ 3< 3$7 3F 3$; 3J 3$D W $E 4 4$V 4 4$j X $k 5 5$z 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%  6 6%) Z %+ 7 7%O 7' 7%c 7; 7%l \ %| 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9&  9 9&% 9 9&- 9 9&7 9 9&@ _ &A : :&Y :5 :&c :@ :&o ` &p ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'! d '' ? ?'5 ?& ?'< ?- ?'U e 'l @7 @'s @E @'{ @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(# h (/ C  C(E C# C(L C* C(e CF C(~ i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)( l )) G G); G G)G G G)b G; G)f G@ G)l GG G)q GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K* K K*8 q *9 L L*V r *W M M*o s *p N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+# Q Q+* Q Q+. Q% Q+@ Q9 Q+Q QP Q+X w +e R R+l R/ R+s R= R+| RM R+ R[ R+ R R+ R R+ y + S S,: Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-\ TC T-p T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.0 Vm V.A V V.I  .U W  W.} W5 W. We W. W W.  . X X/ X X/" X% X/1 X5 X/F Xt X/Z X X/l  /m Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0* \- \02 \9 \08 \E \0> \R \0E \_ \0Q \p \0c \ \0h \ \0m \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1( \ \1. \ \13 \ \18 \ \1= \ \1B \  \1G \ \1L \ \1Q \) \1V \3 \1a \T \1f \[ \1k \f \1r \r \1w \{ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2+ \ \20 \ \24 \ \2< \ \2F \ \2K \ \2R \ \2W \ \2^ \ \2c \ \2p \ \2v \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3  ^b ^3 ] ]3<  3= _ _3W  3Y ` `3h ` `3x  3y a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4H d d4I4d d d4e''4 d d4 d d4  4 ~ ~54 V V5< ~  ~5=  5G5i  5 G 5 ~  ~5((5 ~  ~6  6 ~ ~6#  6D = 6M K 6\ ] 6d f 6  6  7& ~c ~79 ~ ~7K ~ ~7Z ~ ~7j ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~& ~7 ~6 ~7 ~W ~7 ~l ~8 ~z ~8 ~ ~8= ~ ~8M ~ ~8T ~ ~8Z ~ ~8a ~ ~8h ~ ~8n ~ ~8s ~ ~8w ~ ~8 ~3 ~8 ~< ~8 ~\ ~8 ~ ~8 ~ ~8 ~ ~9 ~ ~9. ~ ~9N ~ ~9\ ~  ~9n ~ ~9} ~4 ~9 ~P ~9 ~u ~9 ~} ~9 ~ ~9 ~ ~: ~ ~:  ~ ~:% ~ ~:< ~ ~:[ ~7 ~:s ~W ~: ~ ~: ~ ~: ~ ~: ~ ~;  ~ ~;3 ~* ~;y ~r ~; ~ ~; ~ ~; ~ ~; ~ ~<  ~ ~<[ ~_ ~< ~ ~< ~ ~< ~ ~< ~ ~< ~ ~< ~ ~=  ~4 ~=; ~U ~=Q ~m ~= ~ ~> ~ ~? ~ % ~? ~ 5 ~?! ~ I ~?= ~ g ~?^ ~  ~? ~  ~@ ~ 1 ~@o ~  ~@t ~  ~@x ~  ~@ ~  ~@ ~  ~@ ~  ~@ ~  ~@ ~  ~AV ~  ~A ~  ~A ~  ~B ~ A ~BD ~  ~BP ~  ~Bf ~  ~B ~  ~B ~  ~B ~ $ ~B ~ / ~C ~ c ~CG ~  ~CV ~  ~Cs ~  ~C ~  ~C ~! ~C ~N ~DF ~ ~DQ ~ ~Df ~ ~Dv ~ ~D{ ~ ~D ~ ~D ~ ~D ~  ~D ~( ~E ~i ~E  ~t ~ES ~ ~E_ ~ ~Ex ~ ~E~ ~ ~E ~ ~E ~7 ~E ~B ~F9 ~ ~FC ~ ~FZ ~ ~F ~ ~G ~ ~G ~ ~G% ~ ~G< ~ ~GE ~ ~GR ~ ~G~ ~  ~G ~ ~G ~, ~G ~G ~G ~ ~G ~ ~H ~ ~H ~ ~H ~ ~H ~# ~H ~2 ~H ~ ~Hdivmod.frameryxCround_to_long.frame.safexȣis_leap.frame .safeyeardays_in_month.frameyearmonth*days_before_month .frameyeardaysmonth_days_before_year .frame.safeyearord_to_ymd(.framepreceding daynyear .safemonthordinal8ymd_to_ord.frameday.safemonthyearkweekday.frame.safedaymonthyearˠiso_week1_monday .frame.safeyearcheck_delta_day_range.framedays-check_date_args .framedaymonthyearcheck_time_args .frame ussmhznormalize_pair.framehilofactorʹnormalize_d_s_us.framedsusnormalize_y_m_d.framedymφnormalize_date.framedaymonthyearϩnormalize_datetime.framemonthyearday hourminutemicrosecondsecond@time_alloc .frametypeaware}datetime_alloc .frametypeawareкset_date_fields.frame dmselfynew_date_ex.framedaymonthyearself type?new_datetime_ex.framesecondminute houruseconddaymonthyearselfawaretzinfo typenew_time_ex.framesecondminutehour usecondawaretzinfotypeҵnew_delta_ex.frametypemicrosecondssecondsdays normalize2check_tzinfo_subclass.framepӘcall_tzinfo_method.frametzinfoargmethnametzinfoget_tzinfo_member.frametzinfoself^call_utc_tzinfo_method$.framessutzinfoargnametzinfo noneresultcall_utcoffset.framenonetzinfoargtzinfo:offset_as_timedelta$.frame offsetnonetzinfoargnametzinfocall_dst.framenonetzinfoargtzinfo call_tzname.frameresulttzinfoargtzinfoװclassify_utcoffset.framenonetzinfoargopoffset؊classify_two_utcoffsets.frametzinfoarg2 tzinfoarg1n2n1offset2offset1o1.safeo2>append_keyword_tzinfo.frametemp .safereprtzinfoAformat_ctime.frame secondsminuteshoursbufferdateformat_utcoffset4.framesepbuflen minutes signbufoffsetnonetzinfoarg tzinfomake_freplacementT.frameD.safe@freplacementobjectwrap_strftime.frame4time4bigger0ntoappend8temptzinfoargbuftzinfoobject,ptoappendpinformat(usednew pnew$totalnewformat_len4year8pyyear timetuplenewfmtfreplacement Zreplacementzreplacementresultisoformat_date .framebufflenbufferdtisoformat_time$.framexbufflenbufferusdttime_time.frametimeresultbuild_struct_timeD.framedstflagssmm hh.safedmytimeresult diff_to_bool .frameopdiffcmperror.framebadelta_to_microseconds.framex1selfresult x3x2microseconds_to_delta_ex4.frametypesustemptuplepyusresultnummultiply_int_timedelta.frame resultpyus_outintobjpyus_indeltadivide_timedelta_int.frame resultpyus_outintobjpyus_indeltadelta_add(.frameresultrightlefthdelta_negative.frameselfdelta_positive.frameselfdelta_abs .frameselfdelta_subtract(.frameresultrightleftdelta_richcompare.frameotherselfopUdelta_hash .frametempselfdelta_multiply.frameresultleftright`delta_divide.frameresultrightleftaccum<.frametagleftover(y,.safe$xfracpart intpartdnumsumprodsofar factornumdelta_newd.frametype4temp8.safe(y$xkwargs0leftover_us weekhourminutemsus seconddayselfCdelta_nonzero.frameselfidelta_repr.frameselfdelta_str.framehoursminutesbuflen|pbufxbuf ussecondsdaysselfdelta_getstate.frameselfdelta_total_seconds.frametotal_seconds one_milliontotal_microsecondsselfdelta_reduce.frame.safeselfdate_year.frameselfdate_month.frameselfdate_day.frameselfdate_new<.framedaymonth yearkwmestateselfargstypeSdate_local_from_time_t$.frameclstts resultdate_today.frameresulttimeclsKdate_fromtimestamp.frameclstimestampargs resultdate_fromordinal,.frameclsdaymonth yearordinalargsresultBadd_date_timedelta(.framedaynegatedelta monthyearresultdatedate_add.framerightleftdate_subtract .frameleft_ordrightleftdate_repr(.framebufferselfdate_isoformat.framebufferself6date_str.frameself[date_ctime.frameselfdate_strftime,.frameresulttupleselfformat_len formatkwargsAdate_format.frameselfformatargsdate_isoweekday.frameselfTdate_isocalendar(.frameweekday todayweek1_mondayyearselfDdate_richcompare.frameopselfotherdate_timetuple .frameselfLdate_replace4.frameclonetuplekwargsdaymonth yearself2date_hash .frametempselfdate_toordinal.frame.safeselfdate_weekday.frameself date_getstate.frame.safeself :date_reduce.frame.safeself qtzinfo_nogo.framemethodname tzinfo_tzname.frame tzinfo_utcoffset.frame tzinfo_dst.frame tzinfo_fromutcX.frame resultusssmmhh dmy(dst$off,noneselfdt tzinfo_reduce,.framedictptrstategetstateargsgetinitargsself tmptime_hour.frameselftime_minute.frameselfpy_time_second.frameselftime_microsecond.frameself?time_tzinfo.frameself_time_newP.framekw me!awaretypestatetzinfousecondsecondminute hourselfargstime_dealloc.frameselftime_utcoffset.frameself time_dst.frameselfBtime_tzname .frameselfqtime_repr.framedbufferselftime_str.frameselftime_isoformat.frame.safehresultdbufselfpdatetimedatetimetime_strftime<.frameresulttupleselfformat_len formatkwargstime_richcompare<.frame n2offset2n1offset1selfopothertime_hash0.frame tempminuteoffsetselftime_replaceD.frameclonetuplekwargstzinfousssmm hhself4time_nonzero.frameoffsetnoneselftime_getstate.framebasestateselfresulttime_reduce.frame.safeselfdatetime_hour.frameselfdatetime_minute.frameselfdatetime_second.frameselfdatetime_microsecond.frameself;datetime_tzinfo.frameself[datetime_newh.framedaymonth yearkw,me-awaretypestate(tzinfo$usecond secondminutehourselfargsdatetime_from_timet_and_us4.frametzinfo usclsftimetresult datetime_from_timestamp(.frametzinfofcls fraction.safetimettimestamp!datetime_best_possible .frametzinfofclst!_datetime_now$.frameself tempclskwargstzinfo"Mdatetime_utcnow.framecls"rdatetime_fromtimestamp0.frameselftempcls timestampkwargstzinfo#wdatetime_utcfromtimestamp$.frameclstimestampargs result#datetime_strptimeh.framecls 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 ~ ~4 ~ ~5  ~) ~5 ~  ~5ii5p ~* ~5 ~@ ~5 ~{ ~5 ~ ~5 ~ ~5 ~ ~6  ~ ~60 ~ ~6A ~ ~6_ ~. ~6t ~F ~6x ~L ~6 ~e ~6 ~v ~6 ~ ~6 ~ ~6 ~ ~6 ~ ~7 ~ ~7 ~ ~7R ~I ~7c ~\ ~7p ~i ~7 ~{ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~ ~7 ~  ~8 ~! ~8 ~= ~86 ~X ~8_ ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~ ~8 ~! ~9 ~V ~9 ~` ~9! ~j ~9$ ~t ~9' ~~ ~9* ~ ~9- ~ ~90 ~ ~93 ~ ~96 ~ ~99 ~ ~9:DVspecial_type.framedE6c_acosT.frame s2s10r.ret@.safezGc_acoshL.frame s2s10r.ret8.safezIc_asin8.frame.ret rszIc_asinhT.frame s2s10r.ret@.safezLc_atan8.frame.ret rszLc_atan2.framezN>c_atanhX.framer hay.ret@.safezQc_cos(.frame.retrzQc_cosh<.framex_minus_one.retr(.safezUOc_exp<.framel.retr(.safezXc_logd.frame0an(am8hr ayax.retP.safez[c_log10,.frame.retzr\c_sin8.frame.ret rsz\\c_sinh<.framex_minus_one.retr(.safez_c_sqrt\.frame ds0ay(axr.retH.safezbdc_tan8.frame.ret rszbc_tanh\.frame8denom0txty(cx tytx.retH.saferzecmath_logH.frame(.safe yxargsgOmath_error .framegmath_18.frame(.safefunc rxargshcmath_acos .frameargshcmath_acosh .frameargsicmath_asin .frameargsi1cmath_asinh .frameargsiMcmath_atan .frameargsiicmath_atanh .frameargsicmath_cos .frameargsicmath_cosh .frameargsicmath_exp .frameargsicmath_log10 .frameargsicmath_sin .frameargsjcmath_sinh .frameargsj-cmath_sqrt .frameargsjIcmath_tan .frameargsjecmath_tanh .frameargsjcmath_phase,.frame .safephizargskgcmath_polar8.frame(.safer phizargslpcmath_rectD.framez0.safe phirargsocmath_isnan$.frame.safezargsp6cmath_isinf$.frame.safezargspinitcmath$.framep .safem ~ ~  * , +  ,  6J   g ( o  }   a   5  CIJTW Xp q5 "  %=b  + ' !! ) """"Q + S##  -## A 8 B$$ T 9 V % %n   % %&& % % % %e %; %j"" %@ %'' %J %(( %M %((3(({ %Z %)) %u %*** * % % % %++ % % G  , ,  # , , , , N  - -? % %V -3 - -s - O  .j . . . . . . .+ . . . . . . . . . . . .6 . .? . . .= . .F . .P . .^ .. . .? . .E Q H / / -s - /a / / / / /  / / / /9 /0 /\ /^ /b R d 0 0| 0 0 0" 0 T  1 1 18 122  1 1 ' 1 1!( 1 1!6 1 1!U 1 1!c 1 1!i 1 1!y 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"5 1 1"< 1' 1"D 10 1"I 15 1"P 1I 1"\ 1i 1"c 1q 1"k 1z 1"p 1 1"w 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#( 1 1#1 1 1#@ 1 1#H 1 1#Q 1 1#Z 1 1#b 1 1#m 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$+ 3< 3$3 3F 3$7 3J 3$@ W $A 4 4$R 4 4$f X $g 5 5$v 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%% Z %' 7 7%K 7' 7%_ 7; 7%h \ %x 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&! 9 9&) 9 9&3 9 9&< _ &= : :&U :5 :&_ :@ :&k ` &l ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '# ? ?'1 ?& ?'8 ?- ?'Q e 'h @7 @'o @E @'w @O @'{ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (+ C  C(A C# C(H C* C(a CF C(z i ({ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)$ l )% G G)7 G G)C G G)^ G; G)b G@ G)h GG G)m GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*4 q *5 L L*R r *S M M*k s *l N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+& Q Q+* Q% Q+< Q9 Q+M QP Q+T w +a R R+h R/ R+o R= R+x RM R+ R[ R+ R R+ R R+ y + S S,6 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-X TC T-l T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V., Vm V.= V V.E  .Q W  W.y W5 W. We W. W W.  . X X/  X X/ X% X/- X5 X/B Xt X/V X X/h  /i Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0& \- \0. \9 \04 \E \0: \R \0A \_ \0M \p \0_ \ \0d \ \0i \ \0s \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1* \ \1/ \ \14 \ \19 \ \1> \  \1C \ \1H \ \1M \) \1R \3 \1] \T \1b \[ \1g \f \1n \r \1s \{ \1x \ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2' \ \2, \ \20 \ \28 \ \2B \ \2G \ \2N \ \2S \ \2Z \ \2_ \ \2l \ \2r \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]38  39 _ _3S  3U ` `3d ` `3t  3u a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4D d d4E4` d d4a''4 d d4 d d4  4 ~ ~5 [A [5' ~ ~5; # 5? ) 5L 7 5P < 5Y E 5_ ~ ~5`  5j5  5 G 5 ~ ~5 ~+ ~6! ~t ~6K ~ ~6 ~ ~6 ~3 ~7 ~d ~7+ ~ ~7U ~ ~7 ~ ~8' ~ ~8l ~ ~8_IO__opencheck .frameselfIO_get_closed.frameselfIO_flush.frameselfIO_cgetval .frameselfIO_getval$.frameargsselfuse_posIO_isatty.frameselfIO_cread.frameoutputnself^IO_read.frameselfargsoutputnIO_creadline.frameoutputselfCIO_readline.frame outputselfmargsIO_readlines(.framelinenoutputself resultargslengthhint IO_reset.frameself?IO_tell.frameselflIO_truncate.frameargsselfposIO_iternext.frameselfxIO_seek.framepositionargsselfmodeO_cwrite .framecnewsizeoselfnewposlenselfO_writeH.frame8resultself4bufargsO_close.frameself:O_writelines .frameself ncsitargsO_dealloc.frameselfnewOobject.framesizeselfcI_close.frameselfI_dealloc.frameselfnewIobjectP.frame@result8buf % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ~ ~4 # 4 ) 5 7 5 < 5 E 5 ~ ~5  5 5B  5m G 5 ~ ~5 ~g ~6 ~ ~6? ~ ~6{ ~ ~6 ~K ~84 ~ ~8 ~? ~8 ~ ~9a ~ ~9 ~_ ~9 ~p ~9 ~ ~:P ~ ~:d ~" ~;" ~ ~;G ~  ~;b ~( ~;q ~8 ~; ~U ~<) ~ ~< ~ ~= ~ ~= ~ ~= ~ ~>V ~ 2 ~>s ~ P ~> ~  ~? ~  ~@ ~ } ~@ ~  ~A] ~ B ~A ~  ~B^ ~ C ~B ~ k ~B ~ { ~B ~  ~B ~  ~C~ ~k ~C ~ ~D@ ~. ~D ~ ~EB ~6 ~E ~ ~E ~ ~F ~ ~F ~ ~F ~ ~G' ~! ~GT ~O ~Ga ~] ~H ~ ~JJ ~K ~K( ~* ~K ~ ~K ~ ~K ~ ~K ~ ~K ~ ~L ~! ~L ~. ~L ~C ~LZ ~ ~L Pdata_dealloc.framepiselfPdata_New .frameselfstackUnderflow .framePdata_clear.framepiselfcleartoPdata_grow.framebiggerselfPdata_popTuple.framelstartselfbPdata_popList.framelstartselfcPickle_ErrFormat.frameErrTypevstringformat retvalargsformatwrite_file.framenbyteswrittenn_saveselfswrite_cStringIO.frameselflensn5write_none.framensDwrite_other.framepy_strjunkselfnsread_file.framesnbytesread_savesizeselfn8readline_file.framebiggersiselfnread_cStringIO$.framesstartkptrself endlennAreadline_cStringIO .framesptrself endstartnread_other.framesbytesselfnstr™readline_other.framesstr_sizestrself?pystrndup.framesrnÉgetD.frame*smvidselfyput .frameselfobũput2L.framec_strob(p8t4memo_len0py_ob_id,resselfswhichmodule,.frameglobal_namejimodules_dictglobalname modulefast_save_enter.framekeyobjself fast_save_leave.framekeyobjselfˏsave_none.frameselfsave_bool.frameopcodeargsselfIsave_int@.frame,.safe c_strargsself]save_long@.framesizepdatanbytesnbitsc_str(signself reprresargs@save_float0.frame.safeopbuf resultstrxargsselfѤsave_string(.framedoputsizec_strrepr_strlen reprselfargs@modified_EncodeRawUnicodeEscape .frames qreprsizesave_unicode(.framedoputc_strsizerepr_strlen reprselfargsstore_tuple_elements.frameselftilenres#save_tuple$.frame ic_strlenselfargsrespy_tuple_idbatch_list$.framefirstitemn iiterselfobjasave_list .frameitersargsselfresbatch_dict$.framefirstitemn iiterselfpbatch_dict_exact(.frame idict_sizeselfobjpposvaluekeysave_dict .frameitersargsselfres!save_instL.frame$name_str module_str,name_size(module_size name4element8iPickler_get_memo .framepvPickler_set_memo .framepv Pickler_get_error.framefind_class.frameglobalmodulepy_global_namepy_module_namefcmarker .frameself?load_none.frameselfbad_readline .frameload_int(.framepy_intendptrlen sresselfload_bool.framebooleanselfcalc_binint.framesx load_binintx.framepy_intselfxsload_binint.framesselfload_binint1.framesselfBload_binint2.framesselfload_long$.framelend sresselfload_counted_long$.framealong pdatasizenbytesselfload_float,.framepy_floatdendptr sresself _load_binfloat .framepy_float xpself!Qload_string,.framestrlens resself#load_binstring.framepy_stringl sself$=load_short_binstring.framepy_stringl sself%2load_unicode.framestr sself%load_binunicode.frameunicodel sself' load_tuple.frametupself'load_counted_tuple.frametupselflen(load_empty_list .framelistself)Rload_empty_dict .framedictself)load_list.framelistself*|load_dict(.framekdictjiself+Instance_New(.framertb vtpargscls-$load_obj.frameclasstupself obj.load_inst0.frametupclass_namemodule_name siself objclass0load_newobj .frameobjargsclsrawself3Eload_global$.frame class_namemodule_namesclassself4load_persid.framepid sself7Dload_binpersid.framepidself9load_pop .framelenself:load_pop_mark.frameself:Kload_dup.framelastself:load_get .framercvaluepy_strsself;load_binget$.framercvaluepy_keysself?load_extension,.framepairobj py_codecodenbytescodebytesselfAQload_put$.framelpy_str lensselfBload_binput$.framepy_keylensselfBload_long_binput(.framepy_keylensselfCdo_append0.framejunkvalue append_methodislicelistlenxselfFload_append .frameselfFload_appends.frame.safeselfFdo_setitems(.framei dictxlenrselfGload_setitem .frameselfGload_setitems.frame.safeselfGload_build8.framed_valued_key i$dict slotstate$junk__setstate__inststateresselfLload_mark.framesselfMQload_reduce.framecallablearg_tup obselfNload_proto.frameprotobyteselfOZload .frame sselfVnoload_obj.frameselfW*noload_inst.framesselfWnoload_newobj.frameselfY0noload_global.framesselfYnoload_reduce .frameselfZVnoload_build .frameselfZnoload_extension.framenbytescodebytesself[noload_append .frameself[1noload_appends.frameself[enoload_setitem .frameself[noload_setitems.frameself[noload .frame sselfc*Unpickler_load.frameselfc=Unpickler_noload.frameselfcPnewUnpicklerobject.framefselfe8get_Unpickler.framefileeKUnpickler_dealloc.frameselfgqUnpickler_traverse.framevisitargselfhUnpickler_clear .frameselfjUnpickler_getattr.frameselfnamekUnpickler_setattr .frameselfvaluenamemmcpm_dump4.framefileobkwdsargsprotopickler resn;cpm_dumps0.frameobkwdsargsprotopickler resfileodcpm_load.frameunpicklerobresocpm_loads .frameobargsunpickler resfilepinit_stuff$.frametmodule_dictcopyregwinitcPickle@.frame$compatible_formats format_versionkivdm direv ~  ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~  ~555e ~  ~5qH56 ~  ~6V6456X7 ~ ~7  7 7.  7Y G 7w ~ ~7z  7 ~ ~7 ~ ~7 ~I ~8 ~ ~8f ~ ~8 ~ ~8 ~P ~8 ~c ~9 ~~ ~9J ~ ~9{ ~ ~9 ~W ~9 ~ ~: ~& ~: ~- ~: ~i ~: ~ ~; ~ ~;/ ~ ~;N ~ ~; ~@ ~; ~e ~; ~l ~; ~ ~; ~ ~< ~ ~<. ~ ~< ~ ~=R ~ ~= ~H ~= ~ ~>d ~1 ~> ~v ~?C ~ ~?u ~S ~? ~ ~@I ~ / ~@eycheck_iterbuffered .framefyUtil_CatchBZ2Error.framebzerror{Util_NewBufferSize.framecurrentsize{+Util_GrowBuffer.framesizebuf{}Util_GetLineH.frameused_v_sizec bzerror4_save endbufvtotal_v_size0univ_newline,skipnextlf(newlinetypesfn~Util_UnivNewlineRead0.frameshortreaddstsrc skipnextlfnewlinetypesstreambzerrorfbuf nUtil_DropReadAhead.framefUtil_ReadAhead$.framechunksizebzerror _savebufsizef5Util_ReadAheadGetLineSkip .frame bufsbufptrlenskipbufsizefBZ2File_read4.framechunksizebzerrorbytesread buffersize_saveselfargsretbytesrequestedQBZ2File_readline.frame _saveselfargssizehintretBZ2File_readlines X.frame @rest ,q 4err line (p 0end nread  6% 6E 6%  6g 6% 6v 6% 6~ 6%  6 6%) Z %+ 7 7%O 7' 7%c 7; 7%l \ %| 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9&  9 9&% 9 9&- 9 9&7 9 9&@ _ &A : :&Y :5 :&c :@ :&o ` &p ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'! d '' ? ?'5 ?& ?'< ?- ?'U e 'l @7 @'s @E @'{ @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(# h (/ C  C(E C# C(L C* C(e CF C(~ i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)( l )) G G); G G)G G G)b G; G)f G@ G)l GG G)q GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K* K K*8 q *9 L L*V r *W M M*o s *p N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+# Q Q+* Q Q+. Q% Q+@ Q9 Q+Q QP Q+X w +e R R+l R/ R+s R= R+| RM R+ R[ R+ R R+ R R+ y + S S,: Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-\ TC T-p T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.0 Vm V.A V V.I  .U W  W.} W5 W. We W. W W.  . X X/ X X/" X% X/1 X5 X/F Xt X/Z X X/l  /m Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0* \- \02 \9 \08 \E \0> \R \0E \_ \0Q \p \0c \ \0h \ \0m \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1( \ \1. \ \13 \ \18 \ \1= \ \1B \  \1G \ \1L \ \1Q \) \1V \3 \1a \T \1f \[ \1k \f \1r \r \1w \{ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2+ \ \20 \ \24 \ \2< \ \2F \ \2K \ \2R \ \2W \ \2^ \ \2c \ \2p \ \2v \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3  ^b ^3 ] ]3<  3= _ _3W  3Y ` `3h ` `3x  3y a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4H d d4I4d d d4e''4 d d4 d d4  4 ~; ~4 ~E ~5 ~ ~5 ~ ~5 ~ ~5 ~ ~5 ~T ~60 ~ ~6; ~ ~6F ~ ~6[ ~ ~6 ~ ~6 ~4 ~7 ~, ~7 ~4 ~7 ~] ~8  ~ ~8 ~L ~8 ~r ~8 ~ ~8 ~ ~9A ~ ~9\ ~/ ~9 ~u ~:'binascii_a2b_uud.framein_repeat=in_byteDrvLout_lenHin_len8in_data4pinargs@binascii_crc_hqxT.frame /0 /a /^ /g R i 0 0 0 0 0" 0 T  1 1 18 122 $ 1 1 , 1 1!- 1 1!; 1 1!Z 1 1!h 1 1!n 1 1!~ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1": 1 1"A 1' 1"I 10 1"N 15 1"U 1I 1"a 1i 1"h 1q 1"p 1z 1"u 1 1"| 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1## 1x 1#- 1 1#6 1 1#E 1 1#M 1 1#V 1 1#_ 1 1#g 1 1#r 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$0 3< 3$8 3F 3$< 3J 3$E W $F 4 4$W 4 4$k X $l 5 5${ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%! 6 6%* Z %, 7 7%P 7' 7%d 7; 7%m \ %} 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&! 9 9&& 9 9&. 9 9&8 9 9&A _ &B : :&Z :5 :&d :@ :&p ` &q ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'" d '( ? ?'6 ?& ?'= ?- ?'V e 'm @7 @'t @E @'| @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B($ h (0 C  C(F C# C(M C* C(f CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)) l )* G G)< G G)H G G)c G; G)g G@ G)m GG G)r GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*  K K*9 q *: L L*W r *X M M*p s *q N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+$ Q Q++ Q Q+/ Q% Q+A Q9 Q+R QP Q+Y w +f R R+m R/ R+t R= R+} RM R+ R[ R+ R R+ R R+ y + S S,; Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-] TC T-q T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.1 Vm V.B V V.J  .V W  W.~ W5 W. We W. W W.  / X X/ X X/# X% X/2 X5 X/G Xt X/[ X X/m  /n Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0+ \- \03 \9 \09 \E \0? \R \0F \_ \0R \p \0d \ \0i \ \0n \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1/ \ \14 \ \19 \ \1> \ \1C \  \1H \ \1M \ \1R \) \1W \3 \1b \T \1g \[ \1l \f \1s \r \1x \{ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2, \ \21 \ \25 \ \2= \ \2G \ \2L \ \2S \ \2X \ \2_ \ \2d \ \2q \ \2w \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3=  3> _ _3X  3Z ` `3i ` `3y  3z a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4I d d4J4e d d4f''4 d d4 d d4  4 ~ ~4  45  5; G 5Y ~  ~5\5~ ~ ~5 ~6 ~5 ~I ~5 ~N ~5 ~g ~5 ~ ~66 ~ ~6 ~ ~7 ~~ ~8? ~ ~8 ~ ~9  ~ ~95 ~ ~9R ~  ~9^ ~ ~9k ~) ~9} ~@ ~9 ~L ~9 ~ ~9 ~ ~9 ~ ~: ~ ~: ~ ~:9 ~  ~:@ ~ ~:e ~6 ~:q ~D ~: ~] ~: ~ ~: ~ ~: ~ ~: ~ ~; ~ ~;  ~  ~;_ ~J ~< ~ ~= ~ ~=  ~3 ~='array_resize.frame_new_size .safeselfnewsizeZc_getitem .frameiap؀c_setitem.frameapixvb_getitem .frameiapb_setitem.frameapixvٓBB_getitem .frameiapٱBB_setitem.frameapixvu_getitem .frameiap#u_setitem.frameapilenpvڡh_getitem.frameiaph_setitem.frameapixvHH_getitem.frameiap0HH_setitem.frameapixvi_getitem.frameiapi_setitem.frameapixv5II_getitem.frameiapTII_setitem.frameapiyxv.l_getitem.frameiapMl_setitem.frameapixvݚLL_getitem.frameiapݹLL_setitem.frameapiyxvޓf_getitem .frameiap޲f_setitem.frameapixvd_getitem .frameiapd_setitem.frameapixvknewarrayobject.frameopnbytes .safesizetypedescrmgetarrayitem.frameiopins1.framewherenselfvarray_dealloc.frameoparray_richcompare8.framereskiopwavawvwi vi&array_length.framea.array_item .frameiararray_slice.framenpihighilowa*array_copy.frameaLarray_concat.framenpbbararray_repeat$.framenbytespi np.safeanEarray_ass_slice$.frameitem dretilown vaihigharray_ass_item.frameiavJsetarrayitem.frameviamarray_iter_extend.framevselfitbbZarray_do_extend.framesizeold_item .safeselfbbarray_inplace_concat.frameselfbbharray_inplace_repeat .framepiitems size.safeselfnins.framevwhereself&array_count .framecmpv selfiiselfcountarray_index.frame cmpvselfiiself}array_contains.framecmpv selfiiselfarray_remove .frame cmpvselfiiselfarray_pop.framevselfargsiarray_extend .framebbself array_insert.frameselfviargs]array_buffer_info .frameselfretvalarray_append.framevselfarray_byteswap.frame p0selfarray_reverse.frameitemsizep tmp qselfarray_fromfile4.frameitemitemsize fpselfnfargsarray_fromfile_as_read.frameargsself9array_tofile.framefpselffarray_tofile_as_write.framefself)array_fromlist$.framei itemnitemsizeselflistarray_tolist.frameilistselfarray_fromstring$.framenstrargs itemsizeselfarray_tostring .frame.safeselfYarray_fromunicode .frameselfnustrargsarray_tounicode .frameselfarray_reduce$.frameresult listdictarrayarray_sizeof .frameselfarray_get_typecode.frametca array_get_itemsize.framea%array_repr(.frame.safes tvtypecodebufaarray_subscrD.framecur ar(resultslicelength stepstopstart$itemsizeiitemselfarray_ass_subscrD.frame curneededitemsize retotherslicelength stepstopstart$iselfvalueitem Varray_buffer_getreadbuf .frameindexselfptr array_buffer_getwritebuf .frameindexselfptr array_buffer_getsegcount.frameselflenp 'array_new8.framen selft_initial vialendescrcargskwdstype itinitialarray_iter.frameitaoxarrayiter_next .frameitarrayiter_dealloc.frameitarrayiter_traverse.framevisitargit'initarray.framem ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~  ~4ii5+ ~  ~5,  565X  5 G 5 ~  ~5  5 = 5 K 5 ] 5 f 6   6h  6p ~  ~6s  6 ~ ~6 ~( ~6 ~: ~7< ~ ~7r ~ ~7 ~! ~8 ~ ~8 ~  ~8& ~ ~86 ~+ ~8Y ~P ~8 ~ ~8 ~ ~8 ~ ~8 ~  ~8 ~ ~8 ~+ ~9" ~P ~9V ~ ~9i ~ ~9 ~ ~9 ~ ~:= ~p ~: ~ ~;( ~^ ~; ~ ~; ~ ~< ~ ~< ~0 ~= ~[ ~=8 ~x ~=Y ~ ~= ~ ~= ~  ~= ~  ~= ~ ~= ~# ~= ~= ~= ~@ ~>& ~{ ~?* ~ ~?GraiseTestError.framebuftest_name.safemsgdsizeof_error .frame gottypnameexpectedfatnamebuftest_config.frametest_list_api.frameilisttest_dict_inner0.frameokv icountdictiterationspostest_dict_iteration .frameitest_lazy_hash_inheritance.frameobjtypebroken_buffer_getbuffer .frametest_broken_memoryview.frameresobjraise_test_long_error .framemsgtest_long_api_inner0.frameyxoneoutin$uout pyresulterror uin(.safejibaseNBITS]test_long_api.frameqraise_test_longlong_error .framemsgtest_longlong_api_innerD.frame yxone(out inpyresult8uouterror<.safej0uini baseNBITS&Htest_longlong_api.frame&\test_long_and_overflow$.frame temponevaluenumoverflow-test_long_long_and_overflow(.frame temponenumvalueoverflow6test_L_code .framevaluenumtuple7getargs_tuple$.frame cbaargs7getargs_keywordsd.framekwargsargs(int_args9&getargs_b.framevalueargs9bgetargs_B.framevalueargs9getargs_h.framevalueargs9getargs_H.framevalueargs:getargs_I.framevalueargs:Qgetargs_k.framevalueargs:getargs_i.framevalueargs:getargs_l.framevalueargs;getargs_n.framevalueargs;=getargs_L.framevalueargs;getargs_K.framevalueargs;test_k_code.frame valuenumtuple=test_u_code(.framelen valueobj.safetuple>test_widechar .frameutf8widewtext@xunicode_encodedecimal4.framedecimallengthunicodeargs errorsAmtest_empty_argparse .frame resulttupledictBIcodec_incrementalencoder.frameencodingargserrorsBcodec_incrementaldecoder.frameencodingargserrorsBtest_long_numbits.framesignnbitsplongitestcasesErtest_null_strings.frame tupleo2o1Eraise_exception(.frameiexc_argsnum_argsexcargsGtest_datetime_capi .frameG_make_call.framesuccesscallable sG_make_call_from_thread.framecallableHtest_thread_state.frame _savefnargssuccessI_pending_callback.framercallableargJpending_threadfunc.framer _savecallableargJtest_string_from_format.framemsg .saferesultNcapsule_destructor .frameoOctest_capsule`.frame pointerHmodulepointer2objectDknown@known_capsuleserrorTtest_with_docstring.frameTtraceback_print .framefiletracebackargsUcode_newempty$.frame firstlinenofuncnamefilenameargsUumake_exception_with_doc4.framenamekwargsargsdict basedocV sequence_delitem.frameiseqargsVjtest_structmembers_new\.framekwargsargsobtype string_lensWtest_structmembers_free.frameobXinit_testcapi.frame.safem ~ ~   0 , 1  2  <P   m ( u     a   ;  IOPZ] ^v w5! " &+Ch  + ' !! ) "" #""W + Y##  3## G 8 H$$ Z 9 \ % %t   % %&& % % % %k %; %p"" %@ %'' %J %(( %M %((!9(( %Z %)) %u %*** * % % % %++ % % G  , ,  ) , , , , N  - -E % %\ -3 - -s - O  .j . . . . . . .1 . . . . . . . . . .  . .< . .E . . .= .  .F . .P ." .^ .4 . .E . .K Q N / / -s - /a / / /  / / / / / /? /0 /b /^ /h R j 0 0 0 0 0" 0 T  1 1 18 122 % 1 1 - 1 1!. 1 1!< 1 1![ 1 1!i 1 1!o 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"; 1 1"B 1' 1"J 10 1"O 15 1"V 1I 1"b 1i 1"i 1q 1"q 1z 1"v 1 1"} 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#$ 1x 1#. 1 1#7 1 1#F 1 1#N 1 1#W 1 1#` 1 1#h 1 1#s 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $  3 3$ 3  3$1 3< 3$9 3F 3$= 3J 3$F W $G 4 4$X 4 4$l X $m 5 5$| 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6% 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%" 6 6%+ Z %- 7 7%Q 7' 7%e 7; 7%n \ %~ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&" 9 9&' 9 9&/ 9 9&9 9 9&B _ &C : :&[ :5 :&e :@ :&q ` &r ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'# d ') ? ?'7 ?& ?'> ?- ?'W e 'n @7 @'u @E @'} @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(% h (1 C  C(G C# C(N C* C(g CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)  FK F)* l )+ G G)= G G)I G G)d G; G)h G@ G)n GG G)s GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*! K K*: q *; L L*X r *Y M M*q s *r N N* t * O O* O, O* u * P P+ P P+ v + Q Q+  Q Q+% Q Q+, Q Q+0 Q% Q+B Q9 Q+S QP Q+Z w +g R R+n R/ R+u R= R+~ RM R+ R[ R+ R R+ R R+ y + S S,< Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S-- S@ S- z - T T-^ TC T-r T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.2 Vm V.C V V.K  .W W  W. W5 W. We W. W W/  / X X/ X X/$ X% X/3 X5 X/H Xt X/\ X X/n  /o Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0, \- \04 \9 \0: \E \0@ \R \0G \_ \0S \p \0e \ \0j \ \0o \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1* \ \10 \ \15 \ \1: \ \1? \ \1D \  \1I \ \1N \ \1S \) \1X \3 \1c \T \1h \[ \1m \f \1t \r \1y \{ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2 \g \2  \o \2 \v \2 \} \2- \ \22 \ \26 \ \2> \ \2H \ \2M \ \2T \ \2Y \ \2` \ \2e \ \2r \ \2x \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3>  3? _ _3Y  3[ ` `3j ` `3z  3{ a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4J d d4K4f d d4g''4 d d4 d d4  4 ~  ~4  5  % 5 ~  ~5  55<  5g G 5 ~  ~5225 ~  ~5 ~ ~6 ~S ~6' ~x ~69 ~ ~6g ~ ~6o ~ ~6 ~6 ~6 ~\ ~7E ~ ~: ~} ~:y ~ ~;6 ~ ~;a ~ ~; ~ ~; ~ ~; ~A ~; ~h ~<8 ~ ~< ~$ ~< ~. ~< ~= ~< ~[ ~< ~y ~=  ~ ~=8 ~ ~=L ~ ~=X ~ ~=^ ~ ~=b ~ ~=f ~ ~=\get_pylong .framerm convertedv_get_long .framepxv_get_ulong .framepxv_get_longlong.framepxv`~get_ulonglong.framepxvaunpack_float.framexlepaRunpack_double.framexlepa_range_error .frameis_unsignedfbnu_char .framepb4nu_byte.framepbJnu_ubyte.framepb`nu_short.framepxbnu_ushort.framepxbnu_int.framepxbnu_uint.framepxc 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  44  5 555jj55jj55jj5ll5ll5jj6W6Y6Z6n6o6 6666666nn6nn777777T8 8K8R8[8j8'8P8y99p9v  9}  :  :,#:/ ~ ~:7:mA:m:v:: ~  ~; B;2k;P;W;n ~  ~;p;x ~ ~;; ~% ~; ~{ ~; ~ ~; ~ ~; ~ ~< ~ ~<  ~ ~<)&<+  I ?f???@[7@n@@A" A3 A=/A]PA(pushssld.framecfdalg secoutsecinfdPdataHdnamebufTctlfinished.framebuf2handisclientinbufpushtlst.framesecret isclientencalghashalgfdHdnamedirbufTctlPdataXhandEPySocketModule_ImportModuleAndAPI.framePySSL_cryptoalgs.frameciphersPySSL_SetError.framevlineno filenamebufstateerrobjprettcheckstate.frame infldssfdLbufrselfnewPySSLObject.framecacerts_filecertreqs modecertfilepemfileprotociphersselflPySSL_sslwrapP.framesargs cipherscacerts_filecert_filekey_fileprotocol verification_modeserver_sideYreporter.framefmtPySSL_SSLdo_handshake.frameerrdfdQfromclientsecretffromserversecret certchaincertificatecertlencachain_saveselferrstrPySSL_server.frameselfPySSL_issuer.frameself_create_tuple_for_attribute .framevalue_obj.safevaluename_objkey attr_create_tuple_for_X509_NAMEH.frame 6% 6E 6%  6g 6% 6v 6% 6~ 6%" 6 6%+ Z %- 7 7%Q 7' 7%e 7; 7%n \ %~ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&" 9 9&' 9 9&/ 9 9&9 9 9&B _ &C : :&[ :5 :&e :@ :&q ` &r ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'# d ') ? ?'7 ?& ?'> ?- ?'W e 'n @7 @'u @E @'} @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(% h (1 C  C(G C# C(N C* C(g CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)  FK F)* l )+ G G)= G G)I G G)d G; G)h G@ G)n GG G)s GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*! K K*: q *; L L*X r *Y M M*q s *r N N* t * O O* O, O* u * P P+ P P+ v + Q Q+  Q Q+% Q Q+, Q Q+0 Q% Q+B Q9 Q+S QP Q+Z w +g R R+n R/ R+u R= R+~ RM R+ R[ R+ R R+ R R+ y + S S,< Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S-- S@ S- z - T T-^ TC T-r T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.2 Vm V.C V V.K  .W W  W. W5 W. We W. W W/  / X X/ X X/$ X% X/3 X5 X/H Xt X/\ X X/n  /o Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0, \- \04 \9 \0: \E \0@ \R \0G \_ \0S \p \0e \ \0j \ \0o \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1* \ \10 \ \15 \ \1: \ \1? \ \1D \  \1I \ \1N \ \1S \) \1X \3 \1c \T \1h \[ \1m \f \1t \r \1y \{ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2 \g \2  \o \2 \v \2 \} \2- \ \22 \ \26 \ \2> \ \2H \ \2M \ \2T \ \2Y \ \2` \ \2e \ \2r \ \2x \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3>  3? _ _3Y  3[ ` `3j ` `3z  3{ a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4J d d4K4f d d4g''4 d d4 d d4  4 ~ F ~ 4((5' ~ G ~ 5b ~  ~ 5 ~  ~ 5 ~  ~ 5 ~  ~ 6F ~  ~ 6q ~  ~ 6 ~  ~ 6 ~  ~ 6 ~  ~ 6 ~ F ~ 7 genrand_int32.frameselfrandom_random.frame .safeaselfinit_genrand .framesselfinit_by_array.frameinit_key kkey_lengthmtselfrandom_seedL.frame4bigger(newn0chunk,pychunkkeymaxkeyusedself(nowargs$argkeyn thirtytwomasklowerresultrandom_getstate.frameself istate9random_setstate.frame indexselfelementistateFrandom_jumpahead,.framejremobj iobjimtselfnrandom_getrandbits,.frameresultselfibytearray byteskargsrandom_new.frameargsselfkwdstypeinit_random.frame ~  ~   , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~  ~ 4ii5+ ~  ~ 5, ~ ~5T ~) ~5\ ~  ~ 5d ~ ( ~ 5 ~ W ~ 5 ~  ~ 5 ~  ~ 5 ~  ~ 5 ~  ~ 5 ~  ~ 5 ~  ~ 6>_Py_acosh.frame.safetxt_Py_asinh,.framet .safewabsxxŲ_Py_atanh$.frametabsxxƗ_Py_expm1.frameux _Py_log1p.frameyx ~  ~   ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ~  ~ 4 ] ]5 ~  ~ 5  5!  5& % 5, . 5: < 5Y ~  ~ 5Z  5~ % 5 ~  ~ 5 ~  ~5""5 ~  ~5 ~  ~ 56 ~ - ~ 665 ~ . ~ 6 ~  ~ 6 ~  ~ 6 ~  ~ 6 ~  ~ 6 ~  ~ 7x ~ u ~ 7~ ~  ~ 7 ~  ~ 7 ~  ~ 7 ~  ~ 8^ ~ v ~ 8 ~  ~ 8 ~  ~ 8 ~  ~ 9 ~ 2 ~ 9QǓhpTimer .frame.ret.saferettvhpTimerUnit.frameCallExternalTimer$.frameval oresult.retpObj!normalizeUserObj$.frameresmo nameself modnamemodfnobjnewProfilerEntry.framekeyuserObjpObjself˖getEntry .framekeypObj˴getSubEntry .frameentrycallernewSubEntry.frameselfcallerentrypObjPfreeSubEntry .frameheaderefreeEntry.frameentryheaderclearEntries.framepObj?initContext.framecallerselfpObjentryStop4.frameitttselfentry(.safepObjCptrace_enter_call(.frameuserObjprofEntrykeylast_tblast_valuelast_typepObjselfptrace_leave_call.framekeypObj pContextself~profiler_callback.framewhatself argframe.pending_exception .framepObjostatsForSubEntryL.frameerrsinfo$.safesentry entrycollectargnodeXstatsForEntryL.frameerr info .safeentrycollectargnode profiler_getstats .framecollectpObjsetSubcalls.framepObjnvaluesetBuiltins.framepObjnvalueprofiler_enable$.frameselfkwdsargsbuiltinssubcallsflush_unmatched.framepContextpObj(profiler_disable .frameselfyprofiler_clear.framepObj֗profiler_dealloc .frameopprofiler_init<.framepObjkwargsbuiltinssubcallstimeunittimerinit_lsprof .framedmodule ~  ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~  ~555f ~ ~5g5l55 ~ ~55 ~ ~5226 ~ ~6!!6x ~ ~6 ~6 ~71 ~ ~7H ~ ~7p ~ ~7 ~c ~8v ~# ~9H ~ ~9H,copy_grouping.frame valiresultsFfixup_ulcase(.frameuloulstrop stringmods PyLocale_setlocale$.frameresult_objectcategoryargslocalePyLocale_localeconv.frame xlresult4PyLocale_strcoll .frame .safes2s1argsPyLocale_strxfrm$.frameresultn2buf n1sargsfinit_locale$.frame xd ~ ~  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ~ ~4  45   55 G 5S ~ ~5 ~ ~6 ~Z ~6 ~ ~6 ~ ~7 ~] ~8G ~ ~8h ~4 ~8 ~y ~9 ~ ~9 ~q ~9 ~ ~: ~ ~:% ~ ~: ~y ~: ~ ~: ~ ~: ~ ~;+ ~* ~;< ~; ~;D ~C ~=F ~H ~= ~ ~= ~ ~= ~ ~>] ~ h ~>n_convertPyInt_AsSsize_t.framesize_ptro_convertPyInt_FromSsize_t.framesize_ptrascii_escape_char.framecharsoutputcascii_escape_unicode8.framecharsoutputirval output_sizemax_output_sizeinput_chars input_unicodepystrascii_escape_str8.frameoutputchars output_sizeinput_charsirval(uniinput_strpystr)raise_errmsg$.framepymsgendsmsgdecoderjoin_list_unicode.framelstustr_build_rval_index_tuple.framepyidxidxrval5scanstring_str8.framenext_end_ptrrval chunkencoding$strchunknext strictcchunksbuf beginendlenpystrscanstring_unicode8.frame next_end_ptrrval chunknextstrictcchunksbuf beginendlenpystrpy_scanstring8.frame endpystrargsstrictencodingnext_end py_encode_basestring_ascii.framepystr Uscanner_dealloc.frameself zscanner_traverse.framevisitargsself scanner_clear.framesself +_parse_object_strD.frame rval next_idx_ptritem(next_idxpairsidx$strict encodingvalkeyend_idxstrspystr _parse_object_unicode<.frame rval next_idx_ptritem$next_idxpairsidx strictsvalkeyend_idxstrpystr _parse_array_str,.frame next_idx_ptrnext_idxsrvalidx valend_idxstrpystr 9_parse_array_unicode,.frame next_idx_ptrnext_idxsrvalidx valend_idxstrpystr G_parse_constant.frame next_idx_ptridxrvalcstrsconstant _match_number_str0.frame next_idx_ptr drvalnumstrs idxis_floatstartpystr _match_number_unicode,.frame next_idx_ptrrvalnumstrs idxis_floatstartpystr scan_once_str(.frame.safespystridx next_idx_ptr scan_once_unicode$.frame.safespystridx next_idx_ptr !lscanner_call4.frame idxpystrkwdsargssselfnext_idx "zscanner_new.frametype "scanner_init$.frame tmpctxkwdsargssself &encoder_new.frametype &encoder_init`.frame(allow_nan$skipkeys sort_keysitem_separatorkey_separatorindentencoder defaultfnmarkerskwdsargssself (#encoder_call0.framerval indent_levelobjkwdsargssself (_encoded_const .frameobj )encoder_encode_float.framesiobj *Nencoder_encode_string.frameobjs *_steal_list_append.framervalstolenlst *encoder_listencode_obj$.framervnewobj ident indent_levelrvalobjs /[encoder_listencode_dict8.frame encodedidxskipkeys indent_levelsrvaldctitvalue keyidentkstr 6 encoder_listencode_list$.frame iobj indent_levelsrvals_fastseqident 9encoder_dealloc.frameself 9encoder_traverse.framevisitargsself ;$encoder_clear.framesself  1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~5  ~6 ~5c ~ ~5 ~ ~5 ~ ~5 ~ ~5 ~" ~5 ~5 ~6 ~> ~6T ~ ~6f ~ ~6 ~ ~6 ~; ~7 ~k ~7 ~ ~7! =cmp_lt.frameyx >_siftdown$.frameparentparentposstartposnewitemsizeheappos ?_siftup4.frametmp childposrightposnewitemstartposendpos$sizeheappos Aheappush$.frameitemheapargs Bheappop .framereturnitem nlasteltheap Cheapreplace(.frame returnitemitemheapargs Dheappushpop,.frame returnitemitemheapargs Eheapify.frameiheap F7nlargest8.framesolelemiheapit iterable nargs I_siftdownmax.frameparentparentposstartposnewitemposheap Jc_siftupmax,.frametmp childposrightposnewitemstartposendposheappos Lnsmallest8.frameloselemiheapit iterable nargs Ninit_heapq .frame.safem   / , 0  1  ;O   l ( t     a   :  HNOY\ ]u v5  " %*Bg  + ' !! ) "" """V + X##  2## F 8 G$$ Y 9 [ % %s   % %&& % % % %j %; %o"" %@ %'' %J %(( %M %(( 8(( %Z %)) %u %*** * % % % %++ % % G  , ,  ( , , , , N  - -D % %[ -3 - -s - O  .j . . . . . . .0 . . . . . . . . . .  . .; . .D . . .= .  .F . .P .! .^ .3 . .D . .J Q M / / -s - /a / / / / / / / / /> /0 /a /^ /g R i 0 0 0 0 0" 0 T  1 1 18 122 $ 1 1 , 1 1!- 1 1!; 1 1!Z 1 1!h 1 1!n 1 1!~ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1": 1 1"A 1' 1"I 10 1"N 15 1"U 1I 1"a 1i 1"h 1q 1"p 1z 1"u 1 1"| 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1## 1x 1#- 1 1#6 1 1#E 1 1#M 1 1#V 1 1#_ 1 1#g 1 1#r 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$0 3< 3$8 3F 3$< 3J 3$E W $F 4 4$W 4 4$k X $l 5 5${ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%! 6 6%* Z %, 7 7%P 7' 7%d 7; 7%m \ %} 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&! 9 9&& 9 9&. 9 9&8 9 9&A _ &B : :&Z :5 :&d :@ :&p ` &q ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'" d '( ? ?'6 ?& ?'= ?- ?'V e 'm @7 @'t @E @'| @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B($ h (0 C  C(F C# C(M C* C(f CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)) l )* G G)< G G)H G G)c G; G)g G@ G)m GG G)r GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*  K K*9 q *: L L*W r *X M M*p s *q N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+$ Q Q++ Q Q+/ Q% Q+A Q9 Q+R QP Q+Y w +f R R+m R/ R+t R= R+} RM R+ R[ R+ R R+ R R+ y + S S,; Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-] TC T-q T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.1 Vm V.B V V.J  .V W  W.~ W5 W. We W. W W.  / X X/ X X/# X% X/2 X5 X/G Xt X/[ X X/m  /n Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0+ \- \03 \9 \09 \E \0? \R \0F \_ \0R \p \0d \ \0i \ \0n \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1/ \ \14 \ \19 \ \1> \ \1C \  \1H \ \1M \ \1R \) \1W \3 \1b \T \1g \[ \1l \f \1s \r \1x \{ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2, \ \21 \ \25 \ \2= \ \2G \ \2L \ \2S \ \2X \ \2_ \ \2d \ \2q \ \2w \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3=  3> _ _3X  3Z ` `3i ` `3y  3z a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4I d d4J4e d d4f''4 d d4 d d4  44  45  5; G 5Y5\  5)55/55155576T6M66666'7 P71y7S27lK7m8828_@889?19iy9 OBLSEC_MD_CTX_cleanup.framectx OuLSEC_MD_CTX_copy.frameinout P;LSEC_get_digestbyname.framenamefn PLSEC_DigestUpdate.framecntdctx PLSEC_DigestInit.framefuncctx PLSEC_DigestFinal.framemdctx Q7newLSECobject .framename QdLSEC_hash.frameprocesscpselfvplen QLSEC_dealloc.frameself R#locked_LSEC_MD_CTX_copy.framenew_ctx_p_saveself RLSEC_copy.framenewobjself RLSEC_digest\.frame@digestPdigest_sizeselfHtemp_ctx S7LSEC_hexdigestp.frameTiPhex_digestLretval@digest\digest_sizeselfHtemp_ctx TLSEC_updateH.frame8_saveself4viewargs ULSEC_get_block_size .frameself ULSEC_get_digest_size .frameself ULSEC_repr.framedbufh.safeself V LSECnew.frame_save cplenselfname_objinitial_ctxdigest WLSEC_new`.frame 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%% Z %' 7 7%K 7' 7%_ 7; 7%h \ %x 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&! 9 9&) 9 9&3 9 9&< _ &= : :&U :5 :&_ :@ :&k ` &l ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '# ? ?'1 ?& ?'8 ?- ?'Q e 'h @7 @'o @E @'w @O @'{ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (+ C  C(A C# C(H C* C(a CF C(z i ({ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)$ l )% G G)7 G G)C G G)^ G; G)b G@ G)h GG G)m GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*4 q *5 L L*R r *S M M*k s *l N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+& Q Q+* Q% Q+< Q9 Q+M QP Q+T w +a R R+h R/ R+o R= R+x RM R+ R[ R+ R R+ R R+ y + S S,6 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-X TC T-l T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V., Vm V.= V V.E  .Q W  W.y W5 W. We W. W W.  . X X/  X X/ X% X/- X5 X/B Xt X/V X X/h  /i Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0& \- \0. \9 \04 \E \0: \R \0A \_ \0M \p \0_ \ \0d \ \0i \ \0s \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1* \ \1/ \ \14 \ \19 \ \1> \  \1C \ \1H \ \1M \) \1R \3 \1] \T \1b \[ \1g \f \1n \r \1s \{ \1x \ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2' \ \2, \ \20 \ \28 \ \2B \ \2G \ \2N \ \2S \ \2Z \ \2_ \ \2l \ \2r \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]38  39 _ _3S  3U ` `3d ` `3t  3u a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4D d d4E4` d d4a''4 d d4 d d4  4 ~ ~4  45   56 G 5W ~  ~5 ~V ~6$ ~ ~6[ ~ ~6 ~u ~6 _functools_reduce4.frameop2itseqfuncargs result apartial_new.framekwptotypefuncargs bpartial_dealloc.framepto cpartial_call.frameret kwapplargapplargsptokw e:partial_traverse.framevisitargpto epartial_get_dict.framepto fpartial_set_dict.framevaluepto fpartial_reduce .framepto fpartial_setstate,.frameptodict kwfnargsfnstate hRinit_functools,.frameimtypelist ~. ~   / , 0  1  ;O   l ( t     a   :  HNOY\ ]u v5  " %*Bg  + ' !! ) "" """V + X##  2## F 8 G$$ Y 9 [ % %s   % %&& % % % %j %; %o"" %@ %'' %J %(( %M %(( 8(( %Z %)) %u %*** * % % % %++ % % G  , ,  ( , , , , N  - -D % %[ -3 - -s - O  .j . . . . . . .0 . . . . . . . . . .  . .; . .D . . .= .  .F . .P .! .^ .3 . .D . .J Q M / / -s - /a / / / / / / / / /> /0 /a /^ /g R i 0 0 0 0 0" 0 T  1 1 18 122 $ 1 1 , 1 1!- 1 1!; 1 1!Z 1 1!h 1 1!n 1 1!~ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1": 1 1"A 1' 1"I 10 1"N 15 1"U 1I 1"a 1i 1"h 1q 1"p 1z 1"u 1 1"| 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1## 1x 1#- 1 1#6 1 1#E 1 1#M 1 1#V 1 1#_ 1 1#g 1 1#r 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$0 3< 3$8 3F 3$< 3J 3$E W $F 4 4$W 4 4$k X $l 5 5${ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%! 6 6%* Z %, 7 7%P 7' 7%d 7; 7%m \ %} 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&! 9 9&& 9 9&. 9 9&8 9 9&A _ &B : :&Z :5 :&d :@ :&p ` &q ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'" d '( ? ?'6 ?& ?'= ?- ?'V e 'm @7 @'t @E @'| @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B($ h (0 C  C(F C# C(M C* C(f CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)) l )* G G)< G G)H G G)c G; G)g G@ G)m GG G)r GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*  K K*9 q *: L L*W r *X M M*p s *q N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+$ Q Q++ Q Q+/ Q% Q+A Q9 Q+R QP Q+Y w +f R R+m R/ R+t R= R+} RM R+ R[ R+ R R+ R R+ y + S S,; Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-] TC T-q T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.1 Vm V.B V V.J  .V W  W.~ W5 W. We W. W W.  / X X/ X X/# X% X/2 X5 X/G Xt X/[ X X/m  /n Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0+ \- \03 \9 \09 \E \0? \R \0F \_ \0R \p \0d \ \0i \ \0n \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1/ \ \14 \ \19 \ \1> \ \1C \  \1H \ \1M \ \1R \) \1W \3 \1b \T \1g \[ \1l \f \1s \r \1x \{ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2, \ \21 \ \25 \ \2= \ \2G \ \2L \ \2S \ \2X \ \2_ \ \2d \ \2q \ \2w \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3=  3> _ _3X  3Z ` `3i ` `3y  3z a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4I d d4J4e d d4f''4 d d4 d d4  5" ~x ~5e ~ ~5 ~ ~5 ~ ~6 ~[ ~6  ~i ~6 ~o ~7u ~ ~9  ~l ~: ~t ~:e ~ ~;J ~ ~;N ~ ~; ~ ~; ~% ~; ~* ~<{ ~  ~<""< ~ ~< ~  ~< ~% ~=2 ~8 ~=s ~ ~= ~- ~= ~ ~= ~ ~= ~ ~= ~ ~> ~ ~>  ~ ~> ~ ~> ~ ~> ~ ~>7 ~# ~>= ~* ~>F ~5 ~>J ~I ~>[ ~a ~>e ~m ~>n ~z ~>y ~ ~>} ~ ~> ~ ~> ~ ~> ~ ~> ~> ~> ~F ~> ~x ~? ~ ~?  ~ ~? ~ ~? ~ ~?# ~ ~?) ~ ~?1 ~ ~?6 ~ ~?K ~  ~?V ~1 ~?[ ~@ ~?l ~T ~?q ~g ~?~ ~ ~? ~ ~? ~ ~? ~ ~? ~ ~? ~ ~? ~ ~? ~ ~? ~ ~@) ~ ~@7 ~# ~@H ~4 ~@b ~N ~D. ideepcopy.frameresultargsmemoobject ilist_join .frame argsfunctionjoinerresultlist kelement_new_extra.frameselfattrib kxelement_dealloc_extra .frameiself l:element_new.frametagselfattrib m element_resize.framechildrensizeextraself nelement_add_subelement .frameelementself nielement_get_attrib .frameself nelement_get_text .frameself nelement_get_tail .frameself o:element$.frameelemkwtagargs attrib p(subelement0.frameelemkw tagparentargsattrib qjelement_dealloc.frameself r element_append.frameselfelementargs rnelement_clear .frameselfargs s3element_copy.frameelementselfargs telement_deepcopy4.frameiditailtextelementattrib tagself memoargs wcheckpath.frametag xelement_extend$.frameselfi seqlenseqseq_inargs yelement_find,.frameitemiselftagargs namespaces { element_findtext8.frameitemiselftagargsnamespaces default_value |nelement_findall0.frameitemioutself tagargsnamespaces }element_iterfind$.frameselftagargsnamespaces ~Delement_get .frameselfkeyargs default_value ~element_getchildren.frameselfargs Welement_iter.frameresultselfargstag element_itertext.frameresultselfargs element_getitem.frameself_index element_insert$.frameself elementindexargs (element_items .frameselfargs element_keys .frameselfargs element_length.frameself element_makeelement .frameelem attribtagargs element_reduce.frame.safeselfargs element_remove.frameiselfelementargs kelement_repr.framereprtagself element_set .frameself valuekeyargs helement_setitem.frameself_indexitem element_subscr@.frameslicelenstep stopstartiselfself_item element_ass_subscrH.frame,elementcurnewlenslicelenstep stopstart(seq$recyclevalue iselfself_item element_getattr.frameselfname element_setattr .frameselfnamevalue treebuilder_new .frameself ]treebuilder .frameargs treebuilder_dealloc.frameself wtreebuilder_handle_xml.frame treebuilder_handle_start .frame resactionthisnodeattribtagself Ztreebuilder_handle_data.framesizeselfdata ktreebuilder_handle_end.frameresnode actionitemself Vtreebuilder_handle_namespace.frameres parcel uriprefixactionstartself 7treebuilder_data.frameselfdataargs ztreebuilder_end.frameselftagargs treebuilder_done.frameself treebuilder_close .frameselfargs treebuilder_start.frameselftagargsattrib mtreebuilder_xml.frameselfstandaloneencodingargs treebuilder_getattr.framenameself checkstring.framestringsize makestring.framesizestring dmakeuniversal(.frameptag valuekeyselfsizestring Texpat_set_error .framepositionerrorcolumnlinemessagebuffer expat_default_handler.frame.safemessagekeyselfdata_indata_len Vexpat_start_handler,.frameresokvalue.safekey attribattrib_intagtag_inself Cexpat_data_handler.frameresdataselfdata_lendata_in expat_end_handler.frametagtag_inresself expat_start_ns_handler.framesprefixselfsuriprefix .safeuri expat_end_ns_handler.frameself expat_comment_handler.framecomment .safecomment_inself expat_pi_handler .framedatadata_intarget.safetarget_inself expat_unknown_encoding_handler .framenamesinfo xmlparser(.frameselfkwargs encodingtarget xmlparser_dealloc.frameself expat_parse .frame.safeok finaldata_lendataself xmlparser_close.frameselfargs xmlparser_feed.frameselfdata_lendataargs xmlparser_parse$.frame resbufferselfreaderfileobjargs xmlparser_setevents0.frameeventitemitargetself eventsargsevent_set xmlparser_getattr.framehbuffernameself init_elementtree(.frame.safegm ~ ~   0 , 1  2  <P   m ( u     a   ;  IOPZ] ^v w5! " &+Ch  + ' !! ) "" #""W + Y##  3## G 8 H$$ Z 9 \ % %t   % %&& % % % %k %; %p"" %@ %'' %J %(( %M %((!9(( %Z %)) %u %*** * % % % %++ % % G  , ,  ) , , , , N  - -E % %\ -3 - -s - O  .j . . . . . . .1 . . . . . . . . . .  . .< . .E . . .= .  .F . .P ." .^ .4 . .E . .K Q N / / -s - /a / / /  / / / / / /? /0 /b /^ /h R j 0 0 0 0 0" 0 T  1 1 18 122 % 1 1 - 1 1!. 1 1!< 1 1![ 1 1!i 1 1!o 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"; 1 1"B 1' 1"J 10 1"O 15 1"V 1I 1"b 1i 1"i 1q 1"q 1z 1"v 1 1"} 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#$ 1x 1#. 1 1#7 1 1#F 1 1#N 1 1#W 1 1#` 1 1#h 1 1#s 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $  3 3$ 3  3$1 3< 3$9 3F 3$= 3J 3$F W $G 4 4$X 4 4$l X $m 5 5$| 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6% 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%" 6 6%+ Z %- 7 7%Q 7' 7%e 7; 7%n \ %~ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&" 9 9&' 9 9&/ 9 9&9 9 9&B _ &C : :&[ :5 :&e :@ :&q ` &r ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'# d ') ? ?'7 ?& ?'> ?- ?'W e 'n @7 @'u @E @'} @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(% h (1 C  C(G C# C(N C* C(g CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)  FK F)* l )+ G G)= G G)I G G)d G; G)h G@ G)n GG G)s GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*! K K*: q *; L L*X r *Y M M*q s *r N N* t * O O* O, O* u * P P+ P P+ v + Q Q+  Q Q+% Q Q+, Q Q+0 Q% Q+B Q9 Q+S QP Q+Z w +g R R+n R/ R+u R= R+~ RM R+ R[ R+ R R+ R R+ y + S S,< Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S-- S@ S- z - T T-^ TC T-r T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.2 Vm V.C V V.K  .W W  W. W5 W. We W. W W/  / X X/ X X/$ X% X/3 X5 X/H Xt X/\ X X/n  /o Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0, \- \04 \9 \0: \E \0@ \R \0G \_ \0S \p \0e \ \0j \ \0o \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1* \ \10 \ \15 \ \1: \ \1? \ \1D \  \1I \ \1N \ \1S \) \1X \3 \1c \T \1h \[ \1m \f \1t \r \1y \{ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2 \g \2  \o \2 \v \2 \} \2- \ \22 \ \26 \ \2> \ \2H \ \2M \ \2T \ \2Y \ \2` \ \2e \ \2r \ \2x \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3>  3? _ _3Y  3[ ` `3j ` `3z  3{ a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4J d d4K4f d d4g''4 d d4 d d4  4 ~ ~4  45  5< G 5} ~B ~5 ~ ~6 ~ ~6 ~ ~7 ~ ~75 ~ ~7E ~ ~8 ~e ~8 ~ ~8 ~ ~9 ~ ~99 ~ ~9> ~ ~9 ~x ~9 ~ ~9 ~ ~9 ~ ~:4 ~ ~: ~a ~: ~ ~: ~ ~: ~ ~: ~ ~: ~ ~: ~ ~: ~ ~: ~  ~: ~ ~; get_dialect_from_registry.framedialect_objname_obj get_string.framestr $get_nullchar_as_None .framec YDialect_get_lineterminator.frameself oDialect_get_escapechar.frameself Dialect_get_quotechar.frameself Dialect_get_quoting.frameself _set_bool .frame dflttargetsrc _set_int.framename dflttargetsrc S_set_char.framename dflttargetsrc _set_str.framename dflttargetsrc dialect_check_quoting.framequoting Dialect_dealloc.frameself Qdialect_newd.frameselftypekwargsargs,strict(skipinitialspace$quoting quotecharlineterminatorescapechardoublequotedelimiter dialectret b_call_dialect.framedialectkwargsctor_argsdialect_inst parse_save_field.frametmpfieldself Ũparse_grow_buff .frameself 6parse_add_char.framecself ƪparse_process_char.framecself parse_reset.frameself ˋReader_iternext .framelinelen linelineobjselffields eReader_dealloc.frameself #Reader_traverse.framevisitargself ΧReader_clear .frameself 4csv_reader(.framekeyword_argsiteratorargs selfdialect Яjoin_reset.frameself join_append_data$.framequote_emptycwant_escapefieldi quotedcopy_phase rec_lenlinetermdialectself $join_check_rec_size.frameold_recselfrec_len join_append.framequoted quote_emptyfieldself Ԥjoin_append_lineterminator.frameterminator_lenself ;csv_writerow0.framestrappend_okquotedfield ilenseqdialectself +csv_writerows.frame resultrow_objselfrow_iterseqseq %Writer_dealloc.frameself ٱWriter_traverse.framevisitargself Writer_clear .frameself mcsv_writer(.framekeyword_argsoutput_fileargs selfdialect csv_list_dialects.frame csv_register_dialect(.frame dialectkwargsname_objargsdialect_obj csv_unregister_dialect .framename_obj Qcsv_get_dialect.framename_obj dcsv_field_size_limit .frameargsold_limitnew_limit init_csv .framestylemodule ~ ~  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ~ ~4  45   55 G 5_ ~/ ~5o ~D ~5 ~~ ~6; ~ ~6| ~[ ~6 ~ ~7' ~ ~7S ~2 ~7| ~[ ~7 ~ ~7 ~ ~7 ~ ~99 ~ ~9? ~# ~9b ~F ~9 ~m ~9 ~ ~:P ~6 ~: ~s ~: ~ ~: ~ ~;Q ~V ~; ~ ~; ߡnewblock.framerightlinkleftlinklen freeblock.frameb Ddeque_new.framedequetype deque_pop.frameprevblockitemdeque ~deque_popleft.frameprevblockitemdeque deque_append.frameitemdeque deque_appendleft.frameitemdeque {consume_iterator .frameit deque_extend .frameitemit resultsdequeiterable deque_extendleft .frameitemit resultsdequeiterable deque_inplace_concat.frameotherdeque _deque_rotate .framenextblockprevblockmnlendeque Ydeque_rotate.framedequeargsn deque_reverse .frametmpinleftblockdeque bdeque_count0.framevleftblockleftindexistart_statecount ndeque +deque_len.framedeque 3deque_remove$.framevalueindeque ]deque_clear.framedeque deque_item.framedequei }deque_del_item.frameideque deque_ass_item$.framevindexhalflenideque deque_clearmethod.framedeque deque_dealloc.framedeque deque_traverse$.framevisitargb indexindexhideque deque_copy.framedeque fdeque_reduce$.frameresult aslistdictdeque deque_repr.frameresult fmtaslistdeque deque_tp_print(.frameitemitfp_savedequeseparator emit deque_richcompare0.frameby xit1op cmpit2vw deque_init8.framedequekwdargsargskwlist maxlenmaxlenobjiterable deque_sizeof.framedeque Fdeque_get_maxlen.framedeque sdeque_iter .frameitdeque dequeiter_traverse.framevisitargdio dequeiter_dealloc.framedio 3dequeiter_next.frameit dequeiter_len.frameit deque_reviter .frameitdeque dequereviter_next.frameit defdict_missing.framevalue tupkeydd sdefdict_copy.framedd defdict_reduce(.frame resultitemsargsdd defdict_dealloc .framedd defdict_print.framestsddfp_save &defdict_repr .frame resultdefreprbasereprdd idefdict_traverse.framevisitargself defdict_tp_clear .framedd defdict_init(.frameresultkwdsnewargsn newdefaultolddefaultddselfargs Dinit_collections.framem ~ ~  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ~ ~4 ~ ~5 ~I ~57 ~q ~5J ~ ~5n ~ ~5 ~ ~5 ~ ~5 2internal_bisect_right.frame reslitemitemmidlistlo hi 8bisect_right8.frameitemlistkwargshi lo insort_right<.frameitemlistkwargshilo internal_bisect_left.frame resitemlitemmidlistlo hi bisect_left8.frameitemlistkwargshi lo insort_left<.frameitemlistkwargshilo init_bisect.frame    ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4  4  4  4 % 5 . 5 < 5/  57   5O & 6 h 7T + 8  84   87  8 Y 8 \ 8 ^ 8 f 8 check_matched.framercresultargobj uget_warnings_attr.frameattrwarnings_moduleall_modules get_once_registry .frameregistry xget_default_action .framedefault_action get_filterD.framelineno(ln,is_subclasscategory4good_mod module0good_msgtext$ln_obj modcatactiontmp_itemitemi warnings_filters already_warned.frameshould_setregistrykey Vnormalize_module .frame lenmod_strfilename update_registry .frame rcaltkeyregistrycategorytext add_zerozero show_warning.framesourcelinetextf_stderrfilenamename categorylinenolineno_str warn_explicit@.frame$res show_fxnsourceline to_strrcaction linenocategorymessagefilenameitemlineno_obj resulttextkeyregistrymodule Fsetup_context$.frameargvfile_str lenfilenameregistry modulelinenoglobalsstack_level Bget_category.framecategorymessage do_warn4.frameresmessagecategory registrymodulelinenofilenamestack_level warnings_warn,.framemessagekwdsargs stack_levelcategory Wwarnings_warn_explicitd.frame4returned,source_list(source$module_name loaderlineno filenamecategorymessagekwdsargsmodule_globalsregistrymodule "PyErr_WarnEx.frameresstack_levelmessagecategorytext "PyErr_Warn.frametextcategory "PyErr_WarnExplicit4.frameregistry linenoretmodule filenamecategorymodule_strfilename_strmessagetext $&create_filter(.frame resultlinenocategoryactionaction_obj %init_filters.framefilterspos ' _PyWarnings_Init.framem    , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4  5< ^b ^5G  5H  5a  5f % 5l . 5z < 5  5  55  5 G 6   6  6P   6Q J J6q   7  7 'tb_dealloc .frame_tstatetb (tb_traverse.framevisitargtb )tb_clear .frametb )vnewtracebackobject.frametbframenext *PyTraceBack_Here.frameframeoldtbtstate *{_Py_DisplaySourceLine .framef indent buf p pLastCharlinebuflineno namebuf .safe leni taillen npath path tailxfperrfilename .Mtb_displayline.frameflinenolinebuf namefilename /tb_printinternal(.framef.safelimitdepthtb /PyTraceBack_Print.framef limitv    - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4  5 55q  5t""5  5  5 8 6 e 6E  6G6[  6\gg6d6xg g6g;g6  6  66  6!!66! !7  7*   72  7a B 7y [ 7  7  7  7  7  7  8 0 8 6 85 U 8D e 8g  8r  8 0PyThread_init_thread.frame 0PyThread__init_thread.frame 0PyThread_start_new_thread .frameargfunc 1PyThread_get_thread_ident.frame 1+PyThread_exit_thread.frame 1SPyThread__exit_thread.frame 1fdo_PyThread_exit_prog.frameno_cleanupstatus 1PyThread_exit_prog .framestatus 1PyThread__exit_prog .framestatus 1PyThread_allocate_lock.framelk 2 PyThread_free_lock.framelock 2 PyThread_acquire_lock .framewaitflaglock 2VPyThread_release_lock.framelock 2i_pythread_set_stacksize.framesize 2PyThread_get_stacksize.frame 2PyThread_set_stacksize.framesize 2find_key.framevalueprev_pkeyp id 3PyThread_create_key.frame 3PyThread_delete_key.frameqkey 4PyThread_set_key_value.framevaluekey 4HPyThread_get_key_value.framekey 4qPyThread_delete_key_value.framekeyid 4PyThread_ReInitTLS.frame qid " "   / , 0  1  ;O   l ( t     a   :  HNOY\ ]u v5  " %*Bg  + ' !! ) "" """V + X##  2## F 8 G$$ Y 9 [ % %s   % %&& % % % %j %; %o"" %@ %'' %J %(( %M %(( 8(( %Z %)) %u %*** * % % % %++ % % G  , ,  ( , , , , N  - -D % %[ -3 - -s - O  .j . . . . . . .0 . . . . . . . . . .  . .; . .D . . .= .  .F . .P .! .^ .3 . .D . .J Q M / / -s - /a / / / / / / / / /> /0 /a /^ /g R i 0 0 0 0 0" 0 T  1 1 18 122 $ 1 1 , 1 1!- 1 1!; 1 1!Z 1 1!h 1 1!n 1 1!~ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1": 1 1"A 1' 1"I 10 1"N 15 1"U 1I 1"a 1i 1"h 1q 1"p 1z 1"u 1 1"| 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1## 1x 1#- 1 1#6 1 1#E 1 1#M 1 1#V 1 1#_ 1 1#g 1 1#r 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$0 3< 3$8 3F 3$< 3J 3$E W $F 4 4$W 4 4$k X $l 5 5${ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%! 6 6%* Z %, 7 7%P 7' 7%d 7; 7%m \ %} 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&! 9 9&& 9 9&. 9 9&8 9 9&A _ &B : :&Z :5 :&d :@ :&p ` &q ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'" d '( ? ?'6 ?& ?'= ?- ?'V e 'm @7 @'t @E @'| @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B($ h (0 C  C(F C# C(M C* C(f CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)) l )* G G)< G G)H G G)c G; G)g G@ G)m GG G)r GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*  K K*9 q *: L L*W r *X M M*p s *q N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+$ Q Q++ Q Q+/ Q% Q+A Q9 Q+R QP Q+Y w +f R R+m R/ R+t R= R+} RM R+ R[ R+ R R+ R R+ y + S S,; Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-] TC T-q T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.1 Vm V.B V V.J  .V W  W.~ W5 W. We W. W W.  / X X/ X X/# X% X/2 X5 X/G Xt X/[ X X/m  /n Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0+ \- \03 \9 \09 \E \0? \R \0F \_ \0R \p \0d \ \0i \ \0n \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1/ \ \14 \ \19 \ \1> \ \1C \  \1H \ \1M \ \1R \) \1W \3 \1b \T \1g \[ \1l \f \1s \r \1x \{ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2, \ \21 \ \25 \ \2= \ \2G \ \2L \ \2S \ \2X \ \2_ \ \2d \ \2q \ \2w \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3=  3> _ _3X  3Z ` `3i ` `3y  3z a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4I d d4J4e d d4f''4 d d4 d d4  4 " "4  5 % 5 " "5i ^b ^5t " "5u  5  5 % 5 . 5 < 5 " "5 _ _5 " "5  6# " "6 " "6 " "6 " "6 " "6 " "6 " "6 " "6 " "7 " "7x " "7 " "7 " "7 " "7 " "7 " "7 " "8J " "8 " "8 " "8 " "8 "9 "8 "G "8 "g "9 " "9 " "9 "q "9 " "9 " ": " ":# " ":D " ":R "* ":r "P ": "f ": "} ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " ": " "; "v "; " "; 5;PySys_GetObject.framename 5iPySys_GetFile.framedefvnamefp 5PySys_SetObject.framesdnamev 66sys_displayhook .frameoutfbuiltinso 7sys_excepthook,.frame tbvalueexcargs 7sys_exc_info.frame 8Ssys_exc_clear .frametmp_tb tmp_value 9sys_exit.frameargsexit_code 9sys_getdefaultencoding .frame.safe 9sys_setdefaultencoding.frameencodingargs :Lsys_getfilesystemencoding.frame :utrace_init.framei :call_trampoline.frame resultcallbackargs whatargframe ;profile_trampoline .framewhatself argframe ;trace_trampoline(.frame result argselfframewhat )sys_getcheckinterval.frame >>sys_setrecursionlimit.framenew_limitargs >sys_getrecursionlimit .frame.safe >sys_getsizeof,.frametmpmethodokwdsargs dfltres @sys_getrefcount.framearg @sys_getframe.frameargsdepthf Ausys_current_frames.frame A{sys_call_tracing .framefuncargsfuncargs Asys_clear_type_cache.frame Alist_builtin_module_names.frame v nameilist BPySys_ResetWarnOptions.frame CPySys_AddWarnOption.framestrs CPySys_HasWarnOptions.frame C_check_and_flush .frameprev_failstream Dsvnversion_init .frame DjPy_SubversionRevision.frame DvPy_SubversionShortBranch.frame Dmake_flags.frameseqpos Fmake_version_info.framesversion_info pos G_PySys_InitX.frame numbervsyserrsysoutsysin % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 # #4  4  4  5 ) 5   7 # #7y ^b ^7 # #7  7 & 7 + 7 M 7 # #7  78  8> G 8h # #9 # #9 #s #9 # #9 # #9 # #9 # #:+ # #:P #7 #:p #h #: # #: # #: # #;( #1 #;3 #< #; # #; # #<( #Z # % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 $ $4ww45w w5L $ $5 $ $5 $ $6 $ $6( $ $6K $ $6S $ $6t Udev_urandom_noraise.framebuffersizefd dev_urandom_python.framenbufferfd _savesize lcg_urandom .framex0buffersize N_PyOS_URandom .framebuffersize _PyRandom_Init$.frameseedendptrenv secret_sizesecret % %  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 % %4  4  4  5 ) 5   7" % %7$  7.  7O  7 %  %7  7 %  %7  8' %  %8(  8i %  %8s  8 %  %8 ^b ^8 % %8 ] ]9 % %9  9@ & 9E + 9e M 9| % %9 U8 U9 % %9  9 % %9 _ _9 % %9  9 % %< \\ \< % %<ee= %. %=E %Z %=K %` %=] %{ %=r % %= % %> %; %>b % %>p % %> % %> % %> % %> % %> % %> % %> %" %> %9 %? % %? %  %? % %? %b %? %k %? %o %@ %| %@ %Q %@ %d %@ %x %A! % %An % %A % %A %' %B % %C % %C%  CS % %C % %C %, %D  %m %D PyModule_GetWarningsModule.frame Py_IsInitialized.frame add_flag .frameflagenvs 2Py_InitializeExD.frame0sys_isatty,sys_stream4warnings_moduleinstall_sigs8.safesysmod bimodtstateinterp(overridden$free_codeset errorscodeseticodeset Py_Initialize.frame Py_Finalize.frameinterp Py_NewInterpreter$.frame.safebimod save_tstatetstateinterp ePy_EndInterpreter .frameinterptstate Py_SetProgramName.framepn Py_GetProgramName.frame Py_SetPythonHome.framehome Py_GetPythonHome .frame Xinitmain.frame bimoddm initsite .frame XPyRun_AnyFileExFlags.framecloseiterr flagsfpfilename PyRun_InteractiveLoopFlags.framefilenamefp.safev local_flagsflags PyRun_InteractiveOneFlagsH.framemodarenaflagsfilenamefpw v$errcode ps2ps1 maybe_pyc_file .framebuffp ispychalfmagic closeitext _PyRun_SimpleFileExFlags@.frame flagscloseitextfp ffilenamedmretset_file_name PyRun_SimpleStringFlags$.frameflagscommand zparse_syntax_error(.frameholdvtextoffset linenofilenameerrmessage XPyErr_Print.frame lprint_error_text.frameftextoffset handle_system_exit$.framecode tbvalueexceptionexitcode PyErr_PrintEx8.frame$tb2 v2exception2resultargshookset_sys_last_vars tbvexception /PyErr_DisplayD.frame smodstr moduleNameclassName&buftextoffsetlinenofilename messageexceptiontbfvalueerr PyRun_StringFlags(.frame localsglobals arenaflagsstartstrret ïPyRun_FileExFlags0.frameretlocals globalscloseitmod arenaflagsstartfilenamefp Ărun_mod.framev localsglobalscoarenaflagsfilenamemod run_pyc_file.frameflags localsglobalscov magicfp Py_CompileStringFlags(.framecoresult arena flagsstartfilenamestr Py_SymtableString(.framestarenastartfilenamestr flags RPyParser_ASTFromStringH.framemodarena,nlocalflags$errstartfilenames(iflags flags qPyParser_ASTFromFileP.frameerrcodemodarena,nlocalflags$errps2 ps1startfilenamefp(iflagsflags ɱPyParser_SimpleParseFileFlagsD.frame n flagserrstartfilenamefp PyParser_SimpleParseStringFlags8.frame nflagserrstartstr kPyParser_SimpleParseStringFlagsFilename<.frame n flagserrstartfilenamestr PyParser_SimpleParseStringFilename.framestartfilenamestr PyParser_SetError.frameerr err_input8.framevw tbvaluetype errtypemsguerr Py_FatalError.framemsg wait_for_thread_shutdown.frame threading ϵPy_AtExit.framefunc call_sys_exitfunc.frameexitfunc Іcall_ll_exitfuncs.frame Py_Exit.framests initsigs .frame Py_FdIsInteractive .framefilename.safefp ыPyOS_getsig.frame contextsig PyOS_setsig(.frameocontextsig contexthandler PyParser_SimpleParseFile.framestartfilenamefp c  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 & &4445* & &57 & &5] &X &5i &d &5 & &6 &" &64 &N &6\ &w &6 & &6 & &6 & &6 & &6 & &6 & &6 & &6 & &6 & &6 & &7 &$ &7 &( &7 &6 &7 &: &7  &H &76 &_ &7E & &7Q & &7[ & &7` & &7i & &7m & &7| & &7 & &7 & &8 &{ &8" & &83 & &8D & &8i & &8w & &8 &' &8 &1 &8 &7 &8 &A &8 &F &8 &R &8 &[ &8 &b &8 & &9 & &9D Ծcase_insensitive_match.framets _Py_parse_inf_or_nan.frameendptrretval spnegate _PyOS_ascii_strtod.frameresultendptrnptr KPyOS_ascii_strtod .framexendptrfail_pospnptr PyOS_ascii_atof .framenptr PyOS_string_to_double$.frameoverflow_exceptionendptr.safexfail_possresult ؋change_decimal_from_locale_to_dot .framerest_len decimal_point_lenbufferdecimal_point mensure_minimum_exponent_length,.framestartzerosbuf_sizebuffer ڍremove_trailing_zeros .framebuffer Hensure_decimal_point4.frame buf_avail$.safebuf_sizeinsert_countprecisionchars_to_insertpdigit_countdigits_startbuffer convert_to_exp Y_PyOS_ascii_formatd.frameprecision dbuf_sizebuffertmp_formatformat_charformat_lenformat PyOS_ascii_formatd.frame dformatbuf_sizebuffer Uformat_float_shortX.frame4vdigits_start8vdigits_end,decptformat_codeuse_alt_formattingadd_dot_0_if_integer0digits_len$typealways_add_sign float_stringsdigitsdigits_endsigndecpt_as_intprecision moded(use_exp$exppbuf PyOS_double_to_string4.frametypeval precisionformat_codeflags ' '  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 ' '4  5 ' '5$ '' '5w 'z '6 ' '6W '_ '6c 'n '6v ' '6 ' '6 ' '6 ' '6 ' '6 ' '6 ' '6 ' '6 '  '6 '# '6 ') '7 ': '7 'T '7" '] '7+ 'i '7: 'z '7B ' '7H ' '7V &PyInterpreterState_New.frameinterp PyInterpreterState_Clear.framepinterp zapthreads .frameinterp PyInterpreterState_Delete.framepinterp Sthreadstate_getframe.frameself [new_threadstate.frameinittstateinterp {PyThreadState_New .frameinterp _PyThreadState_Prealloc .frameinterp _PyThreadState_Init.frametstate PyThreadState_Clear.frametstate *tstate_delete_common.framepinterptstate prev_p PyThreadState_Delete.frametstate mPyThreadState_DeleteCurrent .frametstate PyThreadState_Get.frame PyThreadState_Swap.framenewts PyThreadState_GetDict.frame UPyThreadState_SetAsyncExc.frameold_excidexcinterp PyInterpreterState_Head.frame PyInterpreterState_Next.frameinterp PyInterpreterState_ThreadHead.frameinterp PyThreadState_Next.frametstate _PyThread_CurrentFrames(.framestatid tframeiresult 'PyThreadState_IsCurrent.frametstate =_PyGILState_Init.frameti e_PyGILState_Fini.frame _PyGILState_NoteThreadState .frametstate PyGILState_GetThisThreadState.frame PyGILState_Ensure.framecurrenttcur zPyGILState_Release .frameoldstatetcur ( (  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 ( (5) copysign.framexy Vround$.frameyabsxx ) )   !   >Y ( F  T ) )_ d dbeejee d d d d'') d d2 d dB )  )J ) )P PyFPE_dummy.frame + +  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 + +4 U8 U5  + +5  + +5 +# +5 +( +5 +5 +5" +< +5& +B +57 +S +5T +q +5 + +5 + +5 block_new .framesize block_free .framenextb %block_alloc.framesizeb PyArena_New .framearena PyArena_Free.framearena [PyArena_Malloc.framesizearena PyArena_AddPyObject.framerobjarena , ,  * , +  ,  6J   g ( o  }   a   5  CIJTW Xp q5 "  %=b  + ' !! ) """"Q + S##  -## A 8 B$$ T 9 V % %n   % %&& % % % %e %; %j"" %@ %'' %J %(( %M %((3(({ %Z %)) %u %*** * % % % %++ % % G  , ,  # , , , , N  - -? % %V -3 - -s - O  .j . . . . . . .+ . . . . . . . . . . . .6 . .? . . .= . .F . .P . .^ .. . .? . .E Q H / / -s - /a / / / / /  / / / /9 /0 /\ /^ /b R d 0 0| 0 0 0" 0 T  1 1 18 122  1 1 ' 1 1!( 1 1!6 1 1!U 1 1!c 1 1!i 1 1!y 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"5 1 1"< 1' 1"D 10 1"I 15 1"P 1I 1"\ 1i 1"c 1q 1"k 1z 1"p 1 1"w 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#( 1 1#1 1 1#@ 1 1#H 1 1#Q 1 1#Z 1 1#b 1 1#m 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$+ 3< 3$3 3F 3$7 3J 3$@ W $A 4 4$R 4 4$f X $g 5 5$v 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%% Z %' 7 7%K 7' 7%_ 7; 7%h \ %x 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&! 9 9&) 9 9&3 9 9&< _ &= : :&U :5 :&_ :@ :&k ` &l ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '# ? ?'1 ?& ?'8 ?- ?'Q e 'h @7 @'o @E @'w @O @'{ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (+ C  C(A C# C(H C* C(a CF C(z i ({ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)$ l )% G G)7 G G)C G G)^ G; G)b G@ G)h GG G)m GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*4 q *5 L L*R r *S M M*k s *l N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+& Q Q+* Q% Q+< Q9 Q+M QP Q+T w +a R R+h R/ R+o R= R+x RM R+ R[ R+ R R+ R R+ y + S S,6 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-X TC T-l T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V., Vm V.= V V.E  .Q W  W.y W5 W. We W. W W.  . X X/  X X/ X% X/- X5 X/B Xt X/V X X/h  /i Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0& \- \0. \9 \04 \E \0: \R \0A \_ \0M \p \0_ \ \0d \ \0i \ \0s \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1* \ \1/ \ \14 \ \19 \ \1> \  \1C \ \1H \ \1M \) \1R \3 \1] \T \1b \[ \1g \f \1n \r \1s \{ \1x \ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2' \ \2, \ \20 \ \28 \ \2B \ \2G \ \2N \ \2S \ \2Z \ \2_ \ \2l \ \2r \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]38  39 _ _3S  3U ` `3d ` `3t  3u a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4D d d4E4` d d4a''4 d d4 d d4  4 , ,4225 ,  ,5!!!5 , ,5 ,@ ,5 ,^ ,6\ , ,6| PyOS_strtoul.framec ovlimitstrbaseptr PyOS_strtol.framebaseptr signstr - -  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 - -4225 -( -55 -E -5Z PyOS_snprintf.framesizestrformat PyOS_vsnprintf.frame vaformatstrsize . .  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 . .4 . .4 . .5 .: .5u . .5 . .5 .  .6 . .7I Py_InitModule48.framedoc v passthroughmlnmethodsdmnamemessagemodule_api_version countformat.frameformatendchar Odo_mkdict(.frameendcharerrvkflagsp_vap_formatid n itemfailed (do_mklist .frameendcharflagsp_vaivp_format itemfailed n 0_ustrlen .frameu Qdo_mktuple .frameendcharflagsp_vaivp_format itemfailed n Ydo_mkvalue,.framevstrpun.safep_vap_formatflags  Py_BuildValue.frameformat ,_Py_BuildValue_SizeT.frameformat PPy_VaBuildValue.framevaformat s_Py_VaBuildValue_SizeT.framevaformat va_build_value$.frame lvavaflagsfformat ,PyEval_CallFunction.frame resargsobjformat PyEval_CallMethod .frameres argsformatmethmethodnameobj KPyModule_AddObject.framename.safeom YPyModule_AddIntConstant.frameonamemvalue PyModule_AddStringConstant.frameonamemvalue / /   / , 0  1  ;O   l ( t     a   :  HNOY\ ]u v5  " %*Bg  + ' !! ) "" """V + X##  2## F 8 G$$ Y 9 [ % %s   % %&& % % % %j %; %o"" %@ %'' %J %(( %M %(( 8(( %Z %)) %u %*** * % % % %++ % % G  , ,  ( , , , , N  - -D % %[ -3 - -s - O  .j . . . . . . .0 . . . . . . . . . .  . .; . .D . . .= .  .F . .P .! .^ .3 . .D . .J Q M / / -s - /a / / / / / / / / /> /0 /a /^ /g R i 0 0 0 0 0" 0 T  1 1 18 122 $ 1 1 , 1 1!- 1 1!; 1 1!Z 1 1!h 1 1!n 1 1!~ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1": 1 1"A 1' 1"I 10 1"N 15 1"U 1I 1"a 1i 1"h 1q 1"p 1z 1"u 1 1"| 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1## 1x 1#- 1 1#6 1 1#E 1 1#M 1 1#V 1 1#_ 1 1#g 1 1#r 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$0 3< 3$8 3F 3$< 3J 3$E W $F 4 4$W 4 4$k X $l 5 5${ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%! 6 6%* Z %, 7 7%P 7' 7%d 7; 7%m \ %} 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&! 9 9&& 9 9&. 9 9&8 9 9&A _ &B : :&Z :5 :&d :@ :&p ` &q ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'" d '( ? ?'6 ?& ?'= ?- ?'V e 'm @7 @'t @E @'| @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B($ h (0 C  C(F C# C(M C* C(f CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)) l )* G G)< G G)H G G)c G; G)g G@ G)m GG G)r GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*  K K*9 q *: L L*W r *X M M*p s *q N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+$ Q Q++ Q Q+/ Q% Q+A Q9 Q+R QP Q+Y w +f R R+m R/ R+t R= R+} RM R+ R[ R+ R R+ R R+ y + S S,; Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-] TC T-q T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.1 Vm V.B V V.J  .V W  W.~ W5 W. We W. W W.  / X X/ X X/# X% X/2 X5 X/G Xt X/[ X X/m  /n Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0+ \- \03 \9 \09 \E \0? \R \0F \_ \0R \p \0d \ \0i \ \0n \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1/ \ \14 \ \19 \ \1> \ \1C \  \1H \ \1M \ \1R \) \1W \3 \1b \T \1g \[ \1l \f \1s \r \1x \{ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2, \ \21 \ \25 \ \2= \ \2G \ \2L \ \2S \ \2X \ \2_ \ \2d \ \2q \ \2w \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3=  3> _ _3X  3Z ` `3i ` `3y  3z a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4I d d4J4e d d4f''4 d d4 d d4  4 /  /4 0+ 05 0Y 05% /  /5 ^b ^5 /  /5  5 / /5 /C /6" / /7 / /7 /h /8 /w /9 /+ /9 /j /: / /: / /: /# /: /8 /: /S /: /x /: / /: 'w_more.framecnewsizesizep w_string.framenps |w_short .framepx w_long .framepx w_PyLong .framedji npob w_object8.frame spb coitvaluekey posi utf8ok ownbuf.safe xpv &PyMarshal_WriteLongToFile,.framexversion wffp &PyMarshal_WriteObjectToFile,.framexversion wffp 'Zr_string.framepns 'r_short .framexp (r_long.framexfpp *r_long64,.framebufis_little_endianonehi4lo4p *r_PyLong,.framej diob sizeshorts_in_top_digitnp -r_objectd.frameLfirstlineno,code(flags$stacksize nlocalsargcountPlnotabHnameDfilename@cellvarsread_object.framevp BPyMarshal_ReadShortFromFile(.frame rffp BPyMarshal_ReadLongFromFile(.frame rffp Cgetfilesize0.frame.ret st$.safefp CYPyMarshal_ReadLastObjectFromFile(.framev pBuffpfilesize D7PyMarshal_ReadObjectFromFile,.frame$result rffp DPyMarshal_ReadObjectFromString,.frame$resultlen rfstr Eset_error .frameerror EYPyMarshal_WriteObjectToString0.framexversion wf Fmarshal_dumpD.frame wf(f$xargs,version H+marshal_load0.frame$result rff Hmarshal_dumps.framexargsversion I'marshal_loads@.frame,result rf(n$sargs IPyMarshal_Init.frame 1 1  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 1 14  4  4  5 ) 5   7" 1 17; U8 U7C 1  17 W W7 1  18  8 1  18  84 1  18 ^b ^8 1  18 ] ]8 1 18 _ _8 1 18  9  1 19! 2 29W 1 19Zww9b9w w9 1W 19 1~ 1: 1 1:< 1 1:H 1 1: 1 1:  : 1 1: 1P 1;U 1 1; 1 1; 1= 1; 1v 1<" 1 1<3 1 1<` 1 1" 1 1>k 1 1> 1T 1?C 1 1?Q 1 1?Y 1 1?a 1 1? 1A 1? 1i 1@* 1 1@^ 1 1@ 1[ 1A 1 1AK 1 1A 1G 1A 1_ 1A 1y 1A 1 1B7 1  1B 1  1B 1  1Cs 1 G 1C{ 1 P 1C 1 g 1C 1  1C 1  1D# 1  1D- 1  1Df 1 F 1Dt 1 U 1Ey 1 [ 1E 1  1E 1  1E 1  1E 1  1E 1  1E 1  1E 1  1E 1  1E 1  1E 1  1Fi 1 e 1F J%isdir,.frame statbufpath Ja_PyImport_Init .framefiletab countDcountS K_PyImportHooks_Init .framezipimporter zimpimporterrvpath_hooks M_PyImport_Fini.frame N0_PyImport_AcquireLock.frametstateme N_PyImport_ReleaseLock .frame OA_PyImport_ReInitLock.frame Ojimp_lock_held.frame Oimp_acquire_lock.frame Oimp_release_lock .frame Oimp_modules_reloading_clear .frame OPyImport_GetModuleDict .frameinterp P'PyImport_Cleanup<.frame namekeyposndone$pdictvalue modulesinterp V7PyImport_GetMagicNumber.frame V>_PyImport_FixupExtension .framecopyfilenamemodname W6_PyImport_FindExtension.framemodnamedictfilename WPyImport_AddModule.framemnamemodules Xremove_module.framenamemodules XPyImport_ExecCodeModule.frameconame YPyImport_ExecCodeModuleEx$.framecovpathname.safe dnamemodules Zmake_compiled_pathname.framelenbufbuflenpathname [check_compiled_module.framepathnamemtimefpcpathname [read_compiled_module.framecpathnamecofp \Oload_compiled_module.frame mnamecocpathnamefp ]$parse_source_module4.framearenapathnamefp flagsco ]open_exclusive.framemodefilename ^write_compiled_module.frame mtimecofpcpathnamesrcstat _update_code_filenames .frame inconstantsnewnameoldnameco `9update_compiled_module.framenewnameoldnamepathname .safeco `load_source_moduleT.frame4mname0co$fpc,cpathname(buf8mtimepathname stD.safefp cHload_package@.frame filedpathnamemnamefpbufpath eis_builtin.frameiname eget_path_importer .frameerrjimporterppath_importer_cache nhookspath_hooks gPyImport_GetImporter.framepathpath_importer_cacheimporter gfind_module.framep_fpwarnstr8loader0v len,copynamelen$path_importer_cache path_hooks bufbuflen.safefullnamepathinpath,meta_path(namesubnamefpfdpp_loader s _PyImport_FindModule .framep_loaderp_fp buflenbufpathname sI_PyImport_IsScript.framefd sgcase_ok.frame smfind_init_module@.frame,statbuf pnameisave_lenbuf tload_module .framepathnamename typefploader vinit_builtin.framepname wfind_frozen.framenamep wget_frozen_object.framename xuPyImport_ImportFrozenModule0.frame m errsdcoispackagesizepname zPyImport_ImportModule.frameresultpnamename zPyImport_ImportModuleNoBlock.framename {Vimport_module_level4.frame fromlistnexttailheadlevelbufglobalsnamebuflen ~MPyImport_ImportModuleLevel.frameresultlevel fromlistlocalsglobalsname ~get_parent<.frame,.safeerr_msgparent(errorpkgname$lenstartmodnamep_buflenbufglobalsorig_level level load_next$.frameresultaltmod lenpp_buflen bufmoddotnamep_name mark_miss.framename ;ensure_fromlist0.framesubmodsubnameret buflenbufallrecursiveitemfromlistimod add_submodule.frame subnamefullnamemodulessubmodmod import_submodule<.framemfdpbufsubname pathfploadermodfullnamemodules PyImport_ReloadModuleX.frame0newm(fdp$buf8parent4parentname subnamename,fploaderpath modulesmmodules_reloading PyImport_Import4.framemodule_name builtinsglobalsrimport imp_get_magic.framebuf Fimp_get_suffixes .frame itemfdplist Pcall_find_module4.frameretfob fdppathnamenamepathfp imp_find_module.framenameargspath imp_init_builtin.framenameargs Uimp_init_frozen.framenameargs imp_get_frozen_object.framenameargs imp_is_builtin.frame.safenameargs Nimp_is_frozen.framenameargs get_file.framefppathnamemodefob imp_load_compiled0.framemfppathnamenameargs fob imp_load_source0.framemfppathnamenameargs fob {imp_load_module@.frametypemodesuffix pathnamefobnameargs imp_load_package.framepathnamenameargs &imp_new_module.framenameargs aimp_reload.framev tsetint.frameerrvnamedvalue NullImporter_init.framepathargskwds NullImporter_find_module.frame initimp .framedm PyImport_ExtendInittab.framepi nnewtab PyImport_AppendInittab .frameinitfuncnamenewtab 3 3  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 3 35 , 5 3 35 Py_GetVersion$.frame.safe 4 4  * , +  ,  6J   g ( o  }   a   5  CIJTW Xp q5 "  %=b  + ' !! ) """"Q + S##  -## A 8 B$$ T 9 V % %n   % %&& % % % %e %; %j"" %@ %'' %J %(( %M %((3(({ %Z %)) %u %*** * % % % %++ % % G  , ,  # , , , , N  - -? % %V -3 - -s - O  .j . . . . . . .+ . . . . . . . . . . . .6 . .? . . .= . .F . .P . .^ .. . .? . .E Q H / / -s - /a / / / / /  / / / /9 /0 /\ /^ /b R d 0 0| 0 0 0" 0 T  1 1 18 122  1 1 ' 1 1!( 1 1!6 1 1!U 1 1!c 1 1!i 1 1!y 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"5 1 1"< 1' 1"D 10 1"I 15 1"P 1I 1"\ 1i 1"c 1q 1"k 1z 1"p 1 1"w 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#( 1 1#1 1 1#@ 1 1#H 1 1#Q 1 1#Z 1 1#b 1 1#m 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$+ 3< 3$3 3F 3$7 3J 3$@ W $A 4 4$R 4 4$f X $g 5 5$v 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%% Z %' 7 7%K 7' 7%_ 7; 7%h \ %x 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&! 9 9&) 9 9&3 9 9&< _ &= : :&U :5 :&_ :@ :&k ` &l ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '# ? ?'1 ?& ?'8 ?- ?'Q e 'h @7 @'o @E @'w @O @'{ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (+ C  C(A C# C(H C* C(a CF C(z i ({ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)$ l )% G G)7 G G)C G G)^ G; G)b G@ G)h GG G)m GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*4 q *5 L L*R r *S M M*k s *l N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+& Q Q+* Q% Q+< Q9 Q+M QP Q+T w +a R R+h R/ R+o R= R+x RM R+ R[ R+ R R+ R R+ y + S S,6 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-X TC T-l T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V., Vm V.= V V.E  .Q W  W.y W5 W. We W. W W.  . X X/  X X/ X% X/- X5 X/B Xt X/V X X/h  /i Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0& \- \0. \9 \04 \E \0: \R \0A \_ \0M \p \0_ \ \0d \ \0i \ \0s \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1* \ \1/ \ \14 \ \19 \ \1> \  \1C \ \1H \ \1M \) \1R \3 \1] \T \1b \[ \1g \f \1n \r \1s \{ \1x \ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2' \ \2, \ \20 \ \28 \ \2B \ \2G \ \2N \ \2S \ \2Z \ \2_ \ \2l \ \2r \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]38  39 _ _3S  3U ` `3d ` `3t  3u a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4D d d4E4` d d4a''4 d d4 d d4  4 4 44 TPy_GetPlatform.frame 5 5  6 7h}5 5 5, 5  5 Z_PyOS_ResetGetOpt.frame _PyOS_GetOpt.frameoptionoptstringargcargv 6 6  + , ,  -  7K   h ( p  ~   a   6  DJKUX Yq r5 " !&>c  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 6 64 6 64 Py_GetCopyright.frame 7 7  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 7 74 Py_GetCompiler.frame 8 8  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 8 84225 8 85 8 86 8 87 8 87& 8" 87, 8( 873 8/ 87A 8C 87K 8W 87n 8z 87 8 87 8 88 8 89/ 8P 89U 8 89 8 89 8 8: 81 8:_ 8 8;7 8e 8;< 8j 8;v 8 8<1 8b 8 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 : :4225% : :5; :( :5 :u :5 : :5 : :5 : :5 : :5 : :5 : :6* :# :6Y :U :7  : :7 :~ :7 : :7 : :7 : :8  : :8 PyErr_Restore.framevaluetypeoldtraceback oldvaluetstatetraceback PyErr_SetObject.framevalueexception PyErr_SetNone .frameexception PyErr_SetString.framevalueexceptionstring XPyErr_Occurred.frame hPyErr_GivenExceptionMatches$.frameresreclimittbvalue exceptioninerrexc 'PyErr_ExceptionMatches.frameexc.safe KPyErr_NormalizeException,.frametstateinitial_tbtbresargs inclasstypevaluevalexc cPyErr_Fetch.framep_tracebackp_valuep_type PyErr_Clear.frame PyErr_BadArgument .frame PyErr_NoMemory .frame ,PyErr_SetFromErrnoWithFilenameObject .framevexcfilenameObject i PyErr_SetFromErrnoWithFilename.frameresultnameexcfilename BPyErr_SetFromErrno .frameexc ]_PyErr_BadInternalCall.framelinenofilename PyErr_BadInternalCall .frame PyErr_Format.framestringexceptionformat PyErr_NewException0.framebasedotdictnameresultbasesmydict classnamemodulename #PyErr_NewExceptionWithDoc .framebasenameresultdocobjdoc dict mydictret PyErr_WriteUnraisable,.frameobjmodstrmoduleNameclassNameftb vt PyErr_SyntaxLocation .framefilenametmplineno tbvexc HPyErr_ProgramText.framepLastCharlinebufifplinenofilename ;r ;  : , ;  <  FZ   w (      a   E  SYZdg h 5+ " 05Mr  + ' !! ) ""-""a + c##   =## Q 8 R$$ d 9 f % %~   % %&& % %% % %u %; %z"" %@ %''  %J %((% %M %&((+C(( %Z %)) %u %*** * % % % %++ % % G  , ,  3 , , , , N  - -O % %f -3 - -s - O  .j . . . . . . .; . . . . . . . .  . . . .F . .O . . .= . .F . .P ., .^ .> . .O . .U Q X / / -s - /a / / / / / / /! / /I /0 /l /^ /r R t 0 0 0 0 0" 0 T  1 1 18 122 / 1 1 7 1 1!8 1 1!F 1 1!e 1 1!s 1 1!y 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1" 1 1"E 1 1"L 1' 1"T 10 1"Y 15 1"` 1I 1"l 1i 1"s 1q 1"{ 1z 1" 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1#$ 1k 1#. 1x 1#8 1 1#A 1 1#P 1 1#X 1 1#a 1 1#j 1 1#r 1 1#} 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$  V $ 3 3$# 3  3$; 3< 3$C 3F 3$G 3J 3$P W $Q 4 4$b 4 4$v X $w 5 5$ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6% 67 6%  6> 6% 6E 6% 6g 6% 6v 6%& 6~ 6%, 6 6%5 Z %7 7 7%[ 7' 7%o 7; 7%x \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9& 9z 9&  9 9& 9 9& 9 9&& 9 9&, 9 9&1 9 9&9 9 9&C 9 9&L _ &M : :&e :5 :&o :@ :&{ ` &| ; ;& a & < <& b & = =&& = =& =2 =& c ' > >' >  >' >& >'- d '3 ? ?'A ?& ?'H ?- ?'a e 'x @7 @' @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B( B- B( B3 B( BR B(/ h (; C  C(Q C# C(X C* C(q CF C( i ( D D( j ( E E( E& E( EA E( k ( F F)  FA F)* FK F)4 l )5 G G)G G G)S G G)n G; G)r G@ G)x GG G)} GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*+ K K*D q *E L L*b r *c M M*{ s *| N N* t * O O* O, O+ u + P P+ P P+ v + Q Q+* Q Q+/ Q Q+6 Q Q+: Q% Q+L Q9 Q+] QP Q+d w +q R R+x R/ R+ R= R+ RM R+ R[ R+ R R+ R R+ y + S S,F Sr S, S S, S S, S  S, S S, S S, S S, S( S- S9 S-- S@ S-% z -' T T-h TC T-| T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V..  V V.< Vm V.M V V.U  .a W  W. W5 W. We W. W W/   /  X X/ X X/. X% X/= X5 X/R Xt X/f X X/x  /y Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0! \ \06 \- \0> \9 \0D \E \0J \R \0Q \_ \0] \p \0o \ \0t \ \0y \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1* \ \1/ \ \14 \ \1: \ \1? \ \1D \ \1I \ \1N \  \1S \ \1X \ \1] \) \1b \3 \1m \T \1r \[ \1w \f \1~ \r \1 \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \2 \M \2 \V \2  \^ \2 \g \2 \o \2 \v \2 \} \27 \ \2< \ \2@ \ \2H \ \2R \ \2W \ \2^ \ \2c \ \2j \ \2o \ \2| \ \2 \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3  ^S ^3 ^Y ^3 ^b ^3$ ] ]3H  3I _ _3c  3e ` `3t ` `3  3 a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee4ee4T d d4U4p d d4q''4 d d4 d d4  4 ;y ;4ii5U ; ;5 ; ;5 ;/ ;5 ;M ;6F ; ;6y ; ;6 ;' ;6 ;d ;7c ; ;7 ;: ;7 ;i ;8 ; ;8l ; ;8 ;  ;8 ;Z ;9 ; ;99 ; ;9 ;% ;9 ;d ;9 ;t ;9 ;x ;9 ; ;9 ; ;:@ ; ;:X ; ;:~ ;8 ;: ;O ;: ; ;: ; ;: ; ;;# ; ;;& ; ;;> ;) ;;C ;8 ;;R ;G ;;o ;r ;; ; ;; ; ;; ; ;; ; ;; ; ;< ; ;< ;  ;< ; 0 ;< ; > ;=  ; Z ;= ; w ;= ;  ;>5 ;  ;>n ;  ;>~ ;  ;> Balloc.framexk 0Bfree.framev hmultadd0.frame b1ymcarryawdsb s2b$.framend0i y9snd hi0bits.framex -lo0bits .framey i2b .framei multL.frameDz 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 < <4  4  4  5 ) 5   7" < <7#  7O < <7g U8 U7o < <7p  7~ < <7 ^b ^7 < <7 ] ]8 <  <8  84 & 89 + 8Y M 8p <! <8 = =9 <" <9- << <96 <E <9C <V <9M <a <9S <i <9^ <t <9l < <9 < <9 < <:C <i <:Q <z <;  <4 <;> <j <;l < <; <0 < <  <> <V <?B < <?c < <?s < <? <A <? <Z <? < <? < <@ <c <B< <  <BB <  <BG <  <BK <  <B < < <B <  <B <  <C <  <C < P <C < \ <C < | <C <  <C <  <C <  <C <  <C <  <Do < O <Dz < Z <D <  <Eu < V <E < l <E <  <F < <Fz <b <F < <F < <F < <F < <G{ <s <G 0 _Py_Mangle$.frame bufferplennlenpnameprivateobjident 1compiler_init.framec 1PyAST_Compile@.frame,local_flagsflagsmod arenafilename$c(co 2PyNode_Compile .frame arenafilenamenco 3xcompiler_free.framec 3list2dict$.framek vinlistdict 5Idictbytype8.frame$tuple(itemflagscope_typekkey_i num_keys sorted_keyssrcdesti offset 7compiler_unit_check.frameu 7compiler_unit_free.framenextbu 9compiler_enter_scope .framecapsule lineno .safenamekeycu compiler_set_lineno.frameoffc ?opcode_stack_effect.frameopargopcode Ecompiler_addop.frameopcodec Fxcompiler_add_oH.framev argtdict(real_negzero$zdo Icompiler_addop_o.frameopcode odictc Jcompiler_if,.framenextseq_isendc bcompiler_for,.frameseq_is endcleanupstartc e  >  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 >  >4225 > >56 >2 >5U >] >5g >p >6 > >6+ >9 >6X >h >6 > >6 > >7 >  >8 > >8  >! >8 >, >8  >7 >8G >a >8O BPyCodec_Register.framesearch_functioninterp normalizestring .framelenstring i_PyCodec_Lookup,.frameilenresultvinterpencoding args args_tuple.frameargsobjecterrors kcodec_getitem.framevindexencoding ŷcodec_getincrementalcodec.framereterrors inccodecattrnamecodecsencoding tcodec_getstreamcodec .framestreamcodeccodecs indexstreamerrorsencoding PyCodec_Encoder .frameencoding "PyCodec_Decoder .frameencoding >PyCodec_IncrementalEncoder.frameerrorsencoding bPyCodec_IncrementalDecoder.frameerrorsencoding džPyCodec_StreamReader.frameerrorsstreamencoding DzPyCodec_StreamWriter.frameerrorsstreamencoding PyCodec_Encode .frameverrorsobjectencoderencoding resultargs pPyCodec_Decode .frameverrorsobjectdecoderencoding resultargs PyCodec_RegisterError.framenameerrorinterp ˁPyCodec_LookupError.framehandlernameinterp wrong_exception_type.frame stringnametypeexc PyCodec_StrictErrors .frameexc 4PyCodec_IgnoreErrors.frameendexc PyCodec_ReplaceErrors,.framerestupleres endstartexc qPyCodec_XMLCharRefReplaceErrors@.framerestuple(cresstartpobjectend startexc 2PyCodec_BackslashReplaceErrors8.framerestupleresstartpobjectend startexc strict_errors.frameexc ignore_errors.frameexc replace_errors.frameexc xmlcharrefreplace_errors.frameexc $backslashreplace_errors.frameexc 7_PyCodecRegistry_Init,.frameresfunc iinterp ? ?   2 , 3  4  >R   o ( w     a   =  KQR\_ `x y5# " (-Ej  + ' !! ) "" %""Y + [##  5## I 8 J$$ \ 9 ^ % %v   % %&& % % % %m %; %r"" %@ %'' %J %(( %M %((#;(( %Z %)) %u %*** * % % % %++ % % G  , ,  + , , , , N  - -G % %^ -3 - -s - O  .j . . . . . . .3 . . . . . . . . . .  . .> . .G . .  .= . .F . .P .$ .^ .6 . .G . .M Q P / / -s - /a / / /  / / / / / /A /0 /d /^ /j R l 0 0 0 0 0" 0 T  1 1 18 122 ' 1 1 / 1 1!0 1 1!> 1 1!] 1 1!k 1 1!q 1 1! 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"= 1 1"D 1' 1"L 10 1"Q 15 1"X 1I 1"d 1i 1"k 1q 1"s 1z 1"x 1 1" 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#& 1x 1#0 1 1#9 1 1#H 1 1#P 1 1#Y 1 1#b 1 1#j 1 1#u 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $  3 3$ 3  3$3 3< 3$; 3F 3$? 3J 3$H W $I 4 4$Z 4 4$n X $o 5 5$~ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6% 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%$ 6 6%- Z %/ 7 7%S 7' 7%g 7; 7%p \ % 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&$ 9 9&) 9 9&1 9 9&; 9 9&D _ &E : :&] :5 :&g :@ :&s ` &t ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'% d '+ ? ?'9 ?& ?'@ ?- ?'Y e 'p @7 @'w @E @' @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(' h (3 C  C(I C# C(P C* C(i CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F)" FK F), l )- G G)? G G)K G G)f G; G)j G@ G)p GG G)u GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*# K K*< q *= L L*Z r *[ M M*s s *t N N* t * O O* O, O* u * P P+  P P+ v + Q Q+" Q Q+' Q Q+. Q Q+2 Q% Q+D Q9 Q+U QP Q+\ w +i R R+p R/ R+w R= R+ RM R+ R[ R+ R R+ R R+ y + S S,> Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S-- S@ S- z - T T-` TC T-t T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-. V V.4 Vm V.E V V.M  .Y W  W. W5 W. We W. W W/  / X X/ X X/& X% X/5 X5 X/J Xt X/^ X X/p  /q Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0. \- \06 \9 \0< \E \0B \R \0I \_ \0U \p \0g \ \0l \ \0q \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1, \ \12 \ \17 \ \1< \ \1A \ \1F \  \1K \ \1P \ \1U \) \1Z \3 \1e \T \1j \[ \1o \f \1v \r \1{ \{ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \2 \^ \2 \g \2  \o \2 \v \2 \} \2/ \ \24 \ \28 \ \2@ \ \2J \ \2O \ \2V \ \2[ \ \2b \ \2g \ \2t \ \2z \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3  ^Y ^3 ^b ^3 ] ]3@  3A _ _3[  3] ` `3l ` `3|  3} a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4L d d4M4h d d4i''4 d d4 d d4  4 ?  ?5B ^b ^5M ? ?5N  5g  5l % 5r . 5 < 5 ? ?5 _ _5 ? ?6G = =6^ ? ?6_  6i6  6 G 6 ? ?6227< ?H ?7 ? ?7!!8( ? ?8*  8T ? ?8 ?' ?8 ?4 ?8 ?; ?8 ?O ?8 ? ?8 ? ?9: ?  ?9 ?g ?9 ? ?9 ? ?9 ? ?9 ? ?:R ?c ?:b ?~ ?:l ? ?:} ? ?: ? ?: ? ?: ? ?: ? ?: ? ?: ?. ?; ?Q ?; ? ?; ?/ ?< ?O ?< ? ?= ? ?= ? ?>} ? ?> ? ?> ? ??5 ?n ??< ?u ?@m ?  ?@ ?  ?@ ?  ?@ ? ! ?A ? ] ?A| ?  ?B  ? e ?Bl ?  ?B ?  ?C ? u ?C) ?  ?C, ?  ?C0 ?  ?CM ?  ?CT ?  ?C] ?  ?C ? & ?C ? ] ?C ?  ?C ?  ?D. ?  ?DK ?  ?D ? ?D ? ?Ei ? ?E ? ?E ? ?F ? ?F ? ?F( ? ?F ? ?F ? ?F ? ?G ? ?G# ?  ?G8 ? ?Gz ?b ?H6 ?  ?H ?z ?H ?} ?H ? ?H ? ?H ? ?H ? ?I5 PyEval_GetCallStats.frame PyEval_ThreadsInitialized.frame !PyEval_InitThreads .frame \PyEval_AcquireLock .frame zPyEval_ReleaseLock.frame ؏PyEval_AcquireThread .frametstate PyEval_ReleaseThread.frametstate 'PyEval_ReInitThreads.framethreading PyEval_SaveThread .frametstate HPyEval_RestoreThread.frameerrtstate ڣPy_AddPendingCall.frameargfuncilock result rPy_MakePendingCalls .framefuncargir ܣPy_GetRecursionLimit.frame ܪPy_SetRecursionLimit.framenew_limit ܻ_Py_CheckRecursiveCall.framewhere PyEval_EvalCode,.framelocalsglobalsco cPyEval_EvalFrame .framef ~PyEval_EvalFrameEx.frameltbhvaldexc opcode|selftfuncppfunclnhflagsdnk`naxsp`exit_func`hash`items`b`sdlen,t(u v.safeopargthrowflag$wxerrwhystack_pointernext_instrTfirst_instr8freevars4fastlocals\constsXnamesDcofPinstr_prevLinstr_lbHinstr_ub@tstatec  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 @ @4  4  4  5 ) 5   7  @ @7"  7N @ @7 ^b ^7 @ @7 _ _7 @  @7228  @  @8 ii8[ @ @8~ @F @8 @R @8 @} @8 @ @8 @ @9 @ @9  @ @9 @ @9 @h @9 @z @9 @ @9 @ @9 @ @9 @ @:J @C @:W @[ @:d @j @: @ @: @ @;  @ @; @" @;5 @J @;C @Z @;k @ @;u @ @; @ @; @ @; @ @< @6 @<6 @_ @= @ @>B @ @>s @ @> @ @> @ @? @| @? @ @?Y @ @? @( @? @1 @? @H @? @O @? @X @? @e @? @ @@  @ @@5 @ @@U @ @@y @  @@ @ k @@ @ | @@ @  @A @  @A @  @An @  @A @ ] @A @ y @BK @  @B @  @C  @  @C/ wbuiltin___import__<.framenamekwdsargslevelfromlist localsglobals xbuiltin_abs.framev xbuiltin_all.framecmpitemit iternextv ybuiltin_any.framecmpitemit iternextv zbuiltin_apply4.framefuncargsretvalt kwdictalist |builtin_bin .framev |builtin_callable .frame.safev |builtin_filterD.frame(status(good$ok itemj resultlenitargseqfuncargs builtin_format.framevalueargsformat_spec builtin_chr.framesxargs `builtin_unichr.framexargs builtin_cmp(.frame cbaargs builtin_coerce(.frame reswvargs 'builtin_compilel.frame0lengthstr@arenamode cf startstrfilename(cmdkwdsargsc  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 A A4  4  4  5 ) 5   7  A A7!  7+  7L  7 A  A7  7 A  A7 U8 U7 A  A7  7 A  A7  8S A  A8T  8 A A8  8 A A8$$9 A A9/ AC A9 A A9 A A: A A:+ AJ A:M Ap A:T Ax A:X A A: A A: A A; AM A;< Ak A;M A| A;l A A; A A; A A; A A; A A; A A<' AY A AU A> A[ A>\ A A> A A> A A> A* A> AE A?  AX A? Ak A?' Ay A?, A~ A?5 A A?D A A?W A A?f A A?r A A? A A? A A? A A? A A? A A? A8 A? AX A? Af A@ A A@$ A A@M A A@ A A@ A! A@ A? A@ AQ AA  A AA A AA7 A AA] A AAe A AA A 3 AA A K AA A P AA A V AA A c AA A s AA A  ABa A  AB A  AB A M AB A  AC A  AC+ A  AC^ A  ACo A  ACt A  AC A  AC A  AC A < AC A P AC A Z AC A s AC A  AD  A  AD A  AD) A  AD7 A  ADI A  ADc A  ADq A  AD A ' AD A , AD A N AD A  AD A  AE  A  AE A  AE7 A  AE A @ AE A v AF A  AF( A  AFL pnew_identifier.frameidarenan Ӥast_error.frameunerrstr ast_error_finish4.frametmplocfilenamelineno .safeerrstr tbackvaluetype ast_warn.framencmsg ւforbidden_check.framecnx כnum_stmts.framebufiln ZPyAST_FromNode@.framejnumchistmts4.safe kfilename,cnflags arena get_operator.framen ݆set_contextL.frame i4buf ncexpr_namesectx ast_for_augassign.framen ast_for_comp_op.framen ~seq_for_testlist.frame iseqcn $compiler_complex_args8.frame resultchildiargsclenn ast_for_argumentsT.frame,chi4parenthesized0complex_args kj defaultsargsn_argsc(kwarg$varargfound_defaultn_defaultsn Sast_for_dotted_name0.frameieccol_offset linenon nast_for_decorator,.framenc %ast_for_decorators.frame idecorator_seqcn ast_for_funcdef0.framedecorator_seqargsnamecnname_i ast_for_decorated.framencthing ast_for_lambdef .frameargscn vast_for_ifexpr(.frameexpressionbodync &count_list_fors.framen count_list_ifs.framen ast_for_listcompT.frame,j4ifs0n_ifs<.safelc$expression t(for_chchi listcompsn_forseltnc count_comp_fors.framen count_comp_ifs.framen 7ast_for_comprehensionH.frame$j,ifs(n_ifs0.safecompexpressiont for_chi compsn_forsnc ast_for_itercomp .frametypeeltnc [ast_for_dictcomp(.framevaluekeync ast_for_genexp.framenc .ast_for_setcomp.framenc Rast_for_atom.framevalueskeys sizeieltschpynumstrbuferrstrtbackvalue typecnxast_for_slice,.framechstep upperlowerncast_for_binop@.framenewoperator$next_operinopsresultexpr2 expr1ncEast_for_trailer<.frame.safejslicessimplencleft_exprast_for_factor4.framepynumcs .safepnumn ast_for_power,.frameienc ast_for_expr4.framenewoperatorcmpsopsiseqncast_for_call\.framefunc4k0key$chinargskeywordsargsc nkeywords kwargvarargn&ast_for_testlist.framencast_for_testlist_comp .framencast_for_class_bases.framebasescn]ast_for_expr_stmt4.frameeitargetsexpr2expr1chnceast_for_print_stmt<.frameij startc seqdestnast_for_exprlist .framecontextiseqcnast_for_del_stmt.framencast_for_flow_stmt,.frame expr2expr1chcnNalias_for_import_name(.framessch ilena asname_nodestr_nodestr name_nodencstore#ast_for_import_stmtD.frameidx$modname modndots ialiasescol_offsetlinenonc&ast_for_global_stmt .frame iscn'ast_for_exec_stmt,.frameexpr1cn_children localsglobalsn(ast_for_assert_stmt .frameexpr1nc)ast_for_suite0.frame$j ch iendseqcnpos+vast_for_if_stmt@.frame$newobj offisuite_seq n_eliforelse seq1expressioncn0ast_for_while_stmt(.frameseq1expressionnc1ast_for_for_stmt<.frameexpressiontargetnode_targetcseqn2ast_for_except_clause(.frame eexpressionbodyexcc4ast_for_try_stmt@.frameexcept_sti handlers bodycfinallyorelsen_exceptnchn7ast_for_with_item$.framecontentcontext_exprncoptional_vars8mast_for_with_stmt.framereticn9ast_for_classdef,.framebasesdecorator_seq scn;2ast_for_stmt.framecn=parsenumber8.framedx complex$imflagends?decode_utf8 .framev encodinguendsPtr?decode_unicode@.framev rawmode$i rnrwcendsp bufulenencodingBZparsestr4.framevuneed_encodinglenquoteunicodec rawmodesEdparsestrplus.frametemp sivnc B B  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 B B4  4  5 ) 5 B B5DFasdl_seq_new.frameseqnarenasizeGuasdl_int_seq_new.frameseqnarenasize C  C   / , 0  1  ;O   l ( t     a   :  HNOY\ ]u v5  " %*Bg  + ' !! ) "" """V + X##  2## F 8 G$$ Y 9 [ % %s   % %&& % % % %j %; %o"" %@ %'' %J %(( %M %(( 8(( %Z %)) %u %*** * % % % %++ % % G  , ,  ( , , , , N  - -D % %[ -3 - -s - O  .j . . . . . . .0 . . . . . . . . . .  . .; . .D . . .= .  .F . .P .! .^ .3 . .D . .J Q M / / -s - /a / / / / / / / / /> /0 /a /^ /g R i 0 0 0 0 0" 0 T  1 1 18 122 $ 1 1 , 1 1!- 1 1!; 1 1!Z 1 1!h 1 1!n 1 1!~ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1": 1 1"A 1' 1"I 10 1"N 15 1"U 1I 1"a 1i 1"h 1q 1"p 1z 1"u 1 1"| 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1## 1x 1#- 1 1#6 1 1#E 1 1#M 1 1#V 1 1#_ 1 1#g 1 1#r 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$0 3< 3$8 3F 3$< 3J 3$E W $F 4 4$W 4 4$k X $l 5 5${ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%! 6 6%* Z %, 7 7%P 7' 7%d 7; 7%m \ %} 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&! 9 9&& 9 9&. 9 9&8 9 9&A _ &B : :&Z :5 :&d :@ :&p ` &q ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'" d '( ? ?'6 ?& ?'= ?- ?'V e 'm @7 @'t @E @'| @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B($ h (0 C  C(F C# C(M C* C(f CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)) l )* G G)< G G)H G G)c G; G)g G@ G)m GG G)r GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*  K K*9 q *: L L*W r *X M M*p s *q N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+$ Q Q++ Q Q+/ Q% Q+A Q9 Q+R QP Q+Y w +f R R+m R/ R+t R= R+} RM R+ R[ R+ R R+ R R+ y + S S,; Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-] TC T-q T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.1 Vm V.B V V.J  .V W  W.~ W5 W. We W. W W.  / X X/ X X/# X% X/2 X5 X/G Xt X/[ X X/m  /n Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0+ \- \03 \9 \09 \E \0? \R \0F \_ \0R \p \0d \ \0i \ \0n \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1/ \ \14 \ \19 \ \1> \ \1C \  \1H \ \1M \ \1R \) \1W \3 \1b \T \1g \[ \1l \f \1s \r \1x \{ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2, \ \21 \ \25 \ \2= \ \2G \ \2L \ \2S \ \2X \ \2_ \ \2d \ \2q \ \2w \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3=  3> _ _3X  3Z ` `3i ` `3y  3z a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4I d d4J4e d d4f''4 d d4 d d4  4 C  C4  4  4  5  ) 5  7$ C C;) C C;E C/ C;x Cb C; Cw C; C C; C C; C C; C C< C C< C C<- C C<> C( C C C>U C? C>u C_ C> C C> C C> C C?& C C?7 C! CE C  CE Co CF C CG Cu CH C CH C CKh CR CK C CL_ CI CP C CQHast_type_init8.framevaluekeykwnameiargsfieldsself resnumfieldsJ>ast_type_reduce.frameresdictselfJmake_type4.frameresultbasetypefields ifnames num_fieldsKadd_attributes .frameresulttypeattrsilnum_fieldsLast2obj_list.framefunci resultnseqMast2obj_object.frameoM%ast2obj_bool.framebM8ast2obj_int.framebMKobj2ast_object .frameoutarenaobjMobj2ast_identifier.framearenaoutobjMobj2ast_string.framearenaoutobjN:obj2ast_int.frameoutisobjNobj2ast_bool.frameoutsobjOadd_ast_fields.frameempty_tupledPFinit_types.framen_Py_Module.framebodyarenao_Py_Interactive.framebodyarenaoL_Py_Expression.framearenabodyo_Py_Suite.framebodyarenao_Py_FunctionDef.framecol_offsetlineno decorator_listbodyarenaargsnamepq_Py_ClassDef.framecol_offsetlineno decorator_listbodybasesarenanamep_Py_Return.framecol_offsetlinenovalue arenaq._Py_Delete.framecol_offsetlinenotargets arenaqp_Py_Assign.frame col_offsetlinenotargetsarenavalueq_Py_AugAssign.framecol_offset linenoarenavalueoptargetr_Py_Print.framecol_offset linenonlvaluesdestarenar_Py_For.framecol_offsetlineno orelsebodyarenaitertargetsv_Py_While.framecol_offset linenoorelsebodyarenatests_Py_If.framecol_offset linenoorelsebodyarenatestt^_Py_With.framecol_offset linenobodyoptional_varsarenacontext_exprt_Py_Raise.framecol_offset linenotbackinsttypearenau"_Py_TryExcept.framecol_offset linenoorelsehandlersbodyarenaur_Py_TryFinally.frame col_offsetlinenofinalbodybodyarenau_Py_Assert.frame col_offsetlinenomsgarenatestv(_Py_Import.framecol_offsetlinenonames arenavj_Py_ImportFrom.framecol_offset linenolevelnamesmodulearenav_Py_Exec.framecol_offset linenolocalsglobalsarenabodyw._Py_Global.framecol_offsetlinenonames arenawp_Py_Expr.framecol_offsetlineno arenavaluew_Py_Pass.framecol_offsetlinenoarenax_Py_Break.framecol_offsetlinenoarenaxL_Py_Continue.framecol_offsetlinenoarenax_Py_BoolOp.frame col_offsetlinenovaluesarenaopx_Py_BinOp.framecol_offset linenoarenarightoplefty_Py_UnaryOp.frame col_offsetlinenoarenaoperandopz/_Py_Lambda.frame col_offsetlinenoarenabodyargsz_Py_IfExp.framecol_offset linenoarenaorelsebodytest{j_Py_Dict.frame col_offsetlinenovalueskeysarena{_Py_Set.framecol_offsetlinenoelts arena{_Py_ListComp.frame col_offsetlinenogeneratorsarenaelt|b_Py_SetComp.frame col_offsetlinenogeneratorsarenaelt|_Py_DictComp.framecol_offset linenogeneratorsarenavaluekey}a_Py_GeneratorExp.frame col_offsetlinenogeneratorsarenaelt}_Py_Yield.framecol_offsetlinenovalue arena~_Py_Compare.framecol_offset linenocomparatorsopsarenaleft~_Py_Call.framecol_offsetlinenokwargs starargskeywordsargsarenafunc_Py_Repr.framecol_offsetlineno arenavaluel_Py_Num.framecol_offsetlineno arenan_Py_Str.framecol_offsetlineno arenas8_Py_Attribute.framecol_offset linenoarenactxattrvalue_Py_Subscript.framecol_offset linenoarenactxslicevalue_Py_Name.frame col_offsetlinenoarenactxid#_Py_List.frame col_offsetlinenoeltsarenactx_Py_Tuple.frame col_offsetlinenoeltsarenactx_Py_Ellipsis.framearena*_Py_Slice.framestepupperlower arenal_Py_ExtSlice.framedimsarena_Py_Index.framearenavalue_Py_comprehension.frameifs arenaitertargetu_Py_ExceptHandler.framecol_offset linenobodynametypearena_Py_arguments.frame defaultskwargvarargargsarena_Py_keyword.framearenavaluearg}_Py_alias.frameasnamearenanameast2obj_mod.frameoresult value_oast2obj_stmt.frame valueresulto_oast2obj_expr$.framein valueresulto_o ast2obj_expr_context .frameoast2obj_slice.frameoresult value_oast2obj_boolop .frameoXast2obj_operator .frameoast2obj_unaryop .frameoast2obj_cmpop .frameoast2obj_comprehension.frame valueresulto_oĶast2obj_excepthandler.frameo valueresult_oHast2obj_arguments.frame valueresulto_oeast2obj_keyword.frame valueresulto_oʮast2obj_alias.frame valueresulto_oobj2ast_mod,.framevaluei bodyarenalentmpoutobj:obj2ast_stmtP.framelocalsglobalslevelmodulenamesmsgfinalbodyhandlerstbackinsttypeoptional_varscontext_exprtest orelseiternlvaluesdestoptargettargetsbases decorator_list0value,ibody(lenargsnamecol_offsetarena linenotmpoutobj tobj2ast_exprX.frameidslicectxattrsn$kwargs starargskeywordsfunccomparatorsopskeygeneratorselteltskeysorelsetestbodyargsoperandrightleft4value0ivalues,lenopcol_offsetarena linenotmpoutobj@*obj2ast_expr_context.frametmpoutobjAobj2ast_slice0.framevaluei dimslenstepupper lowerarenaouttmpobjGobj2ast_boolop.frametmpoutobjHjobj2ast_operator.frametmpoutobjKzobj2ast_unaryop.frametmpoutobjLobj2ast_cmpop.frametmpoutobjO`obj2ast_comprehension4.frameout valueiifslen iterarenatargettmpobjR@obj2ast_excepthandlerH.frame,value(ibody$lennametypecol_offsetarena linenotmpoutobjWobj2ast_arguments<.frameoutdefaultskwarg vararg$value iargsarenalentmpobj[obj2ast_keyword .frameout valuearenaargtmpobj\obj2ast_alias .frameout asnamearenanametmpobj^init_ast .framedmnPyAST_mod2obj.frametnPyAST_obj2mod4.framearenaresmodeastreq_namereq_typeoPyAST_Check .frameobj DE DE  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  4 DE DE4  45   55 G 5W DE DE5 DE2 DE5 DE> DE5 DEX DE6 DE DE6 DE DE6% DE DE6? DE DE6q DE7 DE6 DE DE8% DE  DE8. DE DE8[ DEH DE8h DEW DE8 DEy DE8 DE DE8o_PyWeakref_GetWeakrefCount.frameheadoinit_weakref.frameobcallbackselfpnew_weakref.framecallbackobresultpcclear_weakref.frameselfp_PyWeakref_ClearRef .framecallbackselfq"weakref_dealloc.frameselfqSgc_traverse.framevisitargselfqgc_clear.frameselfqweakref_call.frameselfkwargsqweakref_hash .frameselfrgweakref_repr(.framenameobjnamebufferselft7weakref_richcompare.frameotherselfopu0get_basic_refs.frameheadproxyprefpuinsert_after.frameprevnewrefuinsert_head.framenewreflistuparse_weakref_init_args.framecallbackp obpfuncnameargsvweakref___new__4.frametypeproxyreflistobkwargsargs callbackselfwweakref___init__.frametmpkwargsargsx proxy_checkref .frameproxyxhproxy_getattr .frameyxyproxy_str.frameproxyynproxy_call.framewvproxyzproxy_repr.framebufproxy{proxy_setattr.framevaluenameproxy{Vproxy_compare .framevproxy| proxy_add .frameyx|proxy_sub .frameyx}lproxy_mul .frameyx~proxy_div .frameyx~proxy_floor_div .frameyx|proxy_true_div .frameyx,proxy_mod .frameyxproxy_divmod .frameyxproxy_pow.framewvproxyproxy_neg.frameproxyproxy_pos.frameproxyWproxy_abs.frameproxyproxy_invert.frameproxyproxy_lshift .frameyxproxy_rshift .frameyxcproxy_and .frameyxproxy_xor .frameyxproxy_or .frameyxsproxy_int.frameproxyproxy_long.frameproxyproxy_float.frameproxyuproxy_iadd .frameyx%proxy_isub .frameyxproxy_imul .frameyxproxy_idiv .frameyx5proxy_ifloor_div .frameyxproxy_itrue_div .frameyxproxy_imod .frameyxEproxy_ipow.framewvproxydproxy_ilshift .frameyxproxy_irshift .frameyxproxy_iand .frameyxtproxy_ixor .frameyx$proxy_ior .frameyxproxy_index.frameproxy*proxy_nonzero .frameoproxyoproxy_dealloc.frameselfproxy_slice.framejiproxyproxy_ass_slice.frame valuejiproxyIproxy_contains .framevalueproxyproxy_length.frameproxyproxy_getitem .frameyxproxy_setitem.framekeyvalueproxyproxy_iter.frameproxy;proxy_iternext.frameproxyyproxy_unicode.frameproxyPyWeakref_NewRef$.framecallbackproxy reflistresultobNPyWeakref_NewProxy$.framecallbackproxy reflistresultobPyWeakref_GetObject .frameref]handle_callback.framerefcallbackPyObject_ClearWeakRefs<.frame(next$i tuple callbackerr_tberr_valueerr_typerestore_error countcurrentlistobject DF) DF  - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 DF, DF8 1F 19  DF. DF9  9!  9%  9F DFZ DF9X DFu DF9\ DF~ DF9 DF DF9 DF DF9 DF DF9 DF DF9 DF DF9 DF DF: DF; DF:( DFT DF:C DFt DF:~ DF DF: DF DF: DF DF: DF DF: DF DF: DF DF: DF DF: DF0 DF;v DF DF; DF DF; DF DF; DF DF; DF DF; DF9 DF< DFB DF< DFW DF  DFh DF>/ DF{ DF>i DF DF> DF DF> DF DF> DF) DF?% DF DF? DF  DF? DFL DF@ DFy DF@S DF DF@X DF DF@^ DF DF@ DF DF@ DF4 DF@ DFW DFAH DF DFAs DF DFA DF  DFA DF Y DFBE DF  DFBU DF  DFB DF  DFB DF i DFC> DF  DFC DF " DFC DF + DFC DF  DFD" DF  DFD DF Q DFD DF g DFD DF  DFE DF < DFF DF  DFFV DF  DFFZ DF  DFF DFY DFF DFh DFG DFf DFH DFF DFH DFR DFI= DF DFI DFW DFI DF DFJ* DF DFJT DF DFJ DFU DFJ DF] DFK DF DFKF DF DFKw DF# DFK DF: DFK DFu DFK DF~ DFK DF DFLa DF DFL DF? DFL DGH DGHL DF DFM DGI# DGIM DF DFM DGJ DGJM DF DFM DGK DGKM DGK@ DGKN DGKh DGKN) DGK DGKN< DGK DGKNS DF DFNT DGL DGLN DF DFN DGM3 DGMP DGM^ DGMP3 DF DFP DF DFP DF( DFQW DF DFQ DF, DFR DF/ DFR DF; DFR DFH DFS  DF DFS% DF DFS DF< DFS DFJ DFS DFV DFT DF DFT+ DF DFTJ DF DFTi DF DFT DFi DFT DF DFT DF DFU DF DFU$ DF DFUC DF DFUb DF  DFU DFN DFU DFk DFU DF DFU DF DFU DF DFV DF DFV) DF DFV8 DF DFVL DF$ DFV DF DFV DF DFV DF DFV DF DFW@ DF* DFWe DFU DFW DFq DFW DF DFW DF DFX* DF) DFX3 DF6 DFXT DF] DFXh DFu DFX| DF DFX DF DFX DF DFX DF DFX DF DFX DF DFY7 DGN DGNY~ DGNd DGNY DGN DGNY DGN DGNY DGN DGNZ# DGN DGNZ DGN DGNZ DGN DGNZ DGN DGNZ DGN DGNZ DGN DGNZ DGN DGNZ DGN DGNZ DGN DGN[) DGN/ DGN[7 DGN= DGN[< DGNE DGN[J DGNS DGN[O DGNX DGN[` DGNi DGN[w DGN DGN[ DGN DGN[ DGN DGN[ DGN DGN[ DGN DGN[ DGN DGN\ DGN DGN\ DGN# DGN\ DGN* DGN\ DGN/ DGN\= DGNO DGN\F DGNY DGN\S DGNp DGN\y DGN DGN\ DGN DGN\ DGN DGN\ DGN DGN\ DGN  DGN\ DGN DGN] DGN6 DGN] DGNE DGN], DGNZ DGN]4 DGNc DGN]o DGN DGN] DGN DGN] DGN DGN] DGN' DGN] DGN7 DGN^ DGN< DGN^ DFG DF^ DFM DF^; DFo DF^E DF{ DF_@ DFw DF_{ DF DF_ DF DF_ DF DF_ DF  DF_ DF  DF_ DF > DF`L DF  DFa DF"P DFboePyUnicodeUCS4_GetMax.framekmake_bloom_mask .framelenptrunicode_member.framechrsetsetlenunicode_resize.frameoldstrunicodelength_PyUnicode_New.frameunicodelengthunicode_dealloc .frameunicode_PyUnicode_Resize.framewvlengthunicodePyUnicodeUCS4_Resize .framelengthunicode"PyUnicodeUCS4_FromUnicode.frameunicodesizeuPyUnicodeUCS4_FromStringAndSize.framesizeuPyUnicodeUCS4_FromString.frameuYPyUnicodeUCS4_FromWideChar.frameunicodesizewmakefmt.framecsize_tflaglongflagprecision zeropadfmtwidthkPyUnicodeUCS4_FromFormatV.framecallresult2ucopysizefmtsize_tflaglongflagp,stringAbufferLrealbuffer$f.safesformatcountvargsPabuffersizeHabufferncallresult callresultsPyUnicodeUCS4_FromFormat.frameformat0PyUnicodeUCS4_AsWideChar.framewunicodesizePyUnicodeUCS4_FromOrdinal.framesordinalPyUnicodeUCS4_FromObject.frameobjPPyUnicodeUCS4_FromEncodedObject .frameerrorsencodinglensobjPyUnicodeUCS4_Decode.frameunicodebuffer errorssizesencodingsPyUnicode_AsDecodedObject.frameerrorsunicodeencodingPyUnicodeUCS4_Encode.framev errorsencodingunicodesizes*PyUnicodeUCS4_AsEncodedObject.frameerrorsunicodeencoding}PyUnicodeUCS4_AsEncodedString.frameverrorsunicodeencoding_PyUnicodeUCS4_AsDefaultEncodedString.frameerrorsunicodePyUnicodeUCS4_AsUnicode.frameunicode#PyUnicodeUCS4_GetSize.frameunicodeFPyUnicodeUCS4_GetDefaultEncoding.frameLPyUnicodeUCS4_SetDefaultEncoding.frameencodingunicode_decode_call_errorhandler<.frame$inptr0outptr,outposrepsizerepptrnewpos reasonendinposstartinposinsizeinputencoding exceptionObjecterrorserrorHandler res outsize(outputrepunicoderestuplePyUnicode_DecodeUTF7.frameerrorssizesPyUnicode_DecodeUTF7Stateful|.frameerrors endinposoutposstartinpose(shiftOutStartpunicode consumedsizeget_field_objectL.frame0tmpname is_attributeargs0keykwargs auto_number,rest indexfirstobjinputvrender_field,.frameoutputtmp format_spec_objectresultokformat_specfieldobjparse_field.framestrfield_nameformat_spec conversioncMarkupIterator_init.framelenptrselfMarkupIterator_next4.frame sfield_presentconversionselfformat_spec_needs_expandingformat_spec field_nameliteralmarkup_followscGdo_conversion.frameconversionobjoutput_markup0.frameoutputexpanded_format_specrecursion_depthformat_specformat_spec_needs_expandingfieldobj conversion auto_numberkwargsargsfield_nameresulttmp;do_markupX.frameauto_numberrecursion_depthkwargsargs output format_spec_needs_expanding0conversion,format_spec$field_namefield_presentliteraliterinput;build_string4.frameauto_numberkwargsargs recursion_depthoutputresultinput@do_string_format,.framekwargsargsinputselfauto_number recursion_depthformatteriter_dealloc.frameitformatteriter_next\.frame,literal_str 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 DO  DO8 1F 19  DO  DO9! DP DP@ DPm DPE DP  DPF DP  DPF' DO# DOF< DO8 DOFM DOI DOFW DOS DOFh DOd DOFy DOu DOF DO DOF DO DOF DO DOF DO DOF DO DOF DO DOF_PyUnicodeUCS4_ToNumeric.framech _PyUnicodeUCS4_IsWhitespace.framech_PyUnicodeUCS4_IsLinebreak.framechigettyperecord.framecode_PyUnicodeUCS4_ToTitlecase.framech_PyUnicodeUCS4_IsTitlecase .framech_PyUnicodeUCS4_ToDecimalDigit .framechC_PyUnicodeUCS4_IsDecimalDigit.framechf_PyUnicodeUCS4_ToDigit .framech_PyUnicodeUCS4_IsDigit.framech_PyUnicodeUCS4_IsNumeric .framech_PyUnicodeUCS4_IsLowercase .framech_PyUnicodeUCS4_IsUppercase .framech/_PyUnicodeUCS4_ToUppercase.framechl_PyUnicodeUCS4_ToLowercase.framech_PyUnicodeUCS4_IsAlpha .framech DQ DQ  + , ,  -  7K   h ( p  ~   a   6  DJKUX Yq r5 " !&>c  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 DQ DQ4  45   57 G 5U DQ DQ5W225 DQ DQ5 DQK DQ5 DQo DQ5 DQ DQ6 DQ DQ6d DQ DQ6 DQ= DQ6 DQN DQ7g DQ  DQ7 DQ DQ89 DQ DQ8@ DQ DQ8 DQ5 DQ8 DQK DQ8 DQn DQ8 DQy DQ8 DQ DQ9 DQ DQ9# DQ DQ91 DQ DQ95 DQ DQ9T DQ DQ9e DQs DQ9w DQ DQ9 DQ DQ9 DQ DQ:) DQ_ DQ:N DQ DQ:a DQ DQ:z DQ DQ: DQ DQ: DQ DQ: DQ  DQ;P DQ DQ;Z DQ DQ; DQ  DQ DQ Y DQ> DQ k DQ>a DQ  DQ>v DQ  DQ> DQ  DQ> DQ  DQ> DQ  DQ> DQ  DQ> DQ ) DQ? DQ _ DQ?8 DQ  DQ?> DQ  DQ?H DQ  DQ?Q DQ  DQ?U DQ  DQ? DQ + DQ? DQ q DQ@ DQ O DQA$ DQ  DQAt DQ  DQA DQ | DQA DQ  DQA DQ  DQB DQ DQB DQ DQC DQ DQC DQU DQC DQv DQC DQ{ DQC DQ DQC DQ DQC DQ DQD  DQ DQD) DQ DQD DQt DQF DQ DQF  DQ DQFa DQ; DQF DQ DQF DQ DQF DQ DQG DQ DQG? DQK DQGV DQb DQG DQ DQG DQ DQG DQ DQG DQ DQH DQ DQH DQ DQI3 DQH DQIc DQ{ DQIl DQ DQJp DQ DQJv DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ  DQJ DQ  DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ DQJ DQ  DQJ DQ" DQJ DQ$ DQJ DQ& DQJ DQ( DQJ DQ* DQJ DQ, DQJ DQ. DQJ DQ0 DQJ DQ2 DQK DQ4 DQK DQ8 DQK DQ: DQK DQG DQK DQI DQK DQK DQK DQM DQK DQO DQK DQQ DQK DQS DQK! DQU DQK# DQW DQK% DQY DQK' DQ[ DQK) DQ] DQK+ DQ_ DQK- DQa DQK/ DQc DQK1 DQe DQK3 DQg DQK9 DQm DQK; DQo DQK= DQq DQK? DQs DQKA DQv DQKC DQy DQKE DQ| DQKI DQ DQKK DQ DQKM DQ DQKO DQ DQKQ DQ DQKS DQ DQKU DQ DQKW DQ DQKY DQ DQK[ DQ DQK] DQ DQK_ DQ DQKa DQ DQKf DQ DQK DQ DQK DQ DQK DQ DQK DQ1 DQK DQ6 DQK DQ< DQK DQL DQL DQX DQL DQx DQL8 DQ DQLP DQ DQL| DQ DQL DQ DQL DQT DQM DQ DQM DQ DQMX DQ DQM DQ DQMPyType_ClearCache.frameicur_version_tagPyType_Modified.frame inrawtype type_mro_modified .frameinbases cleartypeassign_version_tag.framen basesitype&type_name.frametype}type_set_name.framevaluetypetype_module.frametype1type_set_module.framevaluetypetype_abstractmethods.frametypetype_set_abstractmethods.framerestypeabstractvaluetype_get_bases.frametypemro_subclasses,.frametemptuplesubclassold_mroi subclassesntypeetype_set_basesD.frame(mro$clsrtemp old_mroold_baseold_basesnew_baseivaluetypeWtype_dict.frametypetype_get_doc.frametypetype___instancecheck__ .frametypeinstYtype___subclasscheck__ .frametypeinsttype_richcompare .frameopwvtype_repr$.frame rtnkindnamemodtype ttype_call.frameobjkwdsargstype PyType_GenericAlloc.frame gobjsizenitemstype PyType_GenericNew .frametype traverse_slots$.framevisit argself mpintype ^subtype_traverse(.frameargvisitbase basetraversetypeself clear_slots.frameself mpintypesubtype_clear .framebase basecleartypeselfsubtype_dealloc(.framedictptrlistg basedeallocbase_tstatetypetstateselftPyType_IsSubtype.frameablookup_maybe.frameselfattrstrattrobj{lookup_method.frameresattrobjattrstrself_PyObject_LookupSpecial.frameattrobjattrstrselfcall_method .frameretvalargs funcnameobjnameova formatcall_maybe .frameretvalargs funcnameobjnameova formatfill_classic_mro.frame inbasesclsmroclassic_mro.frameclsmrotail_contains .framewhencelisto class_name.framenameclscheck_duplicates .frameolistIset_mro_error .framenamevk offbufnsetito_merge_sizeto_mergeremainpmerge4.frameaccjcandidateremainiempty_cnt to_merge_sizeto_mergeXmro_implementation0.frame okresultbases_aslistito_mergenbasestype`mro_external .frameselfsmro_internal4.frame(.safe$tilen solid tupleresultmrocheckittype best_base(.framecandidatebase_iiwinner basenbases"extra_ivars .frametypebase"solid_base.framebasetype#get_builtin_base_with_dict.frametype#Vget_dict_descriptor.frametype#raise_dict_descr_error.frameobj#subtype_dict$.framedictptrobj$subtype_setdict$.framevalueobj%subtype_getweakref.frameobj&valid_identifier.frames&_unicode_to_string.frametmpslot_nameslotsinslots'type_init.frameresclsargskwds(type_new.frame`tp_doc\nXdoctype,etLjnewslots\sXtmpslotsTmay_add_weakPmay_add_dictHadd_weakDadd_dicttype_clear .frametype?Otype_is_gc.frametype?\excess_args.frameargskwds?object_init.frameselfkwdsargserr@Jobject_new0.frameabstract_methodsjoinedsorted_methodstypekwdsargserrBobject_dealloc.frameselfBobject_repr$.framertn namemodtypeselfDZobject_str .frameselfDzobject_get_class.frameselfDequiv_structs.framebaDsame_slots_added.frame slots_asizeabEcompatible_for_assignment .framenewbaseoldbaseattroldtonewtoFobject_set_class.frameoldtonewtoselfvalueGimport_copyreg.frameGslotnames .frame slotnamescopyregclsI reduce_2d.frameHerrDvalue@name8i 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 DR DR4 DR DR5 DR DR5 DR DR6# DRT DR6 DR DR7 DRU DR7w DR DR7 DR  DR7 DR  DR7 DR  DR8 DRO DR8' DRh DR8b DR DR8PyTuple_New.frame gopsize$PyTuple_Size .frameopaPyTuple_GetItem .frameiopPyTuple_SetItem.framenewitemopiТ_PyTuple_MaybeUntrack.frameelti ntopzPyTuple_Pack.framevargsntupledealloc.framei _tstatelenoptupleprint.frameiopfp_savetuplerepr$.frametemp sipiecesnresultv9tuplehash.framep lenxmultvtuplelength.frameatuplecontains.frameiela#tupleitem .frameiamtupleslice .framelenihighailowPyTuple_GetSlice.framejiopZtupleconcat(.frameabb5tuplerepeat$.frameitemsnp.safeantupleindex4.frameivargs stopselfstart4tuplecount.framevicountselfۧtupletraverse.framevisitargiotuplerichcompare,.frameop iwlenvlenwtvtwvtuple_new.frameargkwdsargstypeMtuple_subtype_new$.framenewobjntmptypekwdsargstuplesubscriptD.frameresultslicelength stepstopstartselfiitemtuple_getnewargs.frame.safevtuple_sizeof .frameself_PyTuple_Resize$.framegsvv inewsizeoldsizepv PyTuple_ClearFreeList.frame pifreelist_sizezPyTuple_Fini.frametupleiter_dealloc .frameit tupleiter_traverse.framevisitargitRtupleiter_next.frameittupleiter_len .frameittuple_iter.framegitseq DS DS  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 DS DS4  45   58 G 5V DS DS5W  5{ % 5 DS DS5 DS DS5 DS DS7` DS DS7 DS DS7PyStructSequence_New.frame.safeobjtypestructseq_dealloc.frameisize .safeobjkstructseq_length.frameobjsstructseq_item .frameiobjstructseq_slice.framehighlowobj4structseq_subscript<.frameslicelen stepstopstartiselfitemstructseq_newD.frame ires$n_unnamed_fieldsmax_lenmin_len,.safelentypekwdsargsdictargnmake_tuple.frameobjstructseq_repr<.frame0.safe,crepr$repr i(cnamelentupendofbufpbufbufremovelasttypobjstructseq_concat.frameresultbtupobj4structseq_repeat.frameresultntupobj}structseq_contains.frameresultotupobjstructseq_hash.frameresulttupobj#structseq_richcompare.frameresultopo2tupobjtstructseq_reduce4.frame resultidicttupn_unnamed_fieldsn_visible_fieldsn_fields$.safeselfPyStructSequence_InitType,.framevdicttype n_membersn_unnamed_membersdesc DT DT  - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 DT DT4225 DT DT553 DT DT5= DT DT5E DT8 DT5 DT DT5 DT DT5 DT DT5 DT DT6 DT DT6 DT  DT6 DT DT7[ DT\ DT7 DT DT8L DGU DGU8h DTH DT8 DGI# DGI9 DTI DT9 DGJ DGJ9& DTK DT9' DGK DGK9[ DGK@ DGK9} DGKh DGK9 DGK DGK9 DGK DGK9 DTL DT9 DGL DGL:. DTM DT:F DGM3 DGM;l DGM^ DGM; DTN DT; DGV DGV;;;; DGV DGV< DGV! DGV< DGV2 DGV<# DGVB DGV<5 DGVp DGV DT= DT DT>9 DT DT> DT DT> DT DT? DT DT?4 DT DT?T DT1 DT?v DTW DT?~ DTb DT? DT DT? DT DT? DT DT? DT DT@ DT DT@ DT  DT@ DT DT@ DT DT@ DT DT@ DT DT@ DT DT@ DT DTA  DT  DTA, DTF DTAR DTo DTAp DT DTA DT DTA DT  DTC DT  DTD DT 1 DTD2 DT b DTDY DT  DTD DT  DTD DT  DTD DT  DTE1 DT z DTEF DT  DTE[ DT  DTEs DT  DTE DT  DTE DT  DTE DT 1 DTE DT P DTF DT o DTF- DT  DTFL DT  DTFx DT  DTF DT  DTF DGN DGNF DGNd DGNG) DGN DGNG= DGN DGNG\ DGN DGNG DGN DGNH DGN DGNH  DGN DGNH5 DGN DGNH< DGN DGNH? DGN DGNHE DGN DGNHK DGN DGNHU DGN DGNH DGN/ DGNH DGNE DGNH DGNS DGNH DGNX DGNH DGNi DGNH DGN DGNH DGN DGNI0 DGN DGNI> DGN DGNIU DGN DGNI\ DGN DGNIy DGN DGNI DGN# DGNI DGN* DGNI DGN/ DGNI DGNO DGNI DGNY DGNI DGNp DGNI DGN DGNJ DGN DGNJ& DGN DGNJ9 DGN DGNJ] DGN  DGNJn DGN DGNJ DGN6 DGNJ DGNE DGNJ DGNZ DGNJ DGNc DGNJ DGN DGNK DGN DGNK DGN DGNKd DGN' DGNKt DGN7 DGNKy DGN< DGNK DT DTK DT  DTK DT/ DTK DT5 DTL- DT DTLc DT DTL DT3 DTL DTl DTM DT DTMv DT DTM DT( DTM DTR DTM DT^ DTM DT DTO DT\ DTO DTa DTO DTj DTO DT DTO DT DTP DT DTP0PyString_FromStringAndSize.frametopsizestr?PyString_FromString.frame topsizestrzPyString_FromFormatV<.frame,.safei longflagpsstring fcountformatvargsnxPyString_FromFormat.frameformatPyString_Decode.framev errorsencodingstrsizesPyString_AsDecodedObject.frameerrorsstrencodingJPyString_AsDecodedString.framevtemperrorsencodingstr'PyString_Encode.framev errorsencodingstrsizesPyString_AsEncodedObject.frameerrorsstrencodingPyString_AsEncodedString.framevtemperrorsencodingstrstring_dealloc .frameop:PyString_DecodeEscape<.frame,rn wuerrors(tendp bufsvnewlenrecode_encodinglenstring_getsize.framelensopstring_getbuffer.framelensop 0PyString_Size.frameop ZPyString_AsString.frameop PyString_AsStringAndSize.framelenobjs yfastsearch .framemaskskipmlastmaxcountmodew m countpsn xstringlib_count .framesubstrstr_lenmaxcount sub_len stringlib_find .framesubstroffset sub_lenstr_lenDstringlib_rfind .framesubstroffsetstr_len sub_lenstringlib_find_slice.frame sub_lensubstrstartendstr_lenstringlib_rfind_slice.frame sub_lensubstrstartendstr_lenustringlib_contains_obj.framesubstrstringlib_parse_args_findsd.framesubobjend starttmp_subobjargsfunction_nameFformatobj_endobj_start tmp_endtmp_startstringlib_partition$.frame sep_objposstr_objsepstr_lenstroutsep_lenstringlib_rpartition$.frame sep_objposstr_objsepstr_lenstroutsep_len'stringlib_split_whitespace .framesubistr_objliststr_lenstr count maxcountstringlib_split_char .framestr_objsubj chstrliststr_len countmaxcountstringlib_split4.framesubjilist sepstr_lenstrstr_objcountmaxcountsep_lensstringlib_rsplit_whitespace .framesubistr_objstr_lenliststr count maxcount#stringlib_rsplit_char .framestr_objsubi chstrstr_lenlist countmaxcount@stringlib_rsplit0.framesubposjlist sepstr_lenstrstr_obj countmaxcountsep_len!stringlib_splitlines .framesubstr_obj keependsieol liststrstr_len#a_GroupGenerator_init.framegroupingself#w_GroupGenerator_next.frameself#fill.frame n_zerosdigits_endbuffer_endn_charsthousands_sep_lenthousands_sep$5_PyString_InsertThousandsGroupingP.frame n_charslmin_widthdigitsn_bufferbuffergrouping4groupgen(remaining n_digits$thousands_sep_lenthousands_sepdigits_endbuffer_enduse_separator loop_brokencount'_Py_InsertThousandsGroupingLocale,.framemin_width n_digitsdigitsn_bufferbuffer'Lstring_print4.frameistr_lenquote chunk_size_savesizedataretflagsfpop*"PyString_Repr,.framepismartquotesquote vopobj,)string_repr .frameop,Estring_str.frames,vstring_length.framea,~string_concat.frameopsizebba.wstring_repeat$.framejiop sizean0string_slice .framejai0string_contains.framesub_objstr_obj1string_item.framepcharia1ystring_richcompare$.frame len_blen_aopab3_PyString_Eq.frameo2o13string_hash.framea4gstring_subscript@.frame$result result_bufsource_bufslicelength stepstopstartselfiitem6cstring_buffer_getreadbuf .frameptrindexself6string_buffer_getwritebuf .frame6string_buffer_getsegcount.frameselflenp6string_buffer_getcharbuf .frameptrindexself7 string_buffer_getbuffer.frameflagsviewself7\string_split4.framensubargssubobjs maxsplitlenself8string_partition$.framesep_lensepsep_objself9Ystring_rpartition$.framesep_lensepsep_objself9string_rsplit4.framensubargssubobjs maxsplitlenself;Vstring_join@.frame(npi res,result$itemseqlen seqorigszseplensepself>_PyString_Join .framexsep>string_find_internal0.framedir sub_lensubselfsubobjargsendstart@string_find.frameargsself@Tstring_index.frameargsself@string_rfind.frameargsself@string_rindex.frameargsselfA=do_xstrip(.framejistriptypeseplen seplensselfsepobjBLdo_strip.framestriptypeselfBdo_argstrip.frame resuniselfselfstriptypeargssepDstring_strip.frameselfargsD]string_lstrip.frameselfargsDstring_rstrip.frameselfargsDstring_lower$.frameisnewobj nselfEstring_upper$.frameisnewobj nselfF'string_title(.frame is_newnewobjnprevious_is_casedsselfGstring_capitalize$.frame is_newnewobjnsselfGstring_count8.frame .safesub_len subsub_objargsendstartstrselfIstring_swapcase$.frame is_newnewobjnsselfJfstring_translateX.frame4trans_tableci output_start4result(inlen,tablen table8tableobjargs_FieldNameIterator_attr.frameselfnameq_FieldNameIterator_item.frameselfnameqFieldNameIterator_next .framename_idxself nameis_attributerfield_name_split$.framefield_name_is_emptyauto_number first_idxrestpfirst endlenptrt,get_field_objectL.frame0tmpname is_attributeargs0keykwargs auto_number,rest indexfirstobjinputvarender_field,.frameoutputtmp format_spec_objectresultokfieldobjformat_specxparse_field.framestrfield_nameformat_spec conversioncy!MarkupIterator_init.framelenptrselfyIMarkupIterator_next4.frame sfield_presentconversionselfformat_spec_needs_expandingformat_spec field_nameliteralmarkup_followsc{do_conversion.frameconversionobj| output_markup0.frameoutputexpanded_format_specrecursion_depthformat_specformat_spec_needs_expandingfieldobj conversion auto_numberkwargsargsfield_nameresulttmp}do_markupX.frameauto_numberrecursion_depthkwargsargs output format_spec_needs_expanding-conversion,format_spec$field_namefield_presentliteraliterinput~build_string4.frameauto_numberkwargsargs recursion_depthoutputresultinputdo_string_format,.framekwargsargsinputselfauto_number recursion_depthformatteriter_dealloc.frameit:formatteriter_next\.frame,literal_str /0 /a /^ /g R i 0 0 0 0 0" 0 T  1 1 18 122 $ 1 1 , 1 1!- 1 1!; 1 1!Z 1 1!h 1 1!n 1 1!~ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1": 1 1"A 1' 1"I 10 1"N 15 1"U 1I 1"a 1i 1"h 1q 1"p 1z 1"u 1 1"| 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1## 1x 1#- 1 1#6 1 1#E 1 1#M 1 1#V 1 1#_ 1 1#g 1 1#r 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$0 3< 3$8 3F 3$< 3J 3$E W $F 4 4$W 4 4$k X $l 5 5${ 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6%  6g 6% 6v 6% 6~ 6%! 6 6%* Z %, 7 7%P 7' 7%d 7; 7%m \ %} 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9& 9 9&  9 9& 9 9& 9 9&! 9 9&& 9 9&. 9 9&8 9 9&A _ &B : :&Z :5 :&d :@ :&p ` &q ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >'  >& >'" d '( ? ?'6 ?& ?'= ?- ?'V e 'm @7 @'t @E @'| @O @' @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B($ h (0 C  C(F C# C(M C* C(f CF C( i ( D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)) l )* G G)< G G)H G G)c G; G)g G@ G)m GG G)r GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J* p * K K*  K K*9 q *: L L*W r *X M M*p s *q N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+$ Q Q++ Q Q+/ Q% Q+A Q9 Q+R QP Q+Y w +f R R+m R/ R+t R= R+} RM R+ R[ R+ R R+ R R+ y + S S,; Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-] TC T-q T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.1 Vm V.B V V.J  .V W  W.~ W5 W. We W. W W.  / X X/ X X/# X% X/2 X5 X/G Xt X/[ X X/m  /n Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0+ \- \03 \9 \09 \E \0? \R \0F \_ \0R \p \0d \ \0i \ \0n \ \0x \ \0} \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1$ \ \1) \ \1/ \ \14 \ \19 \ \1> \ \1C \  \1H \ \1M \ \1R \) \1W \3 \1b \T \1g \[ \1l \f \1s \r \1x \{ \1} \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2  \o \2 \v \2 \} \2, \ \21 \ \25 \ \2= \ \2G \ \2L \ \2S \ \2X \ \2_ \ \2d \ \2q \ \2w \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^3 ^S ^3 ^Y ^3 ^b ^3 ] ]3=  3> _ _3X  3Z ` `3i ` `3y  3z a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4I d d4J4e d d4f''4 d d4 d d4  4 DW DW4  45  5; G 5Y DW DW5 DW; DW6 DW DW6 DW DW6R DW DW6ellipsis_repr.frame)PySlice_New .framestopstartstep_PySlice_FromIndices.frame sliceendistopstartistart1PySlice_GetIndices.framerlength stopstartstepPySlice_GetIndicesEx.frame .safeslicelengthdefstoplengthstep stopstartrslice_new,.frameargskwstartstop stepslice_dealloc.framerDslice_repr.frame .safercommasMslice_indices0.frameslicelengthstep stopstartselfilenlenslice_reduce.frameselfslice_compare.frameresultwvslice_hash .frame DX  DX  - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 DX  DX4  45  59 G 5Z DX DX5x DX4 DX5 DXJ DX5 DXn DX5 DXv DX5 DX DX5 DX DX5 DX DX5 DX DX6 DX DX6  DX DX67 DX DX6[ DX: DX6s DXR DX6 DX DX7 DX DX7  DX DX7 DX DX7 DX DX7 DX DX7 DX DX8 DX DX8 DX DX8 DX DX8 DX DX9N DXX DX9 DX DX:9 DXG DX:V DXd DX: DX DX: DX DX;8 DXH DX; DX DX; DX DX5 DX W DX> set_key_error.frametupargbset_lookkey0.frameperturbcmp startkeyentry freeslotihashtablemaskkeysoset_lookkey_string(.frameperturbentry freeslotihashtablemaskkeysoset_insert_key.framehashkeysoset_insert_clean.framekeyhashso set_table_resizeh.frameentryiXsmall_copy newtablenewsizeis_oldtable_mallocedoldtablesominusedset_add_entry.framekeyn_usedsoentryset_add_key.framen_usedsokeyhset_discard_entry.frameoldentrysoset_discard_key.framesokeyset_clear_internal`.frameentryPsmall_copyfill table_is_mallocedtablesoset_next.frameentry_ptrpos_ptrsoJset_dealloc.frameentry _tstatefillsoset_tp_print(.frameentryfp_savesoseparator emitposset_repr .frame listreprkeyssoresultset_len.framesoset_merge$.framekeyiotherothersetsoset_contains_key.framesokeyWset_contains_entry.frameentrysoĢset_pop.frameso:set_traverse.framevisitargentrysoposřfrozenset_hash$.frameentry hashpossoself>setiter_dealloc.framesi|setiter_traverse.framevisitargsiƮsetiter_len .framesisetiter_iternext .framesiǥset_iter.framegsiso1set_update_internal8.frameit an_entryhash valuekeypossootheriset_update.framesoiargsʽmake_new_set.frameiterablesotypefrozenset_new .frameargskwdstypeiterableIPySet_Fini.frameset_new .framekwdstype set_swap_bodies`.frameLtababrset_copy .framesoόfrozenset_copy.framesoϱset_clear.framesoset_union.frameresult iargssoWset_or.frameresultothersoѐset_ior .framesootherset_intersection0.framekey itentryposresultothersoset_intersection_multi.framenewresultresultiargsso|set_intersection_update.frametmpothersoset_intersection_update_multi.frametmpargsso>set_and .frameothersoset_iand.framesootherset_isdisjoint,.framervkeyitentrypossootherset_difference_update_internal.framekeyitentryposothersoset_difference_update.framesoiargs4set_difference$.frameentrycopyentryresultso posother߂set_difference_multi.frameresultisoargs$set_sub .frameothersoset_isub .framesootherset_symmetric_difference_update<.frameentryotherset$an_entryhashvaluekeyother posso(set_symmetric_difference.frameothersetothersoset_xor .frameothersokset_ixor.framesootherset_issubset .frameentryresult tmpsoposotherOset_issuperset.frameresulttmpsootherset_richcompare.framer2 .safer1opwv)set_nocmp .frameLset_add .framekeyso}set_contains.framervtmpkeykeysoHset_direct_contains.framekeysovset_remove.framervtmpkeykeysojset_discard.framervtmpkeykeyso=set_reduce$.framekeyssodict resultargscset_sizeof .framesoset_init.frameargskwdsiterableselfPySet_New .frameiterablePyFrozenSet_New .frameiterablePySet_Size .frameanyset~PySet_Clear .framesetPySet_Contains .framekeyanyset_PySet_Discard .framekeysetPySet_Add .framekeyanysetQ_PySet_Next.framekeyentry_ptrposset_PySet_NextEntry.frame hashkeyentrypossetPySet_Pop .frameset _PySet_Update .frameiterableset DY DY  + , ,  -  7K   h ( p  ~   a   6  DJKUX Yq r5 " !&>c  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 DY DY4 DY DY4 DY DY4 DY, DY5 DY9 DY56 DYq DY5A DY| DY5w DY DY6 DYW DY6nget_len_of_range.frame.safehilostepget_stop_for_range .frame.safer-range_new,.framenargskwistep ihighilow}range_item .frame.saferirange_length.framerrange_repr.frame.saferrange_reduce.frame.saferrangeiter_next.framerrangeiter_len.framerrange_iter.frameseqrange_reverse.frameseq DZ DZ  ) , *  +  5I   f ( n  |   a   4  BHISV Wo p5 " $<a  + ' !! ) """"P + R##  ,## @ 8 A$$ S 9 U % %m  ~ % %&& % % % %d %; %i"" %@ %'' %J %(( %M %((2((z %Z %)) %u %*** * % % % %++ % % G  , ,  " , , , , N  - -> % %U -3 - -s - O  .j . . . . . . .* . . . . . . . . . . . .5 . .> . . .= . .F . .P . .^ .- . .> . .D Q G / / -s - /a / / / / /  / / / /8 /0 /[ /^ /a R c 0 0{ 0 0 0" 0 T  1 1 18 122  1 1 & 1 1!' 1 1!5 1 1!T 1 1!b 1 1!h 1 1!x 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"4 1 1"; 1' 1"C 10 1"H 15 1"O 1I 1"[ 1i 1"b 1q 1"j 1z 1"o 1 1"v 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#' 1 1#0 1 1#? 1 1#G 1 1#P 1 1#Y 1 1#a 1 1#l 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$* 3< 3$2 3F 3$6 3J 3$? W $@ 4 4$Q 4 4$e X $f 5 5$u 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6%  6v 6% 6~ 6% 6 6%$ Z %& 7 7%J 7' 7%^ 7; 7%g \ %w 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9&  9 9& 9 9& 9 9&  9 9&( 9 9&2 9 9&; _ &< : :&T :5 :&^ :@ :&j ` &k ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '" ? ?'0 ?& ?'7 ?- ?'P e 'g @7 @'n @E @'v @O @'z @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B( h (* C  C(@ C# C(G C* C(` CF C(y i (z D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)# l )$ G G)6 G G)B G G)] G; G)a G@ G)g GG G)l GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*3 q *4 L L*Q r *R M M*j s *k N N* t * O O* O, O* u * P P+ P P+  v +  Q Q+ Q Q+ Q Q+% Q Q+) Q% Q+; Q9 Q+L QP Q+S w +` R R+g R/ R+n R= R+w RM R+ R[ R+ R R+ R R+ y + S S,5 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S--  S@ S- z - T T-W TC T-k T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.+ Vm V.< V V.D  .P W  W.x W5 W. We W. W W.  . X X/  X X/ X% X/, X5 X/A Xt X/U X X/g  /h Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0% \- \0- \9 \03 \E \09 \R \0@ \_ \0L \p \0^ \ \0c \ \0h \ \0r \ \0w \ \0| \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1# \ \1) \ \1. \ \13 \ \18 \ \1= \  \1B \ \1G \ \1L \) \1Q \3 \1\ \T \1a \[ \1f \f \1m \r \1r \{ \1w \ \1| \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \1 \g \2 \o \2  \v \2 \} \2& \ \2+ \ \2/ \ \27 \ \2A \ \2F \ \2M \ \2R \ \2Y \ \2^ \ \2k \ \2q \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3 ^b ^3 ] ]37  38 _ _3R  3T ` `3c ` `3s  3t a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4C d d4D4_ d d4`''4 d d4 d d4  5A DZ DZ5c DZ DZ5j DZ DZ5t DZ- DZ5 DZ DZ5 DZ DZ5 DZ DZ5 DZ DZ5 DZ DZ5 DZ  DZ5 DZ DZ5 DZ0 DZ6 DZI DZ6 DZW DZ6C DZ DZ6V DZ DZ6[ DZ DZ6_ DZ  DZ6d DZ DZ6m DZ DZ6 DZ0 DZ6 DZO DZ6 DZV DZ6 DZc DZ6 DZg DZ6 DZu DZ6 DZ DZ6 DZ DZ6 DZ DZ6 DZ DZ7  DZ DZ7 DZ DZ7 DZ DZ7" DZ DZ7) DZ DZ7, DZ DZ7. DZ DZ73 DZ  DZ77 DZ DZ7E DZ DZ7S DZ. DZ7_ DZ? DZ7g DZJ DZ7u DZY DZ7~ DZb DZ7 DZk DZ7 DZm DZ7 DZo DZ7 DZr DZ7 DZ| DZ7 DZ DZ7 DZ DZ7 DZ DZ7 DZ DZ7 DZ DZ7 DZ DZ:) DZW DZ:3new_arena .framearenaobjnumarenascPyObject_Malloc.framesizenbytes:PyObject_Free(.frameaop PyObject_Realloc .framebp sizepoolnbytesp D[ D[  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 D[ D[4  4  4 % 5 . 5 < 5A D[ D[5 D[ D[6; D[( D[6t D[a D[6 D[ D[7! D[ D[7> D[0 D[7G D[: D[7S D[F D[7a D[T D[7g D[_ D[7 D[ D[7 D[ D[7 D[ D[7 D[ D[7 D[ D[7 D[ D[7 D[ D[8 D[, D[8 D[8 D[8& D[E D[81 D[U D[8W D[ D[8q D[ D[8 D[ D[8 D[ D[8 D[ D[8 D[ D[8 D[ D[8 D[ D[8 D[ D[8 D[. D[9 D[? D[9 D[[ D[9Z D[ D[9 D[ D[9 D[" D[9 D[= D[: D[ D[: D[ D[: D[9 D[: D[K D[; D[l D[;6 D[ D[;B D[ D[;x D[ D[; D[ D[; D[? D[< D[\ D[<  D[f D[< D[w D[ D[  D[> D[  D[>, D[  D[>8 D[  D[>M D[  D[>W?Py_IncRef.frameoMPy_DecRef.frameosPyObject_Init.frametpopPyObject_InitVar.frametpsizeop_PyObject_New .frametp_PyObject_NewVar.framenitemstp1_PyObject_Del.frameopDinternal_print.frames_saveopflagsfp nestingretPyObject_Print.frameflagsfpop/_PyObject_Dump.framegilopPyObject_Repr.framestrresv_PyObject_Str.frameresv9PyObject_Str.framestrresvPyObject_Unicode .framefunc strresunicode_method_foundvDadjust_tp_compare.frame tbvtc try_rich_compare.frameopwv try_rich_compare_bool.frameokresopwv try_rich_to_3way_compare.frameiwv try_3way_compare.framecwvQdefault_3way_compare .framevnamevw:do_cmp.framevwPyObject_Compare.framewvvconvert_3way_to_object.frameopc'try_3way_to_rich_compare.frameopwvdo_richcmp.frameopwv2PyObject_RichCompare .frameopwvNPyObject_RichCompareBool.frameresokopwv_Py_HashDouble8.frameexpo(.safex plongfractpartintpartv_Py_HashPointer .framepPyObject_HashNotImplemented.frameselfPyObject_Hash .frametpvPyObject_GetAttrString.framereswvname"PyObject_HasAttrString.framenamevjPyObject_SetAttrString.frameresswvnamePyObject_GetAttr.frametpnamevPyObject_HasAttr.framenamev$PyObject_SetAttr .frameerrvaluenametpvB_PyObject_GetDictPtr.frameobjPyObject_SelfIter.frameobj_PyObject_NextNotImplemented.frameself_PyObject_GenericGetAttrWithDict4.framedescrfdictname restpobjPyObject_GenericGetAttr.framenameobj_PyObject_GenericSetAttrWithDict(.framedictptrdescr f dictvaluerestpobjname!PyObject_GenericSetAttr.framevaluenameobj"PyObject_IsTrue .framev"PyObject_Not .framev#PyNumber_CoerceEx.framewpwpv#PyNumber_Coerce.framepwpv$PyCallable_Check.framex${merge_class_dict$.framebase inbasesstatusclassdictdictaclass&merge_list_attr .framedict ilistattrnameobjresult'g_dir_locals.framenames(_specialized_dir_type.frameobjdictresult({_specialized_dir_module.framedictobjresult)!_generic_dir .frametempdictobj itsclassresult*_dir_object.frameresultdirfuncobj,YPyObject_Dir .frameresultobj,none_repr.frame,none_dealloc.frame,NotImplemented_repr.frame,_Py_ReadyTypes.frame2PyMem_Malloc.framenbytes2PyMem_Realloc .framepnbytes3'PyMem_Free.framep3:Py_ReprEnter.framelistobjdict4 Py_ReprLeave .frameobj4_PyTrash_deposit_object.frameop4_PyTrash_thread_deposit_object.frameop4_PyTrash_destroy_chain.frame4_PyTrash_thread_destroy_chain.frametstate D\ D\  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 D\ D\4  45   58 G 5V D\ D\5 D\l D\5 D\ D\6 D\ D\6! D\ D\6L5)PyModule_New.framenameobjnamem6WPyModule_GetDict.framem6PyModule_GetName.framem7OPyModule_GetFilename.framem7_PyModule_Clear(.frames valuekeyposdm9mmodule_init(.framedictmkwdsargs docname:Jmodule_dealloc.framem:module_repr.framenamem;module_traverse.framevisitargm D] D]  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 D] D]4  45   58 G 5Y D]  D]6< D] D]6 D]f D]6 D] D]6;JPyCFunction_NewEx.framegopmlmoduleself< PyCFunction_GetFunction .frameopmeth_dealloc .framem?]meth_get__doc__ .framem?meth_get__name__.framem?meth_traverse.framevisitargm?meth_get__self__.framem@@meth_repr.framem@meth_compare .framebaA meth_richcompare .frameopotherselfAmeth_hash.framexaBhlistmethodchain(.frame.safemlc ivchainCMPy_FindMethodInChain.framemlselfnamechainDPy_FindMethod.framenameselfchainmethodsDPyCFunction_ClearFreeList.framefreelist_sizeEPyCFunction_Fini.frameEPyCFunction_New.frameselfml D^ D^  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 D^ D^5 D^6 D^5 D^D D^5` D^ D^5o D^ D^5 D^ D^5 D^' D^6d D^ D^6 D^ D^6 D^ D^6 D^ D^6 D^/ D^7] D^ D^7E:get_shape0 .framebufEdup_buffer.framesrcdestEmemory_getbuf.frameflagsresviewselfFMmemory_releasebuf.frameviewF`PyMemoryView_FromBuffer.frameginfomviewFPyMemoryView_FromObjectH.frame8viewbaseGmemory_new.frameobjkwdsargsG_strided_copy_nd(.frameoutstridefortkitemsizesrcdestnd shapestridesI_indirect_copy_nd$.framedestindices elementsfuncfortviewJPyMemoryView_GetContiguous8.framedestbytesgfort viewbuffertypememobjN memory_format_get.frameselfN#memory_itemsize_get.frameselfN9_IntTupleFromSsizet.framei intTuplelenvalsNmemory_shape_get .frameselfNmemory_strides_get .frameselfOmemory_suboffsets_get .frameselfOmemory_readonly_get.frameselfO5memory_ndim_get.frameselfOKmemory_tobytesL.frame8res4viewselfOmemory_tolist .framebufi resviewmemPmemory_dealloc.frameselfQmemory_repr .frameselfQmemory_length.frameselfQmemory_itemH.frame8newviewviewresultptrselfRmemory_subscriptp.frameHnewviewLnewbufslicelengthstep stopstartT.safeviewresultkeyselfTmemory_ass_subt.frame@srcviewTstepPstopX.safelenstartDviewvalueselfkeyWmemory_richcompare.framewvhww4vvlequalopXmemory_traverse.framevisitargselfYgmemory_clear .frameself D_ D_  - , .  /  9M   j ( r     a   8  FLMWZ [s t5 " #(@e  + ' !! ) "" ""T + V##  0## D 8 E$$ W 9 Y % %q   % %&& % % % %h %; %m"" %@ %'' %J %(( %M %((6((~ %Z %)) %u %*** * % % % %++ % % G  , ,  & , , , , N  - -B % %Y -3 - -s - O  .j . . . . . . .. . . . . . . . . . . . .9 . .B . . .= .  .F . .P . .^ .1 . .B . .H Q K / / -s - /a / / / / / / / / /< /0 /_ /^ /e R g 0 0 0 0 0" 0 T  1 1 18 122 " 1 1 * 1 1!+ 1 1!9 1 1!X 1 1!f 1 1!l 1 1!| 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"8 1 1"? 1' 1"G 10 1"L 15 1"S 1I 1"_ 1i 1"f 1q 1"n 1z 1"s 1 1"z 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#! 1x 1#+ 1 1#4 1 1#C 1 1#K 1 1#T 1 1#] 1 1#e 1 1#p 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1$ V $ 3 3$ 3  3$. 3< 3$6 3F 3$: 3J 3$C W $D 4 4$U 4 4$i X $j 5 5$y 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%( Z %* 7 7%N 7' 7%b 7; 7%k \ %{ 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&$ 9 9&, 9 9&6 9 9&? _ &@ : :&X :5 :&b :@ :&n ` &o ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >'  d '& ? ?'4 ?& ?'; ?- ?'T e 'k @7 @'r @E @'z @O @'~ @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(" h (. C  C(D C# C(K C* C(d CF C(} i (~ D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)' l )( G G): G G)F G G)a G; G)e G@ G)k GG G)p GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p * K K* K K*7 q *8 L L*U r *V M M*n s *o N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+" Q Q+) Q Q+- Q% Q+? Q9 Q+P QP Q+W w +d R R+k R/ R+r R= R+{ RM R+ R[ R+ R R+ R R+ y + S S,9 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- - S@ S- z - T T-[ TC T-o T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V./ Vm V.@ V V.H  .T W  W.| W5 W. We W. W W.  . X X/  X X/! X% X/0 X5 X/E Xt X/Y X X/k  /l Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0) \- \01 \9 \07 \E \0= \R \0D \_ \0P \p \0b \ \0g \ \0l \ \0v \ \0{ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1 \ \1" \ \1' \ \1- \ \12 \ \17 \ \1< \ \1A \  \1F \ \1K \ \1P \) \1U \3 \1` \T \1e \[ \1j \f \1q \r \1v \{ \1{ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2* \ \2/ \ \23 \ \2; \ \2E \ \2J \ \2Q \ \2V \ \2] \ \2b \ \2o \ \2u \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3;  3< _ _3V  3X ` `3g ` `3w  3x a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4G d d4H4c d d4d''4 d d4 d d4  4 D_ D_4 0+ 05 0Y 05# D_ D_5$  5H % 5N D_ D_5Pii5 D_  D_5225 D_  D_56 D_- D_6 D_@ D_6! D_L D_6E D_q D_6N D_| D_6 D_ D_6 D_3 D_7  D_G D_7 D_P D_7 D_X D_7& D_a D_7/ D_j D_7K D_ D_7[ D_ D_7 D_ D_7 D_+ D_7 D_; D_8 D_B D_8 D_P D_8 D_b D_8a D_ D_8o D_ D_8s D_ D_8v D_ D_8 D_ D_8 D_ D_8 D_! D_8 D_G D_9  D_Y D_9 D_d D_9Z D_ D_9 D_ D_9 D_ D_9 D_ D_: D_e D_:E D_ D_:Y D_ D_:q D_ D_: D_ D_: D_ D_: D_ D_: D_% D_: D_7 D_: D_S D_: D_a D_; D_u D_; D_x D_;! D_ D_;; D_ D_; D_ D_; D_ D_; D_, D_; D_] D_; D_v D_< D_ D_ D_ D_=L D_- D_=_ D_@ D_=j D_K D_=z D_[ D_=} D_c D_= D_x D_= D_} D_= D_ D_= D_ D_= D_ D_= D_ D_= D_ D_= D_ D_> D_  D_>\ D_ a D_>e D_ k D_>k D_ r D_> D_  D_? D_  D_? D_ ! D_? D_ , D_?& D_ 5 D_?A D_ R D_?R D_ h D_?r D_  D_? D_  D_? D_  D_? D_  D_? D_  D_? D_ $ D_@ D_ g D_@T D_  D_@ D_ t D_@ D_  D_@ D_  D_A D_  D_A D_ P D_A D_ q D_A D_ z D_A D_  D_A D_  D_A D_  D_A D_  D_A D_  D_B D_ D_B D_ D_C D_ D_C D_ D_C D_ D_C D_ D_C D_ D_Dz D_h D_D D_ D_E D_ D_E D_ D_E  D_ D_E/Ylong_normalize .framevY_PyLong_New.frame.safesizeZj_PyLong_Copy.frameisrcZPyLong_FromLong .framendigitsabs_ivalnegativeival[FPyLong_FromUnsignedLong.frame ndigitsival[PyLong_FromDouble4.framei$.safevndig fracexpodvalneg]JPyLong_AsLongAndOverflow,.framesignvresoverflowdo_decrefvv_PyLong_AsLong.frameresultoverflowobj__PyLong_AsInt.frameoverflowobj`PyLong_AsSsize_t .framesignvv`PyLong_AsUnsignedLong .framevvaPyLong_AsUnsignedLongMask.framevvbz_PyLong_Sign.framevvb_PyLong_NumBits.framevvc _PyLong_FromByteArrayL.frame@thisbyte i0accum(carryvnumsignificantbytesincrpstartbytelittle_endianidigitnbytes is_signede_PyLong_AsByteArray<.frameicarryaccumn(pincr little_endiando_twos_compis_signedndigitsvbyteshLPyLong_FromVoidPtr.framephpPyLong_AsVoidPtr .framexvvhPyLong_FromLongLong(.framendigitst abs_ivalivalnegativejPyLong_FromUnsignedLongLong.framendigits tivaljPyLong_FromSsize_t.frameonebytesivaljPyLong_FromSize_t.frameonebytesivalk9PyLong_AsLongLong0.framebytesio.ret onevvmhPyLong_AsUnsignedLongLong(.framebytes.ret onevvn PyLong_AsUnsignedLongLongMask .frame x.retvvnPyLong_AsLongLongAndOverflow8.frameprev x$signres.retoverflow(do_decrefvvr!convert_binop.frame bvwarbits_in_digit.framedsv_iadd .framey nxmsav_isub .framey nxmsv_lshift.framezacc damt%v_rshift.framezaccam dtinplace_divrem1,.frame.safepoutpinrem nsizeudivrem1.framepremnzsizeaulong_to_decimal_stringd.frame strstrlenaddLL.safeDz jisize$poutscratch(pinsize_a8negativeaaay_PyLong_FormatX.frameH.safe newstylec  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 D` D`45 D` D`5  D`# D`5 D`0 D`5d D` D`6 D`3 D`6_ D` D`7/ D`P D`7: D`\ D`7? D`e D`7D D`n D`8 D`, D`8 D`A D`84 D`e D`8 D` D`8 D` D`8 D` D`8 D` D`8 D`1 D`8 D`A D`8 D`] D`9" D` D`91 D` D`9E D` D`9[ D` D`9m D` D`9| D` D`9 D` D`9 D`, D`9 D`O D`9 D`\ D`9 D`a D`9 D`m D`9 D` D`9 D` D`: D` D`: D` D`:3 D` D`:P D` D`:b D` D`: D`6 D`: D`[ D`: D`{ D`: D` D`; D` D`;' D` D`;. D` D`;9 D` D`;? D` D`;G D` D`;a D`  D`;s D`: D`; D`M D`; D` D`; D` D`<+ D` D` D`  D`>c D` < D`>x D` Q D`> D` _ D`@slist_resize.framenew_allocatednewsizeself_PyList_Fini .frameٔPyList_New.frame gopnbytessizePyList_Size .frameopEPyList_GetItem .frameiopPyList_SetItem.framenewitemiopܢins1.framewherenvselfePyList_Insert.framenewitemwhereopݷapp1.framevnself%PyList_Append .framenewitemoptlist_dealloc.framei_tstateopߋlist_print .framei itemfp_saveoplist_repr$.frame tempstatussivresultpieceslist_length.framealist_contains.frameiela list_item .frameiaylist_slice .framelenilowihighaPyList_GetSlice.frameihighilowaMlist_concat(.frameabb$list_repeat$.frameitemsnpnalist_clear.frameitemialist_ass_slice`.frame@kDs8norig(itemlistreviter_traverse.framevisitargitplistreviter_next.frameitlistreviter_len .frameit Da Da  + , ,  -  7K   h ( p  ~   a   6  DJKUX Yq r5 " !&>c  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 Da Da5PySeqIter_New.framegitseq iter_dealloc .frameit!iter_traverse.framevisitargit!4iter_iternext.frameitseqiterator!iter_len.frameit"PyCallIter_New.framegitsentinelcallable"calliter_dealloc .frameit#+calliter_traverse.framevisitargit#calliter_iternext .frame okresultargsit Db Db  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 Db Db4225 Db Db5ii5d Db Db5o Db  Db5 Db; Db5 DbO Db6 Db Db7 Db Db7: Db  Db7L Db Db7Q Db& Db7X Db- Db7c Db> Db7| Db^ Db7 Dbd Db7 Db Db7 Db Db8 Db Db8  Db Db8 Db Db9  Db  Db9B DbA Db9F DbE Db9_ Dba Db9 Db Db9 Db Db9 Db Db9 Db Db9 Db Db9 Db Db: Db Db:@ Db[ Db; Db% Db;%,PyInt_GetMax.frame%2fill_free_list.frame%PyInt_FromLong.frameival%PyInt_FromSize_t.frameival&&PyInt_FromSsize_t.frameival&Uint_dealloc.framev&int_free.framev&PyInt_AsLong.frame valioop'_PyInt_AsInt.frameresultobj(FPyInt_AsSsize_t .frameop(PyInt_AsUnsignedLongMask.frame valioop*PyInt_AsUnsignedLongLongMask.frameioval.retop+PyInt_FromString(.framesreprsobjpendendsbase.0PyInt_FromUnicode.frameresultbasebufferslength.int_print.framefp_saveint_valv/"int_compare .framewv/Oint_hash.framev/iint_add.framewv/int_sub.framewv0zint_mul@.frame4absprod,absdiff$diffdoubled_longproddoubleprod8.safewv1i_divmod.frame p_xmodyp_xdivyyx2 int_div$.framem dyx2int_classic_div$.framem dyixiyx3int_true_divide.frame .safeyx4Wint_mod$.frame dmyx5int_divmod$.framem dyx5int_pow4.framediv modzwv7int_neg.frame resultov8Uint_abs.framev8|int_nonzero.framev8int_invert.framev8int_lshift$.frameresultwwvvvw:int_rshift.framevw;bint_and.framewv;int_xor.framewv< int_or.framewv<int_coerce.framepvpwc  + ' !! ) """"R + T##  .## B 8 C$$ U 9 W % %o   % %&& % % % %f %; %k"" %@ %'' %J %(( %M %((4((| %Z %)) %u %*** * % % % %++ % % G  , ,  $ , , , , N  - -@ % %W -3 - -s - O  .j . . . . . . ., . . . . . . . . . . . .7 . .@ . . .= . .F . .P . .^ ./ . .@ . .F Q I / / -s - /a / / / / / / / / /: /0 /] /^ /c R e 0 0} 0 0 0" 0 T  1 1 18 122  1 1 ( 1 1!) 1 1!7 1 1!V 1 1!d 1 1!j 1 1!z 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"6 1 1"= 1' 1"E 10 1"J 15 1"Q 1I 1"] 1i 1"d 1q 1"l 1z 1"q 1 1"x 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1# 1x 1#) 1 1#2 1 1#A 1 1#I 1 1#R 1 1#[ 1 1#c 1 1#n 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$, 3< 3$4 3F 3$8 3J 3$A W $B 4 4$S 4 4$g X $h 5 5$w 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6$ 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%& Z %( 7 7%L 7' 7%` 7; 7%i \ %y 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&" 9 9&* 9 9&4 9 9&= _ &> : :&V :5 :&` :@ :&l ` &m ; ;& a & < <& b & = =&& = =& =2 =& c & > >& >  >' >& >' d '$ ? ?'2 ?& ?'9 ?- ?'R e 'i @7 @'p @E @'x @O @'| @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B(  BR B(  h (, C  C(B C# C(I C* C(b CF C({ i (| D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)% l )& G G)8 G G)D G G)_ G; G)c G@ G)i GG G)n GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*5 q *6 L L*S r *T M M*l s *m N N* t * O O* O, O* u * P P+ P P+  v + Q Q+ Q Q+  Q Q+' Q Q++ Q% Q+= Q9 Q+N QP Q+U w +b R R+i R/ R+p R= R+y RM R+ R[ R+ R R+ R R+ y + S S,7 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Y TC T-m T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.- Vm V.> V V.F  .R W  W.z W5 W. We W. W W.  . X X/  X X/ X% X/. X5 X/C Xt X/W X X/i  /j Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0' \- \0/ \9 \05 \E \0; \R \0B \_ \0N \p \0` \ \0e \ \0j \ \0t \ \0y \ \0~ \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1  \ \1% \ \1+ \ \10 \ \15 \ \1: \ \1? \  \1D \ \1I \ \1N \) \1S \3 \1^ \T \1c \[ \1h \f \1o \r \1t \{ \1y \ \1~ \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2( \ \2- \ \21 \ \29 \ \2C \ \2H \ \2O \ \2T \ \2[ \ \2` \ \2m \ \2s \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]39  3: _ _3T  3V ` `3e ` `3u  3v a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4E d d4F4a d d4b''4 d d4 d d4  4 Dc Dc4  4  4 % 5 . 5 < 51 Dc Dc52 N N5[ Dc Dc5 X X5 Dc Dc5  55  6! G 6? Dc Dc6 = =6 Dc  Dc7) DcO Dc73 DcZ Dc78 Dc_ Dc7K Dcs Dc7T Dc| Dc7 Dc Dc7 Dc Dc7 Dc Dc7 Dc Dc7 Dc Dc7 Dc Dc8 Dc3 Dc8pFigen_traverse.framevisitarggenFgen_dealloc.framegselfgenH#gen_send_ex.frame resultfarggenexcIgen_send.framearggenJgen_close.framegenJgen_del(.frameerror_traceback error_valueerror_typegenselfKgen_throw,.framegentypargs valtbN@gen_iternext.framegenNcgen_repr.framegenNgen_get_name.framegenNPyGen_New.frameggenfOYPyGen_NeedsFinalizing .framegen Dd Dd  , , -  .  8L   i ( q     a   7  EKLVY Zr s5 " "'?d  + ' !! ) """"S + U##  /## C 8 D$$ V 9 X % %p   % %&& % % % %g %; %l"" %@ %'' %J %(( %M %((5((} %Z %)) %u %*** * % % % %++ % % G  , ,  % , , , , N  - -A % %X -3 - -s - O  .j . . . . . . .- . . . . . . . . . . . .8 . .A . . .= .  .F . .P . .^ .0 . .A . .G Q J / / -s - /a / / / / / / / / /; /0 /^ /^ /d R f 0 0~ 0 0 0" 0 T  1 1 18 122 ! 1 1 ) 1 1!* 1 1!8 1 1!W 1 1!e 1 1!k 1 1!{ 1 1! 1 1! 1) 1! 13 1! 1? 1! 1P 1! 1b 1! 1m 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1! 1 1"7 1 1"> 1' 1"F 10 1"K 15 1"R 1I 1"^ 1i 1"e 1q 1"m 1z 1"r 1 1"y 1 1" 1 1" 1 1" 1 1" 1  1" 1 1" 1 1" 1  1" 1/ 1# 1k 1#  1x 1#* 1 1#3 1 1#B 1 1#J 1 1#S 1 1#\ 1 1#d 1 1#o 1 1# 1 1# 1 1# 1 1# 1 1# 1" 1# 1- 1# 1F 1# V $ 3 3$ 3  3$- 3< 3$5 3F 3$9 3J 3$B W $C 4 4$T 4 4$h X $i 5 5$x 5 5$ 5+ 5$ 5C 5$ 5M 5$ 5\ 5$ 5s 5$ 5| 5$ 5 5$ Y $ 6 6$ 6( 6$ 60 6$ 67 6$ 6> 6% 6E 6% 6g 6% 6v 6% 6~ 6% 6 6%' Z %) 7 7%M 7' 7%a 7; 7%j \ %z 8 8% ^ % 9 9%% 9" 9% 91 9% 9< 9% 9` 9% 9f 9% 9p 9% 9z 9% 9 9& 9 9& 9 9& 9 9& 9 9&# 9 9&+ 9 9&5 9 9&> _ &? : :&W :5 :&a :@ :&m ` &n ; ;& a & < <& b & = =&& = =& =2 =& c & > >' >  >' >& >' d '% ? ?'3 ?& ?': ?- ?'S e 'j @7 @'q @E @'y @O @'} @V @' @l @' @ @' @ @' f ' A A' g ' B B' B! B' B- B' B3 B( BR B(! h (- C  C(C C# C(J C* C(c CF C(| i (} D D( j ( E E( E& E( EA E( k ( F F) FA F) FK F)& l )' G G)9 G G)E G G)` G; G)d G@ G)j GG G)o GO G) m ) H$ H) H5 H) H> H) n ) I I) o ) J J*  p *  K K* K K*6 q *7 L L*T r *U M M*m s *n N N* t * O O* O, O* u * P P+ P P+ v + Q Q+ Q Q+! Q Q+( Q Q+, Q% Q+> Q9 Q+O QP Q+V w +c R R+j R/ R+q R= R+z RM R+ R[ R+ R R+ R R+ y + S S,8 Sr S, S S, S S, S  S, S S, S S, S S, S( S, S9 S- -  S@ S- z - T T-Z TC T-n T[ T- T T- T T- T T- T T- T T- | - U U- U# U- U2 U- U8 U- ~ - V V-- V V.. Vm V.? V V.G  .S W  W.{ W5 W. We W. W W.  . X X/  X X/  X% X// X5 X/D Xt X/X X X/j  /k Y Y/  / Z Z/  / [ [/ [ [/ [A [/  0 \ \0( \- \00 \9 \06 \E \0< \R \0C \_ \0O \p \0a \ \0f \ \0k \ \0u \ \0z \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \ \0 \& \0 \- \0 \2 \0 \K \0 \P \0 \_ \0 \i \0 \n \0 \u \0 \ \0 \ \0 \ \1 \ \1 \ \1  \ \1 \ \1 \ \1 \ \1! \ \1& \ \1, \ \11 \ \16 \ \1; \ \1@ \  \1E \ \1J \ \1O \) \1T \3 \1_ \T \1d \[ \1i \f \1p \r \1u \{ \1z \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \ \1 \% \1 \4 \1 \= \1 \D \1 \M \1 \V \1 \^ \2 \g \2 \o \2  \v \2 \} \2) \ \2. \ \22 \ \2: \ \2D \ \2I \ \2P \ \2U \ \2\ \ \2a \ \2n \ \2t \  \2 \J \2 \S \2 \\ \2  2 ] ]2 ^ ^2 ^ ^2 ^; ^2 ^S ^3 ^Y ^3  ^b ^3 ] ]3:  3; _ _3U  3W ` `3f ` `3v  3w a a3 a a3 a# a3  3 b b3  3 c c3  3  3 d d3ee3ee4F d d4G4b d d4c''4 d d4 d d4  4 Dd Dd5; ^b ^5F Dd Dd5G _ _5a Dd Dd5b  5l5  5 G 5 Dd Dd5 Dd Dd5 Dd, Dd6 Dd Dd6 Dd Dd7  Dd> Dd7- Ddk Dd8 Dd_ Dd8V Dd Dd8 Dd Dd8 DdJ Dd9OPyFunction_New.frameg constsopcodeglobalsQ:PyFunction_GetCode .frameopQnPyFunction_GetGlobals .frameopQPyFunction_GetModule .frameopQPyFunction_GetDefaults .frameopR PyFunction_SetDefaults .frameopdefaultsRPyFunction_GetClosure .frameopRPyFunction_SetClosure.frameopclosureSrestricted .frameSfunc_get_dict.frameopTfunc_set_dict.framevalueopTfunc_get_code.frameopTfunc_set_code(.frame.safenfree nclosureopvalueUfunc_get_name.frameopUfunc_set_name.framevalueopV.func_get_defaults.frameopV\func_set_defaults.framevalueopVfunc_newX.framenewfuncglobalscodekwargsclosuredefaults nameYfunc_dealloc .frameop[;func_repr