}`@gY8OOD$D$$ D$D$D$D$ ,L$ $L$@|+D$4$D$D$q,D$4$@8à tQ'A$t.A t6D$$?D$T$L$AD$ P,D$; u1Ã8L$@ $D$D$@$D$D$D$D$D$ ǹT$L|$DD$4D$HD$0tWD$%L$D$(L$,D$P% D$( L$,у D$( L$,|$|$DCD$@K $JD$$ $L$$L$0&T$4 ( $J L$L$(L$D$0D$ L$8L$у(L$JL$=L$4A$D$0$\$4C$u HCD$8iC|$8|%L$@ $L$ \$4C9D$D| C$$>\$4CD$8;D$(}/C$t ($C D$C$D$[\$4C$C9D$D| HËKT$D K)ȉD$@K $D$$ $L$$L$L$@L$$D$P$D$4@ D$L$0L$D$@D$ =u)($D$4@ D$D$0D$D$PD$ ^D$0$"1HËCKȋK)D$@KKK $<D$$ $L$$L$L$@L$$T$4 ( $J L$L$(L$D$0D$ L$8L$у(L$JL$J$L$>D$|$83D$8iKȉCL$@8 $L$\$4D$8iCC$C8D$CK)ȉD$\$4$e<\$4K9 T$$JL$=`t nT$$L$t $$ȧD$D$D$ D$D$t$$h$, $FL$$hA D$$D$,D$ʧ $<T$BB B B$t&Z PD$$$D$ ÉRۉ$D$ ÃD$@ D$, $‹D$P T$ $D$,D$7T$D$ @$@ J H J $eT$ BtZ P1ÉR L$ $̧L$/u  ËL$ $ϧL$ uVL$ $L$ $D$D$2u&L$ $L$L$u  1 ËL$ $L$L$t1 Ã=hu  ËL$ $L$L$lu  1 ÁP$T@ D$$H $$XL$vD$$ѧL$uw$\$ӧD$D$D$ D$D$'D$$@$[D$$L$H$T$\1PËL$ $/L$S;D$$X $ol$tm$\$l$D$D$ D$L$D$$@$D$$L$H$T$\1P1;p}]\$([   $L$A $T$(R  L$D$,D$~t$,l$\$(tpC;p|;p|,$էPÍ [ L$$A $\$l$D$D$ D$\$|=ht5A $[  L$t$ft$,l$\$(R2@I2@/7)L$ $L$$ L$u.$D$98D$$PËL$ $DD$D$4$D$D$l$$\$(B$M L$\$L$4L$ (;u.$D$7D$${PËD$$@ @tD$L%L$P $/L$pƒu L$P $\L$TƒB$$XL$L$L$L$$I L$ L$u $ߧPË$\$L$D$LD$D$@D$ D$D$RD$$@$D$$L$H$T$\1PÍD$P@ ( $L$$I L$L$L$V$M L$\$L$4L$ b;[<$@hP T$hI1ɃuPuK($h|$D$($@$D$<ËhI1Ƀu7u2h R1 $(D$듋hI1Ƀu6u1($h|$B@D$rED$$D$D$T$(@J $D$ ( $L$I L$L$L$L$L$ 7u$@$<Ë$@($D$@ D$D$@D$D$D$ t={L$I $LD$($D$@ D$D$D$$@(D$ 2J $D$ ( $L$I L$L$L$L$L$ 84T$H|$8t$+HÃ|$\%D$8%}1ȃcP=t$ȃD$*Hý |$`%ȃ@t  ( $L$LI L$L$PL$L$8L$ t$\$l$|$T$ L$@L$$L$dL$(KyT$TL$LA u HÉ%tD$@%t1Hø$ЃD$)Hû;@%t @{ȃt MCȃt /%L($Ph@ D$ @1ɉHS4K4 $$PT$ BC%=D$( $JL$KL$‹(@T$$$$PD$L$ $L$L$JL$JL$ L$L$(L$L$0L$u"D$$$$P$iLË$Ph$D$$D$D$HD$D$1ɉL$ ;L$}+$D$D$D$L$ AL$ ;L$|ո$ÁD$8êD$,D$4D$x$ĪD$1D$$D$(G?$$=u u$t-Q$$} P$|$(u |$$٪ $‰D$0u T$0|$8t)  $L$8L$T$K(  $L$8L$=nu)  $L$8L$L$0L$K(u|D$8$D$h$T$L$0L$EK(uA  $L$L$0L$K(u$D$ ( $$L$L$xL$@L$ L$8L$@L$R(u $D$(b@L$4 $L$xL$L$,L$J@L$ уHL$HL$+($T} 4$L$Y$)ȋ (LL$8 $($L$8L$ @L$L$ Xu $WD$@D$ p$ ( $L$L$ L$)$} o$y1;$ p I $$ [T$  D$ D$@(-p$L$j  L$j  L$ W$ p I $I$C;$@D$ $(=pu$ګD$= $ 0u$t$D$$D$D$(D$D$ Z$pZ;$b ( $ (L$ډ$$ L$pR  L$ eV$$u@$D$D$D$ D$$CTډ $/D$L$ $$ p I p빹Ӫ $D$D$(@$*EE-u EXD$Et*L$ $l$ l$l$ $ʼnl$ u$!D$k_bt{Dtkatol$ $넉̪l$  t ؉D$4fJt$$V4l$ $1%5dtiuhͪl$  t ؉Jt$$&4l$ $1뿉Ϊl$  t ؉D$,Jt$$D3l$ $1mEnstntҪD$ Mt(D$L$ $l$ $xJt$$B31믉Ѫl$  t ؉D$$Jt$$k2l$ $1ЪD$ Mt8D$D$8$D$D$@D$'l$ $D$w/Jt$$y21량Ϫl$  t ؉D$(Jt$$02l$ $1$L$ $L$L$L$DD$ $D$T$ B$D$聀D$ $D$D$ $D$D$ $@D$D$ $D$D$ $D$D$ $D$D$ $D$D$ $D$kD$ $D$D$ $D$D$D$ $D$D$ $ED$ à T$B,D$Bt3JJ,$D$J0)ȃD$~D$l$h,h ø|$T$뺃 T$B,D$BB twJJ,$B L$)L$~~T$JJ,$B L$)L$\~T$JJ,$D$J0)ȃD$7~D$l$h,h$ ø$9T$s$#T$UT$BFB$$Z,JJ,$B$ى\$)L$}T$JJ,$B$L$)L$}T$L$J,$cED$ u ËD$$D$$߄D$$ӄD$$D$$D$$L$ $T$J0ȃB $ɃD$$轃L$ $豃T$J0ȃB$$蚃D$$QD$$D$ ø$T$$T$T$J J,ËT$J$J,ÃdD$,D$(L$h $L$lL$L$D$`$&D$`$D$pD$|D$`$D$|D$`$D$|D$`$9L$` $L$`u $|dÉ $JL$`A,D$\ $D$`$L$` $bD$L$` $RD$D$`$BD$`$6L$D$`T$\ H,D$($:L$` $ƂD$D$($D$D$D$L$` $虂D$$D$$D$`D$蠀D$($D$D$D$D$D$ p1ɉL$ ;L$$}L$ AL$ ;L$$|ċL$( $ L$xD$`$1dÃL$ $L$L$2L$=D$ $D$yT$ B$D$yD$ $@D$yD$ $D$oyD$ $D$yD$ $D$pyD$ $D$3yD$ $D$xD$ $D$ yD$ $D$xD$ $D$xD$ $D$xD$ $D$xD$ $D$xD$ $D$xD$ $D$D$}xD$ $>D$ $D$xD$ à T$B,D$Bt3JJ,$D$J0)ȃD$xD$l$h,h ø<$T$뺃 T$B,D$BB ttJJ,$B L$)L$wT$JJ,$B L$)L$wT$JJ,$D$J0)ȃD$uwD$l$h,h$ øX$T$vJ$T$XT$B.B$ Z,JJ,$B$ى\$)L$vT$JJ,$B$L$)L$vT$L$J,$->D$ u ËD$$~}D$$r}D$$f}D$$Z}L$ $N}T$J0ȃB $7}D$$+}L$ $}T$J0ȃB$$}D$$3}D$$'}D$ øu$T$g$T$T$J J,ËT$J$J,Ã$L$( $L$,L$L$D$ $DD$uD$ $ D$uD$ $D$ $D$_uD$ $D$0D$KuD$ $D$6uD$ $D$!uD$ $D$tD$ $D$4D$qD$ $L$ $D$ uD$ $$ËD$(P$D$ $L$ $v{D$L$ $f{L$8D$ $T{D$ $H{D$ $<{D$ $D$@$D$D$0iD$^T$ 1ۋD$89É\$}0B,D$$_zT$ D$B0L$);L$ ~D$8L$$D$$É$&zL$<L$ ${L$iT$@ L$ ${T$i\$@ AL$ ${T$i\$@ AL$ $f{t$@T$i A i$D$ D$hwP$D$ D$RwL$ $ayT$i\$@ AL$ $AyD$D$ $1yD$ $L$iT$@ D$D$D$Ou\$T$ L$J,CtD$ @uCD$$rL$ PIT$)‹D$ȃwu s $L$ $L$$L$L$JD$$DD$BrD$$ D$-rD$$D$$D$JD$$D$$D$LD$$i9D$JD$$q9D$JD$$D$VLD$$7D$ALD$$$ D$KD$$L$ $L$u $/(É $L$ $R$D$$RL$ $R$ L$ $R$L$ $xR$\$$t $$u?$ $豞$4$D$$D$`\$$4$$D$ $$;$}$$u%$$$;$ȁ(É$D$D$D$MD$)L$ $(\$L$ $$D$ C,K(9si$kD$u9$D$D$D$$胲(Á$  $$$L$2D$$x9D$GD$$PD$$8D$ID$$9D$FHD$$9D$1HD$$$(D$HD$$ D$ID$$7D$ID$$*L$ $L$u $荱É $L$ $P$L$ $P$D$$OD$$O$t D$$D$D$D$/KD$)L$ $H$,D$$OD$$$D$D$D$D$ $QL$ $$,AD$$$D$D$D$D$ PL$ $$,AD$$$D$D$D$D$ PL$ $胜$,A D$$1É$6iD$ 9$D$ D$#D$$Á,DŽ$($0 $$4L$D$$9D$DD$$D$$hD$IGD$$9D$ED$$9D$ED$$D$ GD$$7D$FD$$$<D$jFD$$$8D$/ED$$iL$ $*L$u $̮,É $^L$ $ZM$ L$ $GM$$L$ $4M$L$ $!M$ Ãt _ى$k $k$D$D$$kD$$DD$$$t$(;$|9D$$$@$ u$(,1D$$D$D$D$GD$(L$ $ؙL$L$ $XLL$AL$ $ELL$AL$ $oKL$A D$$$$D$D$D$D$ ML$ $eL$AD$$($fD$ 9$D$ D$ D$$ͬ,Á0$D@$$ $H $$4 $$8L$TD$$9D$AD$$rD$$D$DD$$9D$hBD$$9D$SBD$$D$CD$$7D$CD$$$@D$6CD$$$<D$AD$$$D$AD$$L$ $L$u $聫0É $L$ $J$(L$ $I$,L$ $I$ L$ $I$($t $ }D$$$$0Ë$$ $H D$$ $ t$$;$|)D$$蛪$$;$ȁ0ËD$$D$D$D$DD$(L$ $裖L$L$ $#IL$AL$ $IL$AL$ $:HL$A D$$$,D$D$D$D$ UJƄ$L$ $(L$A$ $L$L$u"D$$褩D$@$蕩$$D$$bD$ 9$D$ D$D$$R0Á0DŽ$$DŽ$ $4 $$8L$D$$9D$V>D$$ D$$pD$@D$$9D$>D$$9D$>D$$$@D$>D$$$<D$>D$$D$?@D$$7D$*@D$$$ D$?D$$D$?D$$L$ $bL$u $0É $L$ $F$(L$ $F$,L$ $E$ L$ $YF$L$ $FF$($t $}D$$c$$0Ã$$u;$k $_$D$D$$kD$$$$D ȉD$$$t$$;$|)D$$Ŧ$$;$ȁ0ËL$ $JEL$L$ $8EL$AL$ $%EL$AD$$$,D$D$D$D$ FƄ$L$ $臒L$A D$$$,D$D$D$D$ qFƄ$L$ $DL$AD$$$$^D$ 9$D$ D$D$$謥0Ã$=t.$D$D$(D$D$,D$ D$0D$L$( $L$L$6u1$D$ $D$D$D$ D$u3D$ L$( $L$,L$L$0L$z%D$u1$ù $D$$D$D$譁T$L$ L$ JB4FL$A,:D$$T$3D$B0B BBB@B$A BDЃ$ÃL$t$ L$ $ÃD$ D$| $\$$L$ I@D$tCD$3 $֎D$$D$3D$葀D$ L$˃4K0X$\$ Ct#D$KHC%)ЉCX$D$$1(D$$4D$D$*7D$$D$(D$:D$$D$B:D$$D$:D$$D$ @$ D$ D$D$:D$$D$ @,%D$c:L$ $AD$9D$$D$9D$$D$(:D$$D$D$:D$$D$ @,%D$9D$$D$ @ D$9D$$D$ @0D$9L$ $D$9T$BЃ1 \$CtzCu_C,K)ȉD$1)Ѓt-ȁK$D$N9L$A øؓ$L$\$뼸œ$̧\$뎸$蹧\$p L$cuQ$詫1ۃ},$L$\$ %D$耫\$C|Ը$i ø$L$T멃4T$8Z,Bt(JJ,$؉\$J)ȃD$a8\$T$8Z,@@t$BD$OiT$8l$iL$8 $%D$,D$8l$|$,u 4ËD$8$D$D$D$.:L$ $4L$L$}t:$D$D$D$D$D$D$ D$D$4ËD$8$>L$8 $=D$(D$8$e>L$8 $">D$0D$8$>L$8 $z=D$D$8$j=D$8$=L$8 $=D$$D$8$=L$8 $=D$ D$8$=D$8$=\$(L$T$8@@$JAL$g\$(T$8t@L$$J@ =u L$ H D$0%@t@%=u*$TD$$D$D$芽4ËD$,4Ãt$#VD$$D$D$S4ø/$=Q$莨\$(T$8@@2B9'd$L$BD$G4à D$L$$ $D$rL$qD$$1ɃL$}>D$$D$S5D$$L$,D$2L$AL$|‹L$ $bT$u$ É$;D$ , $L$L$<t1$L$,D$D$$觜 ËL$ $w;L$$A@D$$-;D$$!;L$ $:L$$A4D$$v:D$$j:L$ $^:L$$AL$ $;L$(L$ $:@L$$A8L$ $:L$$HD$$:L$$D$$ȃHD$HD$5D$$D$,D$D$0D$6L$8 $轆D$$L$ L$D$8D$5L$ $w~D$4$D$ D$D$8D$xD$ $@L$$AtI$D$$1 ø$>D$$ ÃXT$\B$D$sL$D$ $D$2D$ $D$2D$ $D$d2D$ $D$O2D$ $D$:2D$ $D$&2D$ $D$1(D$\@@I $\D$D$ $D$D$1 (I $(D$D$ $D$D$1D$ $D$1D$ $\D$0D$ $(PtHL$ $T$T$-D$L$ $׌D$D$ $D$D$1T$uD$ $D$0(Pt8L$ $T$T$躏D$D$ $D$D$0T$uȋD$ $D$0D$ $(D$-D$ $(@D$-D$ $єD$-D$ $D$-L$ $L$ u $5XÉ $ 7D$ $6L$ $6 (AN(9w4F,D$ ډ N,4$D$ D$|$(D$L$ H,ËD$ $D$|$;à 1Ƀ }5ʉL$   $L$L$ML$uȃ A |˸ ø ÃL$ D$ $D$<D$ ;L$ fNAcT$   $:JL$ A," $&JL$ A0" $JL$ A8" $IT$ B4B$ \$T$ BJJ Ѓ$ D$D$D$ D$\$<\$ CT$SS C1øÃ4L$8 <(t14ÍD$$-dL$ $L$8 $Ѓu 4ÍL$ $gL$8 ( ( $8L$8 ,14ø4à l$\$T$|k f ,9~1 É ,9~, ,)݋D$$ (؉D$l$l$$9D$ ø ÃT$|/ * ($[D$(ÃÃP ( $L$L$L$AD$D}D$T$WD$`f1P1;T$DD$T$WD$T$L RT$ D$$fL$L IT$ ‰D$1;p}N\$H[   $T$LR\$ L$DJT$\$H] [ ;p| J ( $T$ L$L$ L$ D$$WD$T$WD$L$D$4D$ D$0D$D$(D$eD$ $ZD$($ZD$8$YD$<$YD$T$XD$dT$LB;T$DuD$$Y1PùW_WUWKWAt.W)WCV,D$ ( $L$XL$XL$ L$ L$D$(uD$0$XD$d1,1;l$(D$0$XD$\$ IrD$\$ IwD$ \$ IcD$ T$  @D$ T$  @D$l$$ T$  @ D$%cL$$ T$  @ $XL$$ T$  @$Wl$$E;l$(D$ $W1,ø-N--((D$,$.YD$D$D$ @D$D$LD$B4D$J<2LYD$ =bD$,$VYD$(b1҃}C(@#Ոt(D$,$]YD$T$$ՌD$aT$$B|D$,$aYD$aD$,$cYD$a1҃}C(@@#x#t(D$,$nYD$T$$|#D$taT$$B|D$,$rYD$UaL$,(@t $tYD$2a1(É $YD$aUY D$ ( $L$L$L$iD$uD$$$YD$`1 1;\$D$$$YD$T$ @D$ى\$T$ D$ y`T$\$ I $:D$D$$$YD$D$D$?`T$\$ I $D$D$$$YD$D$D$`L$T$ $TL$T$ @$T\$C;\$D$$T1 Á, ( $L$$4 L$L$L$ L$ L$L$(L$L$ID$$|$$u, ÍD$(ËL$$ ID (9$4 $$( KL$C$0 $( tN$AD$$8 @D$>$( @$S$( @$S$( l$YD$AD$AD$ ^묁, à D$$YD$D$1 Ã,D$ ( $L$L$ L$!D$(uC ( $L$L$ L$藛D$(uD$0$YD$^1,1;T$(D$0$YD$щT$$T$ D$] ( $L$T$$\$ L$L$L$ ,tUD$0$YD$D$D$D$D$ r]D$$mRD$$aRD$$URD$$IRL$$T$ $6RD$0$YD$]T$$B;T$(D$ $R1,Ã(D$ ( $L$L$L$kD$$uD$,$YD$\1(1;T$$D$,$ZD$щT$T$D$y\D$ ( $L$T$\$ L$L$L$ AD$ tX1;T$ }DD$,$ZD$щT$T$D$ \L$T$$QT$B;T$ |D$$PL$T$$PD$,$ZD$[T$B;T$$ D$$P1(Ã,(D$$L$IL$L$4L$ L$(L$L$L$聠(D$$uD$0$$[D$.[1,Ã|$(t[$L$IL$L$4L$ L$$IL$L$L$0D$$uD$0$8[D$Z1,1;\$$D$0$L[D$ T$ D$\$ T$ @D$ |Z\$ |$4txD$0$Y[D$ T$ @D$ T$ @D$ 1Z1ۃ}4L$ T$ @ ٺ!Ѓt <uqC|̋D$0$e[D$YL$ T$ $NL$ T$ @$N\$ C;\$$D$$N1,ËD$0$a[D$\$D$gY\$bL$ $L$ÃL$ $L$Ã(\$,E.‰։iQ)øų ‰Չi)ø@)Ãt8ع$ D$g[D$t$ l$T$\$Wع(øع$ D$u[D$l$ T$\$yWʃT$t$-L$};D$uҦ $9D$D$t1ۃ/\$[ # $L$L$U<\$u[<#L$ $)D$ T$R # $(\$;D$ }K[ # $(D$ T$R # $L$L$L$ L$0;\$tC/:L$ $8Í[<#t֍[ # $L$L$s;\$u[ # $@8Í[ # $'8ÁX$hA0tA0$K$hA4t A4$K$\ $$`L$$dL$D$ D$D$L$L$L$ $PL$$L$,L$(脹u5Ԧ $j7$hA0ܦ $S7$hA4XDŽ$LDŽ$H$\$$`D$$TL$$LD$ $HD$e$L $/$hA0$H $$T$hA4t$\$$`D$T$Ã|$u"D$D$(u $]D$1ۃ}P\$  $L$L$'\$uhL$ $L$$L$L$,L$L$0L$  ЉD$|$u-$D$D$D$D$ BD$Ci0L$4D$$L$(L$D$eD$($D$D$\$(T$<CCCL$@ $(L$D$D$ D$4$D$8D$D$D$L$ D$D$D$D$D$L$ $L$DL$L$0Ã,T$0B0D$ j0Z,J0)˃D$(@uCD$$D$D$OD$ $D$D$D$2D$(,É,$\$L$4L$ IL$ L$L$sD$(몃0 L$(t$YT$(J)}D$4$D$BD$L$ BD$$D$$5!\$BD$BD$B D$ BD$$@D$(L$(u10Ã$D$D$D$C$O $$L$#t @t  L$(tD$D$ L$$ $D$t!T$J $l$;D$}UuߋD$ ËL$$ $ML$D$D$#t$$l$\$u3t 3/ul$ \$;\$u|$(tD$(뙃0D$4D$ $L$,L$ \$ toD$(H $T$(L$ L$T$D$ѐD$B D$ J ېD$BD$D$D$B>TA $/L$D$$u ސD$$t$L$!uD$$0ø$D$4D$D$$D$K>ٸݐk,D$D$L$0 $D$D$ u1,û  p I 9\$$ $nL$ I $D$D$6\$$t 벃=ht L$ I $L$L$k"\$$u҃=t  $L$ \$$u D$41,ø$D$0D$D$;=\$$Ӌ p I D$$1ۃ4 $L$ I L$\$(LL$<($L$D$D$L$$L$ ]T$ucD$$D$4L$$p=t  $9L$u1,ø=$D$0D$D$ @ D$]<؉$1\$(C2=t  $`L$Yu|$P,ød$D$0D$;Ӄ4T$<t$$L$T$<Jt\u/AuD$8@J 9}It$L$u 4ø$D$8@D$D$<@ D$I;ҋJ $L$L$L$D$ L$2D$0};t$L$)u 4ø$D$0D$:L$ $ xL$l$8Ãu3t$‘L$u 4øƑ$x:E9؉\$,}/M)ʉ$96l$8D$D$,|$  |$0} D$$D$<@u D$<@,E$y/D$8@ $j/D$8@$[/T$8L$,JL$F9|؃ ýxD$D$L$ $L$L$à |$1D$L$t(wFD$L$u û}ɍ [)AH9vtC멃l$1Ë\$ s ú}2)ѸH59sH9| 1B|΃| 1t$$D$ D$19};L$ $T$ L$)l$ L$+t$$l$ uÉ뷃L$ $!L$l$$\$ L$(uZt0p$D$,VD$\$ L$pøp$D$6VD$\$ ҃t-p$D$=VD$l$ \$L$m렸p$D$FVD$l$ \$DtA $!L$\$(T$ tЃÃuЃøp$D$LVD$T$ \$pÃD$ L$ $)u1ËL$ @ﾭރÃ\$ \$C=ﾭt M\$K ;D$uT$JK1ÃD$ HTL$ $D$@t;MD$ 8I0HÃD$ PTT$B 8I09t MT$B$Ã(D $D$w"} (ÉD$ $L$ L$L$ )}D$ $g"(Ã|D L$ $uȃ(ÃD$PTT$ B u YT$ B B B D$ B $D$D$L$L$M à D$$@TD$$T$'B u T$B B B D$, $L$L$L$(L$D$D$  +D$D$$fD$D$W!$D$D$D$D$:!$nD$D$!L$A t]A $pD$D$ D$@ $D$D$D$D$ D$@ $xD$D$ J øR$T$ X $L$L$ouȃÃD$ L$ $KD$D$ $D$D$D$ $D$L$ 뵃 X $L$L$ou4|$tuȃÉL$ $D$D$D$L$ ؃D$ L$ $6KD$D$ $D$D$D$ $D$ L$ 뇃 X $L$ L$L$$L$L$(L$ L$,L$oouȃÃD$L$ $JD$D$$D$D$yD$$D$L$뵃L$ tX$ȃD$rÃT$uD$$1Ã|$t D$D$ X $L$L$T$pt`ȃD$L$ $ID$ D$$D$ D$L$|$u(L$ $ID$ D$$D$ D$L$ȃà X $L$ L$7rÃD$D$d$D$ $L$D$ t$L$ $HuËL$  $L$|ÃL$ $HuËD$ $D$nÃL$ $Gu ËL$ $Gu1ËD$ $D$1Ã\$|$$11l$T$ |$(uEl$D$ L$ $\$\$ |$D$|$uËL$, $L$L$G|$t$(l$\$t+;|$$}D$ T$ uG|$냃|$ uu D$ G|$t$l$\$ tN1E1)ȃÉCE 9tǃA|Z~A|Z~ 9t)ȃÃl$\$ t:CE 9tA|Z~A|Z~ 9tЉ)ȃÃE1)ȃà \$11  -+0u Cu10|9~ tډЃ ÍC ȃЉCxt)CXt 0|7CЃЉ0|9~1a|f~A|FȃɉCΉȃȃЉC-u t  CCL$ $Ã$U1Ƀ!}EL$$ $$l$$t$@$$ÃE$~ k$$p\$$D$DŽ$Su]Ѭ$$| D$@(}D$$$Ë$ $L$L$~$ƃ$$L$$L$|$ $$L$$L$L$L$ L$ L$$=D$$$D$%$D$D$ $T$'$ $L$L$V$$ $$L$L$i$]@ t C $),$0/dA $/L$7?$0$$D$D$$8D$ L$n$@$ $L$$@A } ,É$$$$L$L$l}$@ $,Ƅ$ u B t$D$D$D$$$D$D$D$D$ $ $/L$苯$8t:$@$(D$D$$D$ $D$D$$D$D$$D$ $D$$<A _$,A $$8$$D$D$$4D$ $8D$_$ $芜D$$$ $$L$L$L$}$@ $,$ƒ$t $<P L$ $L$s$<$@‰E$(}+ $A$<@ $k,Ë$8u $$<$@)˸]AL‰$ F(}<$!$<B(} B9$@r;Ѓ$$<$tF $$(,1拌$ J(빍$$D$D$$4D$ 2A$Q1AD$$D$D$D$責T$B$!L$觚\$Ńuǃ/t#u29v/u!BEAJǃ܃L$ $D$L$ $SÃuT$D$ t9|vA9}oT$D$$a|$t+D$ $D$cT$ J$ЃÉD$ $D$8T$ J$Ӄu\$1D$Qt$ѸE.Ӄ}QKșD$<|$‰щЙD$<|$‰pD$|$\$T$$T$\$9|$T$)D$BՉ\$$\$=nu!1!9|!)B!9}!@$xD$迗ú\$cщT$I $JT$\$J׃ $|D$o\$K I AAK I AA$C D$ù$D$@dD$ƹ$D$@dD$ɹ$D$dD$T$у A̹A͹ιBd|й2ѹ0ҹ$BdD$X ÃL$șЃ)Ѓu-ș$d<$uș$<$u nømÃl$\$ E |&gfff‰Й$ <$Ѓ0Eؙ$ <$Ѓ0EÁD$$D$D$ $D$}1$D$L ĤÉD$ $L$L$L$.L$ =| $띉 $D$D$L$ $L$oL$ $L$QL$ $L$q3L$ $L$1ہL$ $\$ L$\$ < uĤC븃t$ l$ t t1ۃ} t4 t/EC| t u E1øøà |$l$1UE-uF t tu 1 1ۃ t) t$0|.9)ЃЉËUE u׃tۉ1 ø Ã=uËL$D$d$ӋD$d$ËD$ d$ÉYËL$D$d$ӋD$ d$ÃYËL$D$T$t$ ËL$D$\$ D$\$YËL$D$\$ +D$\$Yø \$ËL$t|$D$ t1\$|$t$É+D$D$ۋ\$A uË\$I uËD$ËD$t1ËL$D$T$ u1Ë|$D$T$ \$L$uËD$@Ã\$T$}$\$=} u19uЃB=|L$ $T$T$\$T$D$ 9uЃ릃\$T$9rЃÉ$L$ L$D$)щL$ T$u!L$9vI%=tȃIl$1ۉtP\$ u(L$ $T$ L$l$\$ T$u't/El$B uEt E9uBЃÃuBB'tB1rBEl$B ] T$1t>L$u$L$ $T$ L$@L$T$u'tBu‰Ѓ ÃuBB'tB1뙃딃 \$D$D$;D$}0t L$ $\$ L$\$u3uD$ ËL$T$$L$L$D$뛉C띃 \$D$D$;D$}1t!x! $\$ L$G\$u4uD$ ËL$T$$x!L$D$C렃$|$0\$(D$1$D$     -|+pu0: |R$Mu 011D$0| 9a|z~~A|Z~m9|<<$u\$(|$,tD$,|$ t $Ã|$t؃$É$;t$vD$ 9sD$ C$j̓댉̓ũ녉̓{Cxt CX-C0|C9Ca| Cf~CACF~Cxt CXC-D$tC . t AD$ P;T$ tjT$BL$ I9uoBtB@9t_2$谶T$BtB@9t2$荶T$=^u R;T$ uø2$fT$L2$ST${ L$=^A9D$s A;D$r2$L$AtA@9t2$L$AtA@9t3$ѵL$ $L$AtA$D$D$AD$UL$A tA $AD$D$D$/ ø2$hL$)T$ L$tYuȃÉL$=^u&@9uȃË@9s ŋ 뾸33$T$ L$ø(3$T$ L$됃L$ $L$L$iÃ|$tLL$ $L$IL$B\$‹uCC D$Ë*MKM K M3$_륃|$L$ $L$IL$\$ʼnD$9umCuK MC ʹʉKD$ËC uKMىك @t @uȋJ KJK J U롸i3$讳l$\$y[3$蔳@T$ L$1ۃu؃ËA9uȃËA9sˋIڋI Ջ\$T$u RRËKJZBPBPÃL$ \$C9uCʹʉK1ËCu $v3D$ALЋL$ \$Cu $3D$ALЋ\$CKHCKHD$9uCD$CʹʉKD$ÃL$$D$ @4ut^L$ $T$JL$D$ D$$L$L$‹D$9tL$ $T$\L$ D$ L$IH D$Éȃ$D$AD$F"L$$cL$ $L$ IL$]D$ T$L$ $T$L$ L$ht$ l$\$ ur $l$\$ L$ C ʹʉKD$K)H D$@4u  ʉ؃É؃$D$CD$x!\$ 9t $D$:\$ L$ 눸3$T$1T$L$B9sJ s BHJI!Ë\$T$ B9sZBȋJI!à l$\$K 9=^uD$$\$zl$\$E=^uD$$l$Xl$\$K @@@@MKK KH@@EE ʉ؃ ø3$Ưl$\$M\$ =^t#L$KK KH@؃ø3$y\$ ʃ\$K @J ȋK)ȃÃL$ $L$ L$X\$ t$N9r~F)=s[NŋF)%EN)فMÃ9v݃9sڃ P C9rø3$诮\$ t$뎸3$蘮\$ t$hL$ $L$$L$\$ S)‰T$C+D$$=s?9r s&  D$$\$D$$D$D$ ËD$@9rω$L$S\$ K D$@4u7 ʉL$ $D$D$D$$D$ D$7\$ qL$ $D$D$D$L$ 릃 T$l$BHЋ\$!ÁsE9r s ËB9r+D$$E)؉\$D$D$ ʋD$$D$D$iL$ ʋD$$L$|D$ Ã\$L$ KK ^@Ã$\$,T$(B4B؋J9vV$P L$(uA4u*4$=$É $ 4D$AD$D$,D$ AD$AHƉ$B(Љƒu$ËD$(L$,HT$ $D$jD$ $D$,D$D$($D$ D$\$ K  ʉ$C)ȉL$D$D$($D$D$?D$($D$D$D$($D$D$|$(l$ 1_$9v ދ[ 9w] tE hutHEh Et<$l$ED$I|$(l$ E t<$E D$l$&$Éo$빉$3D$\$BHЋ\$,T$(6T$=^L$ $T$D$$L$L$>D$$D$ D$D$$D$D$\$K ‹=^uL$ $\$T$ËD$$\$\$D$$D$D$ÉT$$D$ D$$D$ D$^D$$D$D$D$ D$p뺃D$$D$ D$fD$$D$$D$R\$ T$$C9u9w@4$让\$ T$$D$@,$T$D$@,Ћt$l$$\$ ECCX K Ë@)ÃM D$4$\$\$D$$D$D$\$ L$$$A)؉D$L$D$$L$D$)ȉD$D$$D$D$ND$ É^$^1Ã8\$@T$<$]4D$D$\$ D$CD$CD$C D$CD$ CD$$CD$(BHЋT$@\$$,$ L$$$Duȉу$ L$$Duh$W$@$,$ L$J$D$At ȉ"<Ãt AMM:E t .tA+t-u$$u븃먃$ڃ$$8$,ttkaEt ect U;kt[t]tXtStG$8u0t,$8D$$8$8Ȉ$,벺뫃t tu؃Љl$ 1һ~ Љ‰$KUÃl$ 1ۃ}DC|1҃}DDB|D$$D$0d$L$ u20~ Ã|$u} |uA|19~ 9} D$g t$\$1҉ىumF?uNtƉt5t(‰Ɖ)‰E0D$uE É벍Љ‹D$눉ىlj)‰E0F?uD$눍Љǃ l$\$T$ l$~3$T$ D$l$\$T$ l$̓~$T$l$ ÃD$$ | T$ R &‹D$L$ $JL$JL$oM\$T$~KD$$)D$(D$$D$ D$T$$Ã|$t$1O;|$ s2t)ݸgfff‰Ӎ)N0u׃ЋL$؉Ÿgfff‰Ӎ)N0듃 D$,ڃ | T$ R \'‹D$L$$ $JL$JL$tL|$$t$(l$}MËD$0L$)D$,(.<$D$\$D$D$ à D$D$D$t9T$D$ [t $[‹D$9t 1 ÃL$}Vىȁ} 4XBÉȁ‰)ЉT$ $\$D$ $L$=Á} XBÉȁ‰)ЉT$ $l\$D$ $\L$ÃD$$$ÃD$\$ D$%=t1D$$D$:u 1D$$|$ }L$$ÃL$D$ $<$t1Á|$u| 1|$u 11ÃD$(D$ $ uD$ $D$vtD$ \$ tD$ \$D$ $T$(\$ D$uL$ \$D$%d$L$?D$ÃL$(\$ uD$ \$ D$%ƃȃ͕ؕ~ H)ž~ty~[~l$ L$ٺЋL$HT$!‰й ) D$ D$%d$ D$)݃d$ D$D$ M1l$ D$ D$ D$%d$  D$Q΁|\$ v$ø$Ã\$$D$\$D$%=u3D$|$uD$%ud$D$D$\$vF\$v.d$$\$L$$\$-4d$D$Á)Ѹ!D$D$D$D$d$Ã5у!D$\$vd$D$Ã$kÃ$,kËD$d$t$ ËD$l$|$ Ã(D$$Ӈ̺$D$D$D$fD$0D$ 1҉T$$;T$ L$3T$3PL$ T$̺$D$ D$D$ L$0D$,$D$ D$L$ED$,l$0D$1D$ D$1D$̺$D$ D$D$T$$ D$ D$ABT$$;T$ ?(É끁D$D$ 1ۃ$} ˌ$T$ C$|ะ$D$D$D$D$($D$yĬÃ$茍=ucD$ $D$D$6$Á$uIP $eu 1É$$D$PD$C$ƃLMu*C#EgC CܺCvT2CƃMHH@)ŋ$9s$H H$$D$l$l$CT$$)$H$H@uC؃H$HD$؃D$$HJǃH$tG$$L$L$؃D$l$$J)$$$uJ$t7؃H$$D$$D$B$$H؁ËHWރHH1ɉ+J$2ƒ88)鉬$T$ $D$L$L$A$D$ D$$ SL$ SL$$$ $D$D$D$$$$D$$D$$$1ɉJ$$؃D$D$r$Lu $c1ùx)鉬$D$T$$D$$D$@$$D$Tyl$\$ T$9s.CCCC9r҃à L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$ L$L$ ÃlL$pT$t D$LD$p;D$LD$x@D$dD$x@ D$`D$x@D$\D$x@D$XD$ $D$pD$@D$|$Xt$dl$`D$h|$h0}jL$hDU‹D$h D JJ )ˉى Љ|$\l$\D$h|$h0|D$xpD$xh D$xL$\HD$xxD$x@1PD$p@D$p;D$LlÉ3D$\1nj#D$\! ȋL$\! yZJ#D$\! 5$uIP $_u 1É$$D$PD$C>$ƃLMu#C#EgC CܺCvT2ƃMHH@)ŋ$9s$H H$$D$l$l$=T$$)$H$H@u,؃H$HD$\$^$ǃH$t4$$L$L$\$#L$$)$$$uJ$t7؃H$$D$$D$=$$H؁ËHHރHH1ɉ+J$2ƒ88)鉬$T$ $D$L$L$^<$D$ D$$ S$ S$$$ $$D$D$$$$D$$D$$$$D$D$r$Lu $^1ùx)鉬$D$$$D$$D$z;$$D$l$\$ T$9s.CCCC9r҃Ãl$\$ T$9s.C K K ȉ9r҃Á$uIP $[u 1É$$D$PD$Q:$ƃLMu#C#EgC CܺCvT2ƃMHH@)ŋ$9s$H H$$D$l$l$9T$$)$H$H@uC؃H$HD$؃D$E$HJǃH$tG$$L$L$؃D$l$$J)$$$uJ$t7؃H$$D$$D$8$$H؁ËH]ރHH1ɉ+J$2ƒ88)鉬$T$ $D$L$L$B8$D$ D$$ S$ S$$$ $$D$D$$$$D$$D${$$1ɉJ$$؃D$D$r$Lu $ZZ1ùx)鉬$D$$$D$$D$I7$$D$sl$\$ T$9s.CCCC9r҃à L$$ $L$(L$L$,L$L$0L$ L$4L$L$8L$L$L$ ÁX$p$x~ 1XÃ$h@v 1XÃ+M$\ $$`L$D$T$ $tЉ$p$luXÍ$$\D$@D$5$h$dƄ$S19s+0C9r$D$D$D$$pD$ $tЍ$ $@L$D$D$ $tЉD$$$xD$$lD$L$ $t1XÍ$$6D$@D$4$h$dƄ$S19s+0C9r$ $@L$D$$pL$ $tЉƒ^1Xà D$$D$D$P4D$$D$D$D$_4D$$D$ D$P L$tD$$L$D$!4D$ﾭރ à D$$D$D$3D$$D$D$D$3D$$D$D$ D$$D$D$ D$$D$D$ L$tD$$L$D$]3D$ﾭރ Ã|$ l$G O O ȉGO O O ȉÉ%UUUUځ⪪ ہ㪪UUUU ˉ%33ف33 ȉ ȉ %ف ȉ ȉÉ%33с33 ȉ ȉ %с ȉ ȉƒ|$$$xD$|$}u 1Ɖ X:3 X<3 X>3 X@1Ëu 1Ɖ X;3 X=3 X?3 XA1Ë$ŋu 1Ɖ X:3 X<3 X>3 X@1‹u 1Ɖ X;3 X=3 X?3 XA1‹$D$|$媪сUUUU ͉%UUUUځ⪪ ‰%33с33 ȉ ȉ %с ȉ ȉ‰%3333 ȉ ȉ %ف ȉ ȈGGGWGGG$~ D$(@L$( ȋL$(I ȋL$(I ȉŋD$(@L$(I ȋL$(I ȋL$(I ȉÉ%UUUUځ⪪ ہ㪪UUUU ˉ%33ف33 ȉ ȉ %ف ȉ ȉʼn%33с33 ȉ ȉ %с ȉ ȉD$|$D$,D$T$$)x|$,D$|$y2 1Ɖ X:3 X<3 X>3 X@1ŋr 1Ɖ X;3 X=3 X?3 XA1ʼn‹2 1Ɖ X:3 X<3 X>3 X@1Ër 1Ɖ X;3 X=3 X?3 XA1ÉD$|$݉D$|$3檪UUUU Ή%UUUUځ⪪ ‰%33с33 ȉ ȉ %с ȉ ȉ‰%3333 ȉ ȉ %ف ȉ ȉËD$(L$(AL$(AL$(AD$(PL$(AL$(AL$(A ËL$T$$ ¿9 t$l$1 2+ 2 Љƃ 2+ 2 ЉŃ< <  P<  <   <  <  P<  É< P<  <  <   <  P<  <  ‰%ف ȉ ȉ ȋL$%ك? ȉ ȉу? ȋL$AD$Gn ÃT$ B J J ȉBJ J J ȉ‰%@@@@ ȉ ȉ ȉсက ȉ ȉ ȉ ȉʼn% ȉ@@@@ ȉс ȉ ȉက ȉ‰%3333 ȉ ȉ %ف ȉ ȉÉ%33с33 ȉ ȉ %с ȉ ȉʼnڃ% $L$D$$D$Ãl$ \$EM M M ȉEM M ȉʼn  C  C C у C C C CÃ\$T$ %J J J J ȉB%J J J ȉ‰CCCCCCÃD$$D$D$?D$$D$D${Á`$d$h$|$X|$$T$ $ L$$\|$l$$l_\$OW w$d;ω}7yZ1#|$1L$t${ω}yZ|$1!1t${ω}yZ1#|$1L${ ω} 7yZ|$1!1t${ω}yZ3|$!3|$t$;l$";ω}7yZ1#|$1L$$d\$}3}3}3}lj}yZ1!1}3}3}3}lj}yZ1!1}3}3}3}lj} yZ1!1}3}3}3}lj}yZ1!1}3}3}3}lj}7n11}3}3}3}lj}n11}3}3}3}lj}n11}3}3}3}lj} n11}3}3}3}lj}n11;l$ !}3}3}3}lj}7ܼ11!11}3}3}3}lj}ܼ11!11}3}3}3}lj}ܼ11!11}3}3}3}lj} ܼ11!11}3}3}3}lj}ܼ11!11;l$}3}3}3}lj}7bʉ11}3}3}3}lj}bʉ11}3}3}3}lj}bʉ11}3}3}3}lj} bʉ11}3}3}3}lj}bʉ11;l$!$l_OW w<$9$d7`ÃD$D$ $l$t$^NV 1!1׍8xjE؉1!1ύ:VU ‰1!1ߍ9p $Mщ1!1Ǎ;ν] ˉ1!1׍8|E؉1!1ύ:*ƇGU ‰1!1ߍ9F0Mщ1!1Ǎ;F]ˉ1!1׍8ؘiE ؉1!1ύ:DU$ ‰1!1ߍ9[M(щ1!1Ǎ;\],ˉ1!1׍8"kE0؉1!1ύ:qU4 ‰1!1ߍ9CyM8щ1!1Ǎ;!I]<ˉ1!1ύ8b%E؉1!1ߍ:@@U ‰1!1Ǎ9QZ^&M,щ1!1׍;Ƕ]ˉ1!1ύ8]/E؉1!1ߍ:SDU( ‰1!1Ǎ9M<щ1!1׍;]ˉ1!1ύ8!E$؉1!1ߍ:7U8 ‰1!1Ǎ9 M щ1!1׍;ZE] ˉ1!1ύ8E4؉1!1ߍ:U ‰1!1Ǎ9ogMщ1!1׍;L*]0ˉ11׍8B9E؉11ύ:qU ‰11ߍ9"amM,щ11Ǎ; 8]8ˉ11׍8D꾤E؉11ύ:KU ‰11ߍ9`KMщ11Ǎ;p](ˉ11׍8~(E4؉11ύ:'U ‰11ߍ90M щ11Ǎ;]ˉ11׍89E$؉11ύ:U0 ‰11ߍ9|M<щ11Ǎ;eV]ˉ׃ 1ύ8D")E؉σ 1ߍ:*CU ‰߃ 1Ǎ9#M8щǃ 1׍;9]ˉ׃ 1ύ8Y[eE0؉σ 1ߍ: U ‰߃ 1Ǎ9}M(щǃ 1׍;]]ˉ׃ 1ύ8O~oE ؉σ 1ߍ:,U< ‰߃ 1Ǎ9CMщǃ 1׍;N]4ˉ׃ 1ύ8~SE؉σ 1ߍ:5:U, ‰߃ 1Ǎ9*Mщǃ 1׍;ӆ]$˃@|$_OW <$9$ËT$L$J kÃL$Altȃp$dD$$ dT$L$ JhBl$=D$$=L$ $(L$AlL$ $(T$Ѓp$2dD$$!dËAh;D$ bÁ0$4p$mc$4JH $JlL$JhL$b$4p$c10É$,$0($($$4@lD$$,D$$4p$kc$( $$,L$L$L$};$,t$($<10Ë$4Id $L$ L$$ƒ $'D$$萗$4T$L$ ׃t$D,$(ƂƂtǂ=t)$/D$CHD$D$D$ yFT$Ё0Ë$4tƀ$(ǃt$DЉT$$D$D$[$4T$J=t?t=$/D$CHD$ЃD$ D$ET$Ё0ø$%/D$CHD$ЃD$ ET$˃D$hHL$ $l$T$1E9sO$ډ\$ IL$ 4\$ l$ƒt&<(փ CE9rf$t&pPppv ,$D$;ø//$q@L$;T$ l$hp9u Ehp9tIpht*h $pL$L$$L$ҋl$11E9s8p $ډ\$ IL$L$$L$D$Ћ\$l$ƒt3f$tt,$D$;É,$T$+<(pCf,$D$É,$8/D$à L$I $i/L$L$V'T$tl/($D$ ùt/(J$$D$m Ã|$u$D$ t$D$ $D$ø{/$u>́$I` $$IL$5$$lu$D$ĐËCt$CЁĐÍD$$D$/D$D$ uA$$D$D$븃 T$|$t lu ËtI` $l L$5D$D$$m5̓L$ I` $L$I L$4T$hu$D$ǂlBt)L$ I` $JL$4T$lJ $"\$ T$hA t[h Hh@$胑\$ T$ׁ$hv 󥋺hց$Ct $CЃÉ$D$$D$à T$|$t hu ËtI` $h L$z4D$D$$3̓L$ Id $L$IL$\$ T$ddt0d9t&C0t $C0ЃÉ$D$K$D$9؃ |$D$dȉL$x$ZT$u[ $L$N \$L$x$[ Éx$ZD$$MD$ǀd1 ø/$:.$D$0L$( $L$,L$L$L$@DЃt$Ë|$(t$1$à T$B@u1 ËL$ $L$L$B@Ѓ ÃL$I` $L$I L$1T$hu$D$Ëh@t$/D$Bfth@%B J9L$I` $JL$0T$pu$D$ËhI $ \$T$pA h@t $ËCDt $/D$tD$\$ ԋC<t $C<¸/$V볋h($菍\$T$hps$D$Và T$|$u`$Jf9rP$uph $4p֋B J9t pu5$u|$uBtЛǂ댋tI` $p L$50D$D$$/T$똃L$I` $L$I L$g/T$hu$D$*Ëh@t$[D$Ëh@%tB࿃ׁ$hBt,/$6T$Bth@%t =h@hI $hI L$\$80T$u$D$B@t7hII@ $hI L$L$/T$ׁ$hv 0%t#hI $e+T$hA$t.D$@t$D$@ЃÉ$D$K$/D$8É$D$#É$D$ûxnd$\D$ Á$$tĔÃ=tZD$$D$0D$BD$ i8L$ $ D$$D$D$D$D$%M$hJHhց$0%th@0@4Ĕà L$I` $L$I L$,T$hu$D$ Ëh@t$[D$ ڋh@%u$D$| 볋h@t0hI $hI L$L$U-T$t3D$@ t$D$@ X$D$ B$D$ ,T$|$tËhJHhց$ÃL$I` $L$I L$*t$l$hu,$D$ ËE},$[D$b ÉIus,$l#D$7 Ëh@%tIENh9v NhMM $\$T$0h@t h@%th@u'C$t $C$ЃÉ$0D$f 鋊hI$ $L$JL$'T$,$D$( Ãn$[D$ Ëh0I[99\$|$uh@%uË,1ɋhB0J4$I` $$I L$($$hu$D$S ĔËB}$[D$3 ĔÉуIus$[D$ ĔËBKh9v KhJh@tu*C(t$C(ЁĔÉ$B0D$D$$D$ 0D$h@D$ Z3$$D$D$dĔËL$|$tËh@t h@@ÃL$ I` $L$I L$'T$hu$D$É$D$à L$I` $L$I L$}'T$hu$D$ Ëh@t3hII@ $hI L$L$y(T$tAD$@,t$D$@,Ѓ É$hIt 1D$(޸$D$ ÃT$|$tËh@tchI $vT$}Ѓ|tD$ $D$D$&Ã|tD$$D$D$D$D$D$ D$ ÃD$@Pu?L$ $=} $s>D$T$\$ZLL$HHD$L$HT|$ t1L$ $L$ITL$})$D$ D$>=tu 7$>$D$D$D$tЋT$BXuM$8$D$WD$@H$8T$BHJL9tBL$8T$|$$tBJT $L$$L$L$(L$AL$ %uB$D$$D$E=ËBT$7 L$L$AXu4$P7$D$衞D$@T$c7L$ $ ÃL$tD=~,$ D$L$L$D$ "L$$bsà $-D$ $T$L$ JЃÃL$ $AD$D$ $à $L$L$D$ $$D$ $L$ $L$L$L$ L$! L$ u $\D$ $P1Éȃà =~$2D$D$D$!L$ $L$L$ ÃT$uÃ=~($BD$T$D$ t!T$с $rL$hth$L$ptp$L$ltl$L$dtd$2L$1ҋ9}2T$$D$3T$L$B9|΋$L$A|tP@t $@ЋL$$D$$D$$Ë($oD$T$]D$X$KD$\$9D$`$'L$Q =~$SD$D$D$L$ $L$L$' ÃL$ $8D$u+$!D$D$D$]"$D$$D$D$D$yL$ $^D$ D$$D$ D$D$ÃL$ $L$L$_D$ u+$"D$D$D$>"$|$u$L$ $l^D$D$ $D$D$8L$ $H^D$D$ $D$D$/D$ ÃL$ $+D$ u+$B"D$D$D$0b"$kL$ $]D$D$ $D$D$D$ Ã=tu T$7 $>ljD$ t$(L$ $MT$ ~$T$D$tЃÃtD$xD$ $L$$L$dD$ }2$TD$D$D$D$ 1tÍL$$ $L$LL$f}P$ UD$D$D$D$ D$$D$$tËL$ $L$LL$gD$}-$UD$D$D$LD$ M $ljD$t$(L$L $t$l$uLuHE`EdElDž !$l$D$t L$AHD$L$ $D$$0D$$ D$$ ÁD$ $D$/UD$$D$ D$L$ $D$i/L$|iD$$L$ L$L$6ƒ~5D$L$ $!L$tL$ $D$D$$)/L$u9U $~ȁĠËD$à $-\$ ƒu6"ЃÃ|$u 6"D$1ہ}L\$ T$Ht0AD$L$A$D$ЋD$$\$ L$uC|D$$vÃL$ $C\$T$ t9uȃË D$$6L$ $L$L$t*HL$ $D$ЋD$$k7D$D$D$$7L$ $L$L$D|$t AD$ ȋL$ H<$8D$ ù $\$D$L$ H$E|$t$ INpD$ 멃D$$V7L$ $L$L$|$tD$ <$8D$ ù $\$D$L$ H$|$t$ INpD$ 멃D$$6L$ $L$L$"t*BD$ȋJ$u D$$q7D$D$$[3 \uQ $U1}( IR xHDE|džLFlL$ AD\$l3L$ AlD$ $D$xD$D$ L$Hlà D$H`t'AD$L$ $q L$uًD$@0$Y D$@4$J D$@8$; D$@<$, $32T$u \JD\$2 ø$fT$͸$SL$R D$@tt ËD$@pu ËT$`t%u-T$ I $ T$uۋD$@p Ë뾃L$ $fL$u $Ad@ЋD$$à T$J@u"$B*D$$ ÉL$9u"$*D$$z ÉЃH$3D$H$3\$T$Bht@$)D$H$4D$H$4D$$ ËB@9t@$)D$H$I4D$H$:4D$$ ËK`t 9L$t9t $n\$T$L$KhCpB@ЃH$3D$$D$H$3D$$=D$$1D$$%1 ËI\L$A%u$$(1ÉȃH$b2L$`L$t=t&T$ I0 $L$ L$wT$ уL$uù $ ‹D$T$ }D$L$ $T$$L$A0Nщ $L$A4L$I8 $T$$L$A8щ $T$BD$D$$D$D$L$ |$ z$0$L$ $,É,$>$$@?ug$$$$@ $T$L$L$L$ D$$0 $ >D$D$$D$D$N$T$L$L$L$ .D$$0 $=D$D$$D$D$L$ $L$L$Au1Ë@ à L$$ $L$0L$D$|$|,L$ $ L$@L$ t$L$$ $L$L$L$(L$L$,L$ L$0L$0L$D$| $SD$ Ã|$1}[l$ [ $|$l$ËD$9r0<$ [L$\$ \$|$t$l$\$ t E|/$|$9t ; u9u(D$ ǀ D$ . [ËD$ )I D$ A փ  $L$Ju1 ËL$ ÃD$$KÃ0L$8 $D$@@=~J$P0ËD$4$D$8D$L$,L$ l$,\$4+ƀ +$D$T$t1Ë $ L$L$L$u%$w 1ËD$ÃL$ $L$L$L$ L$L$$L$ T$(tu+u dËL$ $҃}dÃÁ$u%$ 1ĬÍD$$D$ &$ $ $D$$ $&L$$L$L$L$ $L$ t$&$b 1Ĭù $$$u 1ĬÉ$:&L$D$D$ $L$$$X t%&$ $$1ĬDŽ$ $D$D$a$ $W&L$$L$$L$ $L$$$u $F$=~+$w&$$D$ 1 $$)؉D$$ $$ L$L$L$ &]&$$D$$ $Q$ $$D$$D$Uo$ĬË$ $ L$ L$$ 9?&$/$ D$4L$0 $D$D$D$D$& $L$F}&$D$$n1$ÉD$ $t4L$( $D$D$L$,L$L$L$ aD$D$$D$ $D$$ D$$ÃL$ $E@D$L$ $PD$ u1ÍL$ $C2D$D$ $D$D$L$ $L$L$à $D$:} ÉD$$xL$?L$ D$ D$$,L$ x$D$x xL$ $L$L$ ÃD$(L$ $L$ L$L$$L$D$D$ iÃt$L$$AA AA|$(u |$|$ }AA |$t6t$(L$ $t$t$l$ T$$ÉD$ |$uÃ|$,B @9|$ v |$'u|$,tmB 9B B|$'u|$,t3B 9BB tZBZB L$:D$B@9^ËBȃ9H뇃=$tL$ $$Ћt$l$ \$ T$$>뀋B9D$D$L$ $t$l$ T$$ÉD$ t g|${D$MgDl$TD$HD$,L$PIT$, D$(D$LD$L$ $zþ@~@19} \$C'tKD$ )؃9~ |$ )߃\$ $l$|$(|$\$ D$(ÉC'+D$ÉL$ )ك9~D$ )؃=19|$(}~Ѓ)Ѓt7\$ $D$t$.D$,|$(t$l$$\$ F몉C + } + u+wC1+ uރ$D$q1ɃL$L$> $7u1$ÉD$ dst=%q $dfsmapshare, already connected, src=%q => dst=%q %s%sdfsmapshare connected, src=%q dst=%q dfsmapshare failed src=%s not founddfs remap %s dfs remap %d < %d /dfs remap nfields=%d dfs remap ping failed dfs remap bad ping %ld < %ld && %ld < %d dfs remap ping OK prox=%d host=%s share=%s path=%s dfsreferal level=%d prox=%d path=%q addr=%q dfsreferal level=%d path=%q found=%d used=%d dfsredirect name=%q path=%q dfsredirect cache=hit src=%q => share=%q path=%q //%s/%s/%s%s%s/no memory: %rdfsredirect refresh failed unc=%q dfsredirect refresh cache=stale src=%q => share=%q path=%q //%s/%s/%s%s%s///%s%sno memory: %rdfsredirect new failed unc=%q dfsredirect cache=miss src=%q => share=%q path=%q remove prohibited/37:HKwz~#3GOqsa'QWh,l,,,,,Am#/3oz|az?@?*VW3'{}0OP_a '07@E`gpqJruVvwdxyz{p|}~p!!$$0,^,-%-AZ(Oy1a8<BP*Q*R*S.T2Y6[5`3c1e(fDh/i-k)o-q)r+u*})&&&%ETwy}   N!!a,e,f,s,v,,'---increfreq %p %ld lookupreq %lud closereq %p %ld removereq %lud bad countG0d=k*G(-i,2Q!X5^unknown fidl"r"Ny"""8""""""file not foundunknown specifier in attachokdoneerrorneedkeybadkeyphasetoosmallerrormalformed rpc response: %srpc too bigauth_rpc short writeunknown rpc type %d (bug in auth_rpc.c)unspecified rpc error%sneedkey %s badkey %sbadkey %sphase error %sPm/37:HKwz~#3GOqsa'QWh,l,,,,,Am#/3oz|az?@?*VW3'{}0OP_a '07@E`gpqJruVvwdxyz{p|}~p!!$$0,^,-%-AZ(Oy1a8<BP*Q*R*S.T2Y6[5`3c1e(fDh/i-k)o-q)r+u*})&&&%ETwy}   N!!a,e,f,s,v,,'---/proc/%d/note/proc/%d/notepgannounce opening %s: %rannounce arg format %s%s/announce reading %s: %rannounce %sannounce writing %s: %r%s/listenlisten opening %s: %rlisten arg format %slisten reading %s/listen: %raccept %s%s/datareject %s %s%s/%s/clonebad dial string: %s/netbad dial string: %s%s/cs%s/%screate in non-directorysuccesswait 1wait 2wait 3wait 63abandonedabandoned wait 63user apckernel apcalertedtimeoutpendingreparsemore entriesnot all assignedsome not mappedoplock break in progressvolume mountedrxact committednotify cleanupnotify enum dirno quotas for accountprimary transport connect failedpage fault transitionpage fault demand zeropage fault copy on writepage fault guard pagepage fault paging filecache page lockedcrash dumpbuffer all zerosreparse objectresource requirements changedtranslation completeds membership evaluated locallynothing to terminateprocess not in jobprocess in jobwait for oplockobject name existsthread was suspendedworking set limit rangeimage not at baserxact state createdsegment notificationlocal user session keybad current directoryserial more writesregistry recoveredft read recovery from backupft write recoveryserial counter timeoutnull LM passwordimage machine type mismatchreceive partialreceive expeditedreceive partial expeditedevent doneevent pendingchecking file systemfatal app exitpredefined handlewas unlockedservice notificationwas lockedlog hard erroralready win32wx86 unsimulatewx86 continuewx86 single stepwx86 breakpointwx86 exception continuewx86 exception lastchancewx86 exception chainimage machine type mismatch exeno yield performedtimer resume ignoredarbitration unhandledcardbus not supportedwx86 createwx86tibMP processor mismatchhibernatedresume hibernationwake systemds shutting downCTX cdm connectCTX cdm disconnectSXS release activation contextguard page violationdatatype misalignmentbreakpointsingle stepbuffer overflowno more fileswake system debuggerhandles closedno inheritanceGUID substitution madepartial copydevice paper emptydevice powered offdevice off linedevice busyno more EAsinvalid EA nameea list inconsistentinvalid ea flagverify requiredextraneous informationrxact commit necessaryno more entriesfilemark detectedmedia changedbus resetend of mediabeginning of mediamedia checksetmark detectedno data detectedredirector has open handlesserver has open handlesalready disconnectedlongjumpcleaner cartridge installedplugplay query vetoedunwind consolidatedevice requires cleaningdevice door opencluster node already upcluster node already downcluster network already onlinecluster network already offlinecluster node already memberunsuccessfulnot implementedinvalid info classinfo length mismatchaccess violationin page errorpagefile quotainvalid handlebad initial stackbad initial PCinvalid CIDtimer not canceledinvalid parameterno such deviceno such fileinvalid device requestend of filewrong volumeno media in deviceunrecognized medianonexistent sectormore processing requiredno memoryconflicting addressesnot mapped viewunable to free VMunable to delete sectioninvalid system serviceillegal instructioninvalid lock sequenceinvalid view sizeinvalid file for sectionalready committedpermission deniedbuffer too smallobject type mismatchnoncontinuable exceptioninvalid dispositionunwindbad stackinvalid unwind targetnot lockedparity errorunable to decommit VMnot committedinvalid port attributesport message too longinvalid parameter mixinvalid quota lowerdisk corrupt errorfile name syntaxdoes not existcreate -- file existsport disconnecteddevice already attacheddoes not existdoes not existfile name syntaxdata overrundata late errordata errorcrc errorsection too bigport connection refusedinvalid port handlesharing violationquota exceededinvalid page protectionmutant not ownedsemaphore limit exceededport already setsection not imagesuspend count exceededthread is terminatingbad working set limitincompatible file mapsection protectionEAs not supportedEA too largenonexistent ea entryno EAs on fileEA corrupt errorfile lock conflictlock not granteddelete pendingctl file not supportedunknown revisionrevision mismatchinvalid ownerinvalid primary groupno impersonation tokencant disable mandatoryno logon serversno such logon sessionno such privilegeprivilege not heldinvalid account nameuser existsno such usergroup existsno such groupmember in groupmember not in grouplast adminwrong passwordill-formed passwordpassword restrictionlogon failureaccount restrictioninvalid logon hoursinvalid workstationpassword expiredaccount disablednone mappedtoo many luids requestedluids exhaustedinvalid sub authorityinvalid ACLinvalid SIDinvalid security descrprocedure not foundinvalid image formatno tokenbad inheritance ACLrange not lockeddisk fullserver disabledserver not disabledtoo many guids requestedguids exhaustedinvalid id authorityagents exhaustedinvalid volume labelsection not extendednot mapped dataresource data not foundresource type not foundresource name not foundarray bounds exceededfloat denormal operandfloat divide by zerofloat inexact resultfloat invalid operationfloat overflowfloat stack checkfloat underflowinteger divide by zerointeger overflowprivileged instructiontoo many paging filesfile invalidallotted space exceededinsufficient resourcesdfs exit path founddevice data errordevice not connecteddevice power failurefree VM not at basememory not allocatedworking set quotamedia write protecteddevice not readyinvalid group attributesbad impersonation levelcant open anonymousbad validation classbad token typebad master boot recordinstruction misalignmentinstance not availablepipe not availableinvalid pipe statepipe busyillegal functionpipe disconnectedpipe closingpipe connectedpipe listeninginvalid read modeIO timeoutfile forced closedprofiling not startedprofiling not stoppedcould not interpretfile is a directorynot supportedremote not listeningduplicate namebad network pathnetwork busydevice does not existtoo many commandsadapter hardware errorinvalid network responseunexpected network errorbad remote adapterprint queue fullno spool spaceprint cancellednetwork name deletednetwork access deniedbad device typebad network nametoo many namestoo many sessionssharing pausedrequest not acceptedredirector pausednet write faultprofiling at limitnot same devicefile renamedvirtual circuit closedno security on objectcant waitpipe emptycant access domain infocant terminate selfinvalid server stateinvalid domain stateinvalid domain roleno such domaindomain existsdomain limit exceededoplock not grantedinvalid oplock protocolinternal DB corruptioninternal errorgeneric not mappedbad descriptor formatinvalid user bufferunexpected io errorunexpected MM create errunexpected MM map errorunexpected MM extend errnot logon processlogon session existsinvalid parameter 1invalid parameter 2invalid parameter 3invalid parameter 4invalid parameter 5invalid parameter 6invalid parameter 7invalid parameter 8invalid parameter 9invalid parameter 10invalid parameter 11invalid parameter 12redirector not startedredirector startedstack overflowno such packagebad function tablevariable not founddirectory not emptyfile corrupt errornot a directorybad logon session statelogon session collisionname too longfiles openconnection in usemessage not foundprocess is terminatinginvalid logon typeno guid translationcannot impersonateimage already loadedabios not presentabios lid not existabios lid already ownedabios not lid ownerabios invalid commandabios invalid lidabios selector not availableabios invalid selectorno LDTinvalid LDT sizeinvalid LDT offsetinvalid LDT descriptorinvalid image NE formatrxact invalid staterxact commit failuremapped file size zerotoo many opened filescancelledpermission deniedinvalid computer namefile deletedspecial accountspecial groupspecial usermembers primary groupfile closedtoo many threadsthread not in processtoken already in usepagefile quota exceededcommitment limitinvalid image le formatinvalid image not MZinvalid image protectinvalid image win 16logon server conflicttime difference at DCsynchronization requiredDLL not foundopen failedIO privilege failedordinal not foundentrypoint not foundcontrol-C exitlocal disconnectremote disconnectremote resourceslink failedlink timeoutinvalid connectioninvalid addressDLL init failedmissing systemfileunhandled exceptionapplication init failurepagefile create failedno pagefileinvalid levelwrong password coreillegal float contextpipe brokenregistry corruptregistry io failedno event pairunrecognized volumeserial no device initedno such aliasmember not in aliasmember in aliasalias existslogon not grantedtoo many secretssecret too longinternal db errorfullscreen modetoo many context IDslogon type not grantednot registry fileNT cross encryption requireddomain ctrlr config errorft missing memberill formed service entryillegal characterunmappable characterundefined characterfloppy volumefloppy id mark not foundfloppy wrong cylinderfloppy unknown errorfloppy bad registersdisk recalibrate faileddisk operation faileddisk reset failedshared IRQ busyFT orphaningBIOS failed to connect interruptpartition failureinvalid block lengthdevice not partitionedunable to lock mediaunable to unload mediaeom overflowno mediano such memberinvalid memberkey deletedno log spacetoo many SIDsLM cross encryption requiredkey has childrenchild must be volatiledevice configuration errordriver internal errorinvalid device stateio device errordevice protocol errorbackup controllerlog file fulltoo lateno trust LSA secretno trust SAM accounttrusted domain failuretrusted relationship failureeventlog file corrupteventlog cant starttrust failuremutant limit exceedednetlogon not startedaccount expiredpossible deadlocknetwork credential conflictremote session limiteventlog file changednologon interdomain trust accountnologon workstation trust accountnologon server trust accountdomain trust inconsistentfs driver requiredno user session keyuser session deletedresource lang not foundinsuff server resourcesinvalid buffer sizeinvalid address componentinvalid address wildcardtoo many addressesaddress already existsaddress closedconnection disconnectedconnection resettoo many nodestransaction abortedtransaction timed outtransaction no releasetransaction no matchtransaction respondedtransaction invalid idtransaction invalid typenot server sessionnot client sessioncannot load registry filedebug attach failedsystem process terminateddata not acceptedno browser servers foundVDM hard errordriver cancel timeoutreply message mismatchmapped alignmentimage checksum mismatchlost writebehind dataclient server parameters invalidpassword must changenot foundnot tiny streamrecovery failurestack overflow readfail checkduplicate objectidobjectid existsconvert to largeretryfound out of scopeallocate bucketpropset not foundmarshall overflowinvalid variantdomain controller not foundaccount locked outhandle not closableconnection refusedgraceful disconnectaddress already associatedaddress not associatedconnection invalidconnection activenetwork unreachablehost unreachableprotocol unreachableport unreachablerequest abortedconnection abortedbad compression bufferuser mapped fileaudit failedtimer resolution not setconnection count limitlogin time restrictionlogin wkstation restrictionimage mp up mismatchinsufficient logon infobad DLL entrypointbad service entrypointlpc reply lostIP address conflict1IP address conflict2registry quota limitpath not coveredno callback activelicense quota exceededpassword too shortpassword too recentpassword history conflictplugplay no deviceunsupported compressioninvalid hw profileinvalid plugplay device pathdriver ordinal not founddriver entrypoint not foundresource not ownedtoo many linksquota list inconsistentfile is offlineevaluation expirationillegal DLL relocationlicense violationDLL init failed logoffdriver unable to loaddfs unavailablevolume dismountedwx86 internal errorwx86 float stack checkvalidate continueno matchno more matchesnot a reparse pointIO reparse tag invalidIO reparse tag mismatchIO reparse data invalidIO reparse tag not handledreparse point not resolveddirectory is a reparse pointrange list conflictsource element emptydestination element fullillegal element addressmagazine not presentreinitialization neededencryption faileddecryption failedrange not foundno recovery policyno EFSwrong EFSno user keysfile not encryptednot export formatfile encryptedWMI guid not foundWMI instance not foundWMI itemid not foundWMI try againshared policypolicy object not foundpolicy only in DSvolume not upgradedremote storage not activeremote storage media errorno tracking serviceserver SID mismatchDS no attribute or valueDS invalid attribute syntaxDS attribute type undefinedDS attribute or value existsDS busyDS unavailableDS no RIDs allocatedDS no more RIDsDS incorrect role ownerDS ridmgr init errorDS obj class violationDS cant on non leafDS cant on RDNDS cant mod obj classDS cross dom move failedDS GC not availabledirectory service requiredreparse attribute conflictcant enable deny onlyfloat multiple faultsfloat multiple trapsdevice removedjournal delete in progressjournal not activenointerfaceDS admin limit exceededdriver failed sleepmutual authentication failedcorrupt system filedatatype misalignment errorWMI read onlyWMI set failurecommitment minimumreg NAT consumptiontransport fullDS SAM init failureonly if connectedDS sensitive group violationPNP restart enumerationjournal entry deletedDS cant mod primarygroupidsystem image bad signaturePNP reboot requiredpower state invalidDS invalid group typeDS no nest globalgroup in mixeddomainDS no nest localgroup in mixeddomainDS global can't have local memberDS global can't have universal memberDS universal can't have local memberDS global can't have crossdomain memberDS local can't have crossdomain local memberDS have primary membersWMI not supportedinsufficient powerSAM need bootkey passwordSAM need bootkey floppyDS cant startDS init failureSAM init failureDS gc requiredDS local member of local onlyDS no FPO in universal groupsDS machine account quota exceededmultiple fault violationcurrent domain not allowedcannot makesystem shutdownDS init failure consoleDS sam init failure consoleunfinished context deletedno TGT replyobjectid not foundno IP addresseswrong credential handlecrypto system invalidmax referrals exceededmust be kdcstrong crypto not supportedtoo many principalsno PA datapkinit name mismatchsmartcard logon requiredKDC invalid requestKDC unable to referKDC unknown etypeshutdown in progressserver shutdown in progressnot supported on sbsWMI GUID disconnectedWMI already disabledWMI already enabledmft too fragmentedcopy protection failureCSS authentication failureCSS key not presentCSS key not establishedCSS scrambled sectorCSS region mismatchCSS resets exhaustedpkinit failuresmartcard subsystem failureno kerb keyhost downunsupported preauthEFS alg blob too bigport not setdebugger inactiveds version check failureauditing disabledprent4 machine accountDS AG can't have universal memberinvalid image Win 32invalid image Win 64bad bindingsnetwork session expiredapphelp blockall SIDs filterednot safe mode driveraccess disabled by policy defaultaccess disabled by policy pathaccess disabled by policy publisheraccess disabled by policy otherfailed driver entrydevice enumeration errormount point not resolvedinvalid device object parametermca occureddriver blocked criticaldriver blockeddriver database errorsystem hive too largeinvalid import of non DLLsmartcard wrong pinsmartcard card blockedsmartcard card not authenticatedsmartcard no cardsmartcard no key containersmartcard no certificatesmartcard no keysetsmartcard io errordowngrade detectedsmartcard cert revokedissuing CA untrustedrevocation offline cpkinit client failuresmartcard cert expireddriver failed prior unloadwow assertionPNP bad MPS tablePNP translation failedPNP IRQ translation failedCTX winstation name invalidCTX invalid PDCTX PD not foundCTX close pendingCTX no outbufCTX modem inf not foundCTX invalid modemnameCTX response errorCTX modem response timeoutCTX modem response no carrierCTX modem response no dialtoneCTX modem response busyCTX modem response voiceCTX TD errorCTX license client invalidCTX license not availableCTX license expiredCTX winstation not foundCTX winstation name collisionCTX winstation busyCTX bad video modeCTX graphics invalidCTX not consoleCTX client query timeoutCTX console disconnectCTX console connectCTX shadow deniedCTX winstation access deniedCTX invalid wdCTX WD not foundCTX shadow invalidCTX shadow disabledRDP protocol errorCTX client license not setCTX client license in useCTX shadow ended by mode changeCTX shadow not runningcluster invalid nodecluster node existscluster join in progresscluster node not foundcluster local node not foundcluster network existscluster network not foundcluster netinterface existscluster netinterface not foundcluster invalid requestcluster invalid network providercluster node downcluster node unreachablecluster node not membercluster join not in progresscluster invalid networkcluster no net adapterscluster node upcluster node pausedcluster node not pausedcluster no security contextcluster network not internalcluster poisonedACPI invalid opcodeACPI stack overflowACPI assert failedACPI invalid indexACPI invalid argumentACPI fatalACPI invalid supernameACPI invalid argtypeACPI invalid objtypeACPI invalid targettypeACPI incorrect argument countACPI address not mappedACPI invalid eventtypeACPI handler collisionACPI invalid dataACPI invalid regionACPI invalid access sizeACPI acquire global lockACPI already initializedACPI not initializedACPI invalid mutex levelACPI mutex not ownedACPI mutex not ownerACPI rs accessACPI invalid tableACPI reg handler failedACPI power request failedSXS section not foundSXS cant gen actctxSXS invalid actctx data formatSXS assembly not foundSXS manifest format errorSXS manifest parse errorSXS activation context disabledSXS key not foundSXS version conflictSXS wrong section typeSXS thread queries disabledSXS assembly missingSXS process default already setSXS early deactivationSXS invalid deactivationSXS multiple deactivationSXS system default activation context emptySXS process termination requested (hardware), (dispatch), (storage), (itf), (win32), (windows), (control), (facility=%d), warning, %s%s%s%s%s%d/0x%ux - unknown NT error/dev/randomcan't open /dev/randomcan't read /dev/randomp->tbase != 0p->tbase != 0p->tparam != 0p->tbase != 0p->tdata != 0%d - unsupported DFS infolevel permission denied  #%&)*,/12478;=>@CEFIJLOQRTWX[]^abdghkmnpsuvyz|/factotum/boot/factotumauth_getkey: no /factotum or /boot/factotum: didn't get key %scan't fork for %s: %rgetkey-gnaninfinityinf7635118191655355242878388607671088631342177271251562519531251220703125152587890625190734863281251192092895507812514901161193847656257450580596923828125 dfs ping host=%s timeout=%d - cache hit icmp1dfs ping host=%s timeout=%d rtt=%d - failed @@out of memory allocating %lud memout of memory allocating %lud memout of memory in strdup(%.10s) memUsersGroupsSharesConnectionSessionsDfsrootDfscacheDomainsOpenfilesWorkstationsFiletableotherotherother< --.?./[/0123456789abcdef0123456789ABCDEFbad offsetXX YY|ɢԢܢ(9BPYnwţأ'8@QYqyˤѤդߤ #)-<BFU[_pvz˥ѥեߥ %)>DH\bfyȦΦauthinfobad auth info from factotumfauth_proxy - no factotumUNKNOWN AUTH ERRORstartfauth_proxy start: %rreadauth_proxy write fd: %rwriteauth_proxy short read: %sauth_proxy rpc write: %s: %rauth_proxy rpc: %r/mnt/factotum/rpcopening /mnt/factotum/rpc: %r#c/pid                ! ! !#!2!D!X!no errorinvalid functionfile not founddirectory not foundtoo many open filesaccess deniedinvalid fidmemory control blocks destroyed.out of memoryinvalid memory block addressinvalid environmentinvalid open modeinvalid data (only from ioctl call)reservedinvalid driveattempt to delete current directoryrename/move across filesystemsno more files foundgeneral failureshare mode conflict with open modelock conflictsrequest unsupportednetwork name not availableipc unsupported (guess)invalid share namefile already existsinvalid paramatercannot openinsufficent bufferinvalid nameunknown levelthis region already lockedrename failednamed pipe invalidpipe busyclose in progressno reader of named pipemore data to be returnedno more itemsinvalid directory name in a pathextended attributesauthentication failedbuffer too smallunknown ipcno such print jobinvalid groupnon specific errorbad passwordreservedpermission deniedtid invalidinvalid server nameinvalid deviceunknown smbprint queue fullqueued item too bigfid invalid in print fileunrecognised commandsmb server internal errorfid/pathname invalidreserved 68access is invalidreserved 70attribute mode invalidmessage server pausednot receiving messagesno room for messagetoo many remote usernamesoperation timed outno resourcestoo many useridsbad useridretry with mpx moderetry with standard moderesume mpx modefunction not supportedread only mediaunknown devicedrive not readyunknown commanddata (CRC) errorbad request lengthseek failedbad mediabad sectorno paperwrite faultread faultgeneral hardware failurewrong diskFCB unavailableshare buffer exceededdisk fulldosnetworkhardwareXosmx1mx2mx3packetunknown%s, %s%s, %ud/0x%ux - unknown errorbad length in 9P2000 message header<-%d- %F: dup tag <-%d- %F: %s <-%d- %F f != nillib9p: unused documented feature not implemented9Punknown9P2000error == nil%s: authentication not requirederror == nilcannot clone open fidno walk function, no file trees0opendirfile failedfid mode is 0x%ux no srv->readwrite on fid with open mode 0x%uxno srv->writeremove %s: %rconvD2M(_,_,BIT16SZ) did not return BIT16SZout of memoryconvD2M failswstat -- attempt to change typewstat -- attempt to change devwstat -- attempt to change qidwstat -- attempt to change muidwstat -- attempt to change DMDIR bitunknown messagesrv != nilr->responded == 00-%d-> %F n = %d %F n > 2lib9p srv: write %d returned %d on fd %d: %r/srv/%spostfd %s create fails: %r %dwrite fails: %r postfd successful q->size == t->sizeq->next==nil || q->next->prev==qq->prev==nil || q->prev->next==qq->magic==FREE_MAGICt->magic==FREE_MAGICa < t->size && t->size < bt->next==nil || t->next->prev==tt->prev==nil || t->prev->next==tt != nil (*t)->magic == FREE_MAGICnode != nil node != nil *loc == nodepool->nextpool->prevolst != nil B2NB(a) == bb->magic != FREE_MAGIC b->size >= dsize2bsize(p, dsize)b->size - dsize < 0x10000newarena %lud pool too big: %lud+%lud > %lud memory pool too largebot->aup == top && top > botpool %s block %p hdr %.8lux %.8lux %.8lux %.8lux %.8lux %.8lux tail %.8lux %.8lux %.8lux %.8lux %.8lux %.8lux | %.8lux %.8lux user data %.2ux %.2ux %.2ux %.2ux %.2ux %.2ux %.2ux %.2ux | %.2ux %.2ux %.2ux %.2ux %.2ux %.2ux %.2ux %.2ux %s %s pool panicbad magiccorrupt tail magiccorrupt tail ptrcorrupt tail magiccorrupt tail ptrdangling pointer writebad arena sizebad arena tail sizemem user overflow (magic0)corrupt tail magic0corrupt tail magic1corrupt tail ptrtoo much block datamem user overflowmem user overflowdon't call me when pool->move is nil B2D called on unworthy blockD2B called on non-block %p (double-free?)invalid allocation sizea->size >= nbsizecannot satisfy dsize %lud span %lud with align %lud+%ldD2B(p, c) == bpoolalloc %p %lud = %p poolalignspanalloc %p %lud %lud %lud %ld = %p poolcompact %p poolrealloc %p %p %ld = %p poolfree %p %p dsize >= getdsize(b)poolmsize %p %p = %ld found wrong tailpool %p %s (%p %.8lux %lud) p->tparam != 0p->tbase != 0p->tdata != 0\PIPE\LANMANWrLehB13%s%s: %d/%d - share list incomplete \PIPE\LANMANzWrLhB13BWzWWWzB9B%s\PIPE\LANMANWrLehzzDD%swarning: %d/%d - session list incomplete \PIPE\LANMANWrLehB21%s\PIPE\LANMANzWrLehB21%s\PIPE\LANMANWrLehB21%s\PIPE\LANMANWrLDiehB21%s\PIPE\LANMANzWrLhB21Bzzz%s\PIPE\LANMANWrLehDzB16BBDz%s\PIPE\LANMANWrLehDzzB16BBDz%s\PIPE\LANMANzzWrLehb8g8WWWzz%sattrbad directory in wstatR{PD?m@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@!   !!   !!! !!! !  ! !!!! !                                                                     ?$@Y@@@@j@.AcAחAeA _BvH7BmB@0BļB4&k C7yAC؅W4vCNgmC=`XC@xDPKDMDJ-DyCxD(,* E52TEqىE/'E!1Eꌠ9Y>)F$_FnFF"F|FMraB3G yhGiWCG*GJH\)c=H7]rHaxHyֲHL}YI\CkFI3T|I\'Isȡ1I:~^Jd~QJvaJ0}GJ>nllJ$KAjZK=P1PKMZ>dKW`M}Kmn/LDcL^LpuLafirM?O8MrbnMG9Mz)M:Ft NdȋBN=ֺ.wN 9iNCNuOILLO֯OO[пOE!P/'%UP_QP6PbDP{U[*QmUx`Q*4VQz5߼QlX R.4R9mr"iRY) kRعeR$N(Sa򮌮>S }W-sSO\]ScbuSp] T%L9hGT.B}T}Ô%IT\nTsqUFQU`RUxӫU?+dpU5=%VN=@[Vҟ&VG0JV=:YVf$0W&sdWW)>W]3sMXk5!a9XBioX)8ӣX*4X5AHxY(-\CYr%4xYv/AYiY?ZOMZ20HwZ~$|7Z-[bZXC}"[;/V[ ;C-[SJ[= \[M"4+\0IΕ2a\|AH\[R\ysKp]WPM4]mH=j]Į]-f]u8W]am ^|M$D@^`-Ut^x^WUH^P.5_[ypH_r]~_':__ k_EW`RVR`'.N`(:W"`Yv5`AZazptvwz}'1Va Jnoq/M@X 9 X a q w y      ( * 0 2 3 5 6 8 9 Y \ r t     ( * 0 2 3 5 9 \ ] _ a     ( * 3 5 9 X Y ` a     : ` a z  023@F@GIl*PUZ]efnpuHJMPVZ]`Zlo  1@Q`lnp wPmpt T3EK#MOZ} EHMPW_} !!!!*!-!/!9!@DJPR46NPnp!")247MOQRabgjlrtwy|֦4@Y$(= P ^ = q = = N ?aXY[]q  !!!$!&!(!N!'---o-/.ϩzª>< PoF$'9;BGIKTWY[]_d~no forker%s: announce %s: %r%s: listen %s: %r%s: accept %s: %r %s/remoteunknown                     NaN+Inf-Infe%de%de%dmainnet!%s!%snet!%s%s!%s!%s%s!%s%s!%s09`if o f o f o f o f o PY )@IFOPY@IPY )Ш٨ Щ٩PYfo6?can't enumerate shares: %r %-13q diskprintqdeviceipcspecialtempunknown%-8s %5d/%-5d %s RAPfileenum: %r %c%c%c %-4d %-24q %q raw-modempx-modeunicodelarge-filesNT-smbsrpc-remote-APIsstatus32l2-oplockslock-readNT-findDfsinfo-passthrularge-readxlarge-writexUnixbulk-transfercompressedextended-securityuser-authchallange-responsesigning-availablesigning-required%q %q %q %q %+ldsec %dmtu %s as guestcaps: %s security: %s transport: cifs over netbios transport: cifs RAPsessionenum: %r %-24q %-24q %12s %12s %-32q %q RAPuserenum: %r %-24q %-48q %q RAPgroupenum: %r %q %q workstationserverSQL serverDCbackup DCtime sourceApple serverNovell serverdomain memberprinter serverdial-up serverUnixNTWFWMFPN (?)NT serverpotential browserbackup browserLMBDMBOSF UnixVMSWin95DFSNT clusterTerminal server[26][27]IBM DSSRAPServerenum2: %r RAPServerenum3: %r %-16q %-16q v%d.%d %s, %d %d:%d:%ld %d:%d:%ld 9P protocol botch/env/%s  ( ((((( H GMT/env/timezoneGMTis a directoryokpermission deniedrequest not supportedaccess deniedpassword invalidnot listening on called namenot listening for calling namecalled name not presentcalled name present, but insufficient resourcesmore dataworkstation driver is not installedserver could not be locatednetwork cannot access a shared memory segmentA network resource shortage occurredThis operation is not supported on workstationsdevice is not connectedServer service is not startedqueue is emptydevice or directory does not existoperation is invalid on a redirected resourcename has already been sharedserver is currently out of the requested resourceRequested addition of items exceeds the maximum allowedPeer service supports only two simultaneous usersAPI return buffer is too smallremote API error occurredcannot open or read the configuration filegeneral network error occurredWorkstation service is corruptedWorkstation service has not been startedrequested information is not availableinternal errorserver is not configured for transactionsrequested API is not supported on the remote serverevent name is invalidcomputer name already exists on the networkspecified component could not be found in the config infospecified parameter could not be found in the config infoA line in the configuration file is too longprinter does not existprint job does not existprinter destination cannot be foundprinter destination already existsprinter queue already existsno more printers can be addedno more print jobs can be addedno more printer destinations can be addedprinter idle and cannot accept control operationsinvalid control function in printer requestprint processor not respondingspooler not runningoperation cannot be performed on the print destination in its current stateoperation cannot be performed on the printer queue in its current stateoperation cannot be performed on the print job in its current statespooler - no memorydevice driver does not existdata type not supported by the print processorprint processor is not installedservice database is lockedservice table fullrequested service already startedservice does not respondingservice not startedservice name invalidservice is not responding to the control functionservice control is busyconfiguration file contains an invalid service program nameservice could not be controlled in its present stateservice ended abnormallyrequested pause or stop is not valid for this servicecould not find the service name in the dispatch tableservice control dispatcher pipe read failedthread create for the new service could not be createdThis workstation is already logged on to the local-area networkworkstation is not logged on to the local-area networkuser name or group name parameter is invalidpassword parameter is invalidlogon processor did not add the message aliaslogon processor did not add the message aliaslogoff processor did not delete the message aliaslogoff processor did not delete the message aliasNetwork logons are pauseda centralized logon-server conflict occurredserver is configured without a valid user pathcannot run logon scriptlogon server was not specified. computer will be logged on as STANDALONElogon server could not be foundalready a logon domain for this computerlogon server could not validate the logonsecurity database could not be foundgroup name could not be founduser name could not be foundresource name could not be foundgroup already existsuser account already existsresource permission list already existsThis operation is only allowed on the PDC of the domainsecurity database has not been startedThere are too many names in the user accounts databasedisk I/O failure occurredlimit of 64 entries per resource was exceededDeleting a user with a session is not allowedparent directory could not be locatedUnable to add to the security database session cache segmentThis operation is not allowed on this special groupThis user is not cached in user accounts database session cacheuser already belongs to this groupuser does not belong to this groupThis user account is undefinedThis user account has expireduser is not allowed to log on from this workstationuser is not allowed to log on at this timepassword of this user has expiredpassword of this user cannot changeThis password cannot be used nowpassword does not meet the password policy requirementspassword of this user is too recent to changesecurity database is corruptedNo updates are necessary to this replicant network/local security databaseThis replicant database is outdated; synchronization is requirednetwork connection could not be foundThis asg_type is invalidThis device is currently being sharedcomputer name cannot be added - name may already existMessenger service is already startedMessenger service failed to startmessage alias could not be found on the networkThis message alias has already been forwardedThis message alias has been added but is still forwardedThis message alias already exists locallymaximum number of added message aliases has been exceededcomputer name could not be deletedMessages cannot be forwarded back to the same workstationAn error occurred in the domain message processormessage was sent, but the recipient has paused the Messenger servicemessage was sent but not receivedmessage alias is currently in use. Try again laterMessenger service has not been startedname is not on the local computerforwarded message alias could not be found on the networkmessage alias table on the remote station is fullMessages for this alias are not currently being forwardedbroadcast message was truncatedThis is an invalid device nameA write fault occurredA duplicate message alias exists on the networkThis message alias will be deleted latermessage alias was not successfully deleted from all networksThis operation is not supported on computers with multiple networksThis shared resource does not existThis device is not sharedA session does not exist with that computer nameThere is not an open file with that identification numberA failure occurred when executing a remote administration commandA failure occurred when opening a remote temporary fileData returned from a RAP command has been truncated to 64KThis device cannot be shared as both a spooled and a non-spooled resourceinformation in the list of servers may be incorrectcomputer is not active in this domainshare must be removed from DFS before it can be deletedoperation is invalid for this deviceThis device cannot be sharedThis device was not openThis device name list is invalidqueue priority is invalidThere are no shared communication devicesqueue you specified does not existThis list of devices is invalidrequested device is invalidThis device is already in use by the spoolerThis device is already in use as a communication deviceThis computer name is invalidstring and prefix specified are too longThis path component is invalidCould not determine the type of inputbuffer for types is not big enoughProfile files cannot exceed 64Kstart offset is out of rangesystem cannot delete current connections to network resourcessystem was unable to parse the command line in this fileAn error occurred while loading the profile fileErrors occurred while saving the profile fileLog file %1 is fullThis log file has changed between readsLog file %1 is corruptsource path cannot be a directorysource path is illegaldestination path is illegalsource and destination paths are on different serversRun server you requested is pausedAn error occurred when communicating with a Run serverAn error occurred when starting a background processshared resource you are connected to could not be foundLAN adapter number is invalidThere are open files on the connectionActive connections still existThis share name or password is invaliddevice is being accessed by an active processdrive letter is in use locallyspecified client is already registered for the specified eventalert table is fullAn invalid or nonexistent alert name was raisedalert recipient is invalidA user's session with this server has been deletedlog file does not contain the requested record numberuser accounts database is not configured correctlyThis operation is not permitted when the Netlogon service is runningThis operation is not allowed on the last administrative accountCould not find DC for this domainCould not set logon information for this userNetlogon service has not been startedUnable to add to the user accounts databaseThis server's clock is not synchronized with the PDC's clockA password mismatch has been detectedserver identification does not specify a valid serversession identification does not specify a valid sessionconnection identification does not specify a valid connectionThere is no space for another entry in the table of available serversserver has reached the maximum number of sessions it supportsserver has reached the maximum number of connections it supportsserver cannot open more files because it has reached its maximum numberThere are no alternate servers registered on this serverTry down-level (remote admin protocol) version of API insteadUPS driver could not be accessed by the UPS serviceUPS service is not configured correctlyUPS service could not access the specified Comm PortUPS indicated a line fail or low battery situation. Service not startedUPS service failed to perform a system shut downprogram below returned an MS-DOS error codeprogram below needs more memoryprogram below called an unsupported MS-DOS functionworkstation failed to bootfile below is corruptNo loader is specified in the boot-block definition fileNetBIOS returned an error: The NCB and SMB are dumped aboveA disk I/O error occurredImage parameter substitution failedToo many image parameters cross disk sector boundariesimage was not generated from an MS-DOS diskette formatted with /SRemote boot will be restarted latercall to the Remoteboot server failedCannot connect to the Remoteboot serverCannot open image file on the Remoteboot serverConnecting to the Remoteboot server...Connecting to the Remoteboot server...Remote boot service was stoppedRemote boot startup failed; check the error logA second connection to a Remoteboot resource is not allowedbrowser service was configured with MaintainServerList=NoService failed to startas no network adapters started with this serviceService failed to start due to bad startup information in the registryService failed to start because its database is absent or corruptService failed to start because RPLFILES share is absentService failed to start because RPLUSER group is absentCannot enumerate service recordsWorkstation record information has been corruptedWorkstation record was not foundWorkstation name is in use by some other workstationProfile record information has been corruptedProfile record was not foundProfile name is in use by some other profileThere are workstations using this profileConfiguration record information has been corruptedConfiguration record was not foundAdapter ID record information has been corruptedAn internal service error has occurredVendor ID record information has been corruptedBoot block record information has been corrupteduser account for this workstation record is missingRPLUSER local group could not be foundBoot block record was not foundChosen profile is incompatible with this workstationChosen network adapter ID is in use by some other workstationThere are profiles using this configurationThere are workstations, profiles, or configurations using this boot blockService failed to backup Remoteboot databaseAdapter record was not foundVendor record was not foundVendor name is in use by some other vendor record(boot name, vendor ID) is in use by some other boot block recordConfiguration name is in use by some other configurationinternal database maintained by the Dfs service is corruptOne of the records in the internal Dfs database is corruptThere is no DFS name whose entry path matches the input Entry PathA root or link with the given name already existsserver share specified is already shared in the Dfsindicated server share does not support the indicated DFS namespaceoperation is not valid on this portion of the namespaceoperation is not valid on this portion of the namespaceoperation is ambiguous because the link has multiple serversUnable to create a linkserver is not Dfs Awarespecified rename target path is invalidspecified DFS link is offlinespecified server is not a server for this linkA cycle in the Dfs name was detectedoperation is not supported on a server-based DfsThis link is already supported by the specified server-shareCan't remove the last server-share supporting this root or linkoperation is not supported for an Inter-DFS linkinternal state of the Dfs Service has become inconsistentDfs Service has been installed on the specified serverDfs data being reconciled is identicalDFS root cannot be deleted. Uninstall DFS if requiredA child or parent directory of the share is already in a DfsDfs internal errorThis machine is already joined to a domainThis machine is not currently joined to a domainThis machine is a DC and cannot be unjoined from a domaindestination DC does not support creating machine accounts in OUsspecified workgroup name is invalidspecified computer name is incompatible with the default language used on the DCspecified computer account could not be foundThis version of Windows cannot be joined to a domainpassword must change at the next logonaccount is locked outpassword is too longpassword does not meet the complexity policypassword does not meet the requirements of the password filter DLLsrap: %srap: %ud/0x%ux - unknown errorrfork: %rcifsdial: host=%s called=%s sysname=%s tcpcifsp->wordbase != nilp->bytebase == niln % 2 != 0 %+2d %02x cifsrpc: bad magic number in packet %20ux%02ux%02ux%02uxcifsrpc: invalid packet signatureMAC signature bad %ux != %ux bad sequence number %s%sNT LM 0.12NT LM 0.12no CIFS dialect in common%s dialect unsupportedplan9//%s/%s?????(n & 0xffffffff00000000LL) == 0 || s->caps & CAP_LARGE_FILES(off & 0xffffffff00000000LL) == 0 || s->caps & CAP_LARGE_FILESn < s->mtu - T2HDRLEN || s->caps & CAP_LARGE_WRITEX(n & 0xffffffff00000000LL) == 0 || s->caps & CAP_LARGE_FILES(off & 0xffffffff00000000LL) == 0 || s->caps & CAP_LARGE_FILESn < s->mtu - T2HDRLEN || s->caps & CAP_LARGE_READXabcdefghijklmnopqrstuvwxyzout of memorywalk in non-directory? %q? %q=%q %q:=%q_mkattr malloc: %r_mkattr malloc: %r_parseattr strdup: %rassert failed: %s O#O%I+O,O-OCHEӷGӷSIXJbJcGdJeӷfӷgӷhOlOnOoJpJrsIuOxJn] ]2]A3]VA]R]o]]]]6]7^8 ^9N^:s^;^B^C^D^E _F9_GV_I_J_K_O`S+`XV`Yu`Z`[`\`]`^a_Sa`iabacae bf6bgMbhfbibjbkblbmcn2codcpcqcrcsdtWdudvdwdxde7eJeleeeeee7flffffgTgggghDhrhhhhiLidiiii jEjcjjjjjj2kYkkkkl,lilllm#mBm`mmmmn&n^nnnn7o]ovoooopJpxpppq8qrqqq r>rerrrr-sMslsssst ]t t t t u Hu u u v 9v _v v v v v w! -w" Ww$ zw% w& w' w/ x2 9x4 bx5 x: xB xC xD yE EyF ~yG yI yJ yK zL 0zM RzN izO zQ zU zW {X J{` {a {b {c {d |e ;|~ Z| | | | | +} a} } } ~ <~ j~ ~ ~ ~  U    O  ؀  O    ( Y   ق   C     6 Z   ׄ  % E u 2 3 34 z5 6 7 -8 N9 : ; և< = !> N? x@ A ψB C 'D WE F G H I 8J vK L M N 6O RP Q ŋd e 9f tg h i j ak l эm n &o >p fq r s ؎t u Fv w x y (z O{   Ր  1 k  Б ! O    ֒ duplicate fid$@duplicate tagsbrkmem/env/MALLOCFDcanlock(&pv->lk)==0panic: panic: lu.dialupS-1-5-1lu.networkS-1-5-2lu.batchS-1-5-3lu.interactiveS-1-5-4lu.serviceS-1-5-6lu.anonS-1-5-7lu.DCS-1-5-8lu.enterprise-domainS-1-5-9lu.selfS-1-5-10lu.authenticatedS-1-5-11lu.restrictedS-1-5-12lu.terminal-servicesS-1-5-13lu.remote-desktopS-1-5-14lu.local-systemS-1-5-18lu.local-serviceS-1-5-19lu.network-serviceS-1-5-20lu.builtinS-1-5-32lg.nullS-1-0-0lg.worldS-1-1-0lg.localS-1-2-0lg.creator-ownerS-1-3-0lg.creator-groupS-1-3-1lg.creator-owner-serverS-1-3-2lg.creator-group-serverS-1-3-3du.adminS-1-5500du.guestS-1-5501du.kerberosS-1-5502dg.adminsS-1-5-21512dg.usersS-1-5-21513dg.guestsS-1-5514dg.computersS-1-5515dg.controllersS-1-5516dg.cert-adminsS-1-5517dg.schema-adminsS-1-5518dg.enterprise-adminsS-1-5519dg.group-policy-adminsS-1-5520dg.remote-accessS-1-5553da.adminsS-1-5544da.usersS-1-5545da.guestsS-1-5546da.power-usersS-1-5547da.account-operatorsS-1-5548da.server-operatorsS-1-5549da.print-operatorsS-1-5550da.backup-operatorsS-1-5551da.replicatorS-1-5552da.RAS-serversS-1-5553-unknownunknowncreate prohibitedwrite prohibitedIPC$#p/%d/args%s networkwalkedopendiropenfile%-9s %s billboydtrogbilltrogboyd(p = strrchr(path, '/')) != nil..///%s%s/%s/%s/*...%s/%s%s/%sinvalid attach specifier//..///not foundnot foundfilesystem does not support DMAPPEND%d bad open modeinternal error: stat of newly open/created file failed %d bad open modeCIFSopen, DMAPPEND not supported%d bad open mode%d bad open mode%s/%scannot generate info%s: close failed fh=%d %r %s: findclose failed sh=%d %r illegal operationpermission deniedillegal operationcannot change ownership(query) - %rillegal path(rename) - %r(set length, open) - %r(set length), set) - %r(set length, open) failed - %r(set length, write) - %r(set path info) - %r(set info) - %r(flush) %rdieusage: %s [-d name] [-Dvb] [-a auth-method] [-s srvname] [-n called-name] [-k factotum-params] [-m mntpnt] host [share...] usage#p/%d/args%s keepalivediealarm%s%02ux unknown/n/%ssysnameunknown*SMBSERVER%s - cannot dial, %r %s - cannot negioate common protocol, %r session authentication failed, %r %s, %r - can't connect can't enumerate shares: %r - specify share names on command line %s: %s %q - can't connect to share, %r no available shares wstat prohibitedpv~/netrefused%s/net.alttranslatedoes not exist%s%saddrs > 0alarmmalformed clone cmd from cs `%s'does not existalarm%sunknown error%s/cs%s/%s/clone%s!%sno address to dial%s%s/%s%ld%s/%s%s/%s/dataconnect %s %sconnect %snet5:FKwz|1GMqsa'h,l,,,,,Am#-3oz|az78HI~39?@O{}0_a+kwy '07@EPW`gp}!!+ P+^+q+~++++++1+2+4+@,A(,CB,DW,Ec,Fu,G,Q,R,S,W,X,Y-Z-[%-0-D-]-m----------...(."A.#L.$\.'r.%s %3d %02x windom=%s proto=pass service=cifs %scannot get key - %rwindom=%s proto=mschap role=client service=cifs %scannot get key - %rwindom=%s proto=pass service=cifs-ntlmv2 %scannot get key - %rplainlm+ntlmntlmntlmv2supported auth methods: %s usagentlmv2plaintext authentication required, use '-a plain'%s: %s - unknown auth method BSRSPYL Tversion tag %ud msize %ud version '%s'Rversion tag %ud msize %ud version '%s'Tauth tag %ud afid %d uname %s aname %sRauth tag %ud qid (%.16llux %lud %s)Tattach tag %ud fid %d afid %d uname %s aname %sRattach tag %ud qid (%.16llux %lud %s)Rerror tag %ud ename %sTflush tag %ud oldtag %udRflush tag %udTwalk tag %ud fid %d newfid %d nwname %d %d:%s Rwalk tag %ud nwqid %ud %d:(%.16llux %lud %s) Topen tag %ud fid %ud mode %dRopen tag %ud qid (%.16llux %lud %s) iounit %ud Tcreate tag %ud fid %ud name %s perm %M mode %dRcreate tag %ud qid (%.16llux %lud %s) iounit %ud Tread tag %ud fid %d offset %lld count %udRread tag %ud count %ud Twrite tag %ud fid %d offset %lld count %ud Rwrite tag %ud count %udTclunk tag %ud fid %udRclunk tag %udTremove tag %ud fid %udRremove tag %udTstat tag %ud fid %udRstat tag %ud stat(%d bytes) stat Twstat tag %ud fid %ud stat(%d bytes) stat Rwstat tag %udunknown type %d'%s' '%s' '%s' '%s' q (%.16llux %lud %s) m %#luo at %ld mt %ld l %lld t %d d %d%2.2uxpipe: %rpostfd %s: %rno forkermount %s: %rnot listening on called namenot listening for calling namecalled name not presentinsufficient resourcesunspecified errorudp137137*dumptcp139dumpdumpnbdial: bad error pktNBT: %d - unknown errorNBT: %snbdial: too many keepalivesnbdial: too many redirectsnbdial: bad redirect pkt%d.%d.%d.%dnbdial: 0x%x - unknown packet in netbios handshakedumptxnbtrpc: write failed - %rnbtrpc: short read - %rnbtrpc: too many keepalives (%d attempts)nbtrpc: packet bigger than MTU, (%d > %d)dumprxlogpkt.log%d %02x %s : len=%ud sum=%d mag=0x%ulx cmd=0x%ux err=0x%ulx flg=0x%02ux flg2=0x%04ux dfs=%s ynpidl=%ud res=%uld sid=%ud seq=0x%ux pad=%ud tid=%ud pid=%ud uid=%ud mid=%ud words=%ud totparams=%ud totdata=%ud maxparam=%ud maxdata=%ud maxsetup=%ud reserved=%ud flags=%ud timeout=%uld reserved=%ud paramcnt=%ud paramoff=%ud datacnt=%ud dataoff=%ud setupcnt=%ud reserved=%ud trans2=0x%02x data-words=%d padding=%d words=%ud totparams=%ud totdata=%ud reserved=%ud paramcnt=%ud paramoff=%ud paramdisp=%ud datacnt=%ud dataoff=%ud datadisp=%ud setupcnt=%ud reserved=%ud err=%s err=%s %06lx %c %02ux ? !.?Oh w     #9Pbm~ !"#$g'@:@O@g@y@@@@@ @ @ @$ @; @L@h@x@@@@@@@@@@ @/@=@M@[@l@| @!@"@#@$@%@ &@!'@7(@J)@`*@k+@~@p@ @ @ @/=R a p  '>Uew !"#$%&&/'K(a)t+8H[p     2>K^q#9K d!v"#$%&'()* +,0->.V/l01234578 9:';8<E=U>`?j@zABCDEFG HI,JCKYLoMNOPQRSTUVW6XGYYZg[}\]^_`ab cd%e2f@gPhdioj~klmnopqrst8uHv^wjxvyz{|}~+;Pav%:Ras(:Odx  /F_v$:Pdx 9L]l| /BR_v (>Qi*<Qey/D[n}(3E W n   %7Tkr $!6"L#Y$i%w&'()*+,- .#/80N1c2y3456789: ;</=@>L?Y@lA|BCDEFGHIJ'K3LDMWNeOyPQRSTUVWXY%Z:[Q\c]^_`abcde'f=gRhgijklmnrs t#u8vOw\xezt{|}~  5E[m{ /DTf(;Od|    , =L`v(<Vh !"#$2%<&L'](q)|*+,-./012 3)4<5P6c7w89:;<=>?@)A<BSCdDqEFGHIPQR+S:TOUdVyWXYZ[\^_ `3aPbicdefghijk%l;mKn]oqpqrsuvwxy)Dau /6@M`r4Ocw!9Ney  - B Q l         " 5 I X l ~       ' = c      J b t         3 U n       $<Riu-I^t $ 8 M \!x"PQRSTUVWX:YOZd[q\]^_abc#dCeWfphijklmno"6Mn/E\w567     % = S f        1 E ^ |  " $ & ' ( * + ;. J/ [0 n1 2 3 4 5 6 *CZw    . G_|!2FZm    0 G^p'6I a!{.@ U l  3proto=p9any role=clientqunlock called with qlock not held, from %#p /X8XAXIXUX ]X@mXvXXXX X@XXX X@XX.269GJv{}"2HNpr`&Y_g,k,,,,,@l".2ny{AZ   %?  ~P/ 1V0`(/8?HMho`!o!$$,.,0~,,!: '(09xyO ~:+*;=]>(*AC=DEEGFv&@``A&!*!A+!2!!`,b, c,d,m,n,o,p,r,u,,}u~ZZ  ( ) / / _ _ 00A0Cstat prohibitedfl->f == nilf->ref == 0no parentcannot remove roothas childrenparent changed underfootfl != nil && fl->f == fcreate in non-directoryfile already existsunknown../none.269GJv{}2HNpr`&Y_g,k,,,,,@l".2ny{AZxy:;=>CF/1V(/8?HMho`!o!$$,.,b,d,m,p,~,,}~!:'Av2!!`,r,u,,couldn't parse wait messagep->tbase != 0p->tbase != 0p->tparam != 0p->tbase != 0p->tdata != 0S-%ud-%llud-%udS-%ud-%llud-%ud/dev/usernonenoneZ&Z-Z8Z;ZEZQZ^ZlZzZZZZZZZZZZZZZZZZ[[[[GMTThu Jan 01 00:00:00 GMT 1970 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/env/timezoneGMT69GJv{}2HNpr`&Y_$!(!g,k,,,,,@l".2ny{AZxy:;=>CF/1V(/8?HMho ! !!!!!*!-!0!3!>!?!`!o!$$,.,b,d,m,p,~,,}~!:'4Mh  89;>@DJPl!<Up4VnAv!!!E!!`,r,u,,F (( ((@@@@@@@@ """"        @P@@@@P@@P@@@@P@    @@@@@@@@@@@@@@@@   @P@P @ P @ P     ""  ""A/mnt/factotum/rpcstartreadbad answer from factotumetextpanicbuflibthreadamount_getkey.stringkalarm.s%raperrstr.c/name$4fabs.c.stringEnoremovecifs.ccifs.h__totitlep__totitler`__totitlesBilltrog .stringzdial.cgenrandom.chEbadcounttfsstrtod.c;strrchr.cEunknownfidDreadn.c:strstr.cblocfmtlock.c Infdir..brk_.sP.ratholeXtimezonetransnt.cauth_getuserpasswd.cNatol.catom.sEnotfoundEbadattach.stringNBerratnotify.csha1block.s__toupperp__toupperrp__touppersfile.c&auth.cauth.hH.stringattr.c8utflen.cIpch.stringauth_rpc.cqlmount.spow10.cԔEcreatenondirendFmalloc.cmemccpy.s fcall.hinoted.sԬ.string.stringhmac.c4$0.0ptm2sec.c5argv0.s _dialfork.cexec.s<.stringMcistrcmp.cbdatautfecpy.cannounce.csbrkmemprivinit$4Epermparitymain.cinfo.c 8.stringedata libc.arfork.c libc.herfork.sstrtoul.c .stringargv0 thread.h386pread.s!p$0.c1e00000Lcistrncmp.cgetuser.c!xqsep!.string!dmsize!$0.408f4000!.stringlibsecvqlock.conexlockbsemrelease.s_sysfatalxtime$7pack.c Shares fmtallocawait.sygetenv.cjclose.strerrstr.c"l.stringfauth.sIlock.clibsec.a"sbrkmemlibsec.htimezone"misc.c u.hcmd#<.string#lEbadoffsetRfmt#xsectab$13xuser$1#knownsrc%.stringsysZprint.cnetbios.ccbuf$12&.stringArunetypebody-6.2.0.hxgetpid.cwhen$45asleep.suread.ce$30sha1.cHost_dofmt.c Cache&tab1'\tab2*ping.c$doquotepipe.sgnsec.s(SessxRoot'.string..stringfopen.sfmtldseek.s/.string2 keysh,dialects$242L.stringssbrk.cintmap.c3memcmp.s0Keeppid4magic{ctime.c8<.string2memcpy.s8_tospool.cGpool.hx917state<__assertpost.c9.stringYsmprint.cTnpath$9`9syscallTonex:Ebaddir:$509f7b52.3fd34413:$dmsizeqtime.c!sid2name.c:XspboxBXtabwait.cGX__isalpharSP__isalphasT.stringlibauthsrv.a1memmove.sUDtabV.stringV$_exits@IpcnameV,.stringcsemacquire.s\tmp$12stat.sVT__isdigitrW.stringCrune.c0memset.sDimagmemHap$4Lap$10pbuf$1fcallfmt.c^fmtfd.cauthsrv.h[Ebotchmuldiv.spwrite.spbuf$1auth_attr.c}vlop.sKctype.cctype.hPdatamagicpaddr$1trans.chnotify.s[.stringlibthread.aamount_getkey.c[tabamount.c6vlrt.cowerrstr.cponnotlockxbuf$1T_rendezvouspfltfmt.cSvsmprint.cEnetmkaddr.cread9pmsg.c[_ctype\.stringfrexp.cXmainmem\EisdirTfmtdef.h].string\freefilelistexecl.cp.stringremsmb.h@runetype.cauth_getkey.clib9p.aauth_respond.ctrans2.c.stringhEnomemx.stringauthlocal.hEwalknodir4main9.s$0.3ff00000Pabs.cutfrune.cmd5block.slibauth.a.stringXsnprint.c`first$21l_exits.sdes.c)dfs.cincluded_nprivatesWsprint.c.stringknownfmtldmsizeauth_proxy.cfid.cmd4.cRAPerrsmd5.chCheckcaseEdupfid$$0.40240000seprint.c]fmtprint.ctokenize.c,Eduptagwpostnote.cfmt.c<.stringthreadimpl.hlrandfd$1|.stringlisten.cpNsharesBrunebsearch.cEnocreatelib9pnan.cerrfmt.cmem.clibautht_forker(libmp.aEnowrite .stringlibmpJgetfields.cEnowstatmethods\fmtstr.c>strecpy.c(.string9p.href.c __islowerp __islowerr__islowersreq.capinums.h.stringvsnprint.c~tas.sgetcallerpc.sm9sysxonnotdirread.cuid.cDOSerrs.string.string .stringrsysfatal.cUvseprint.cxDfstoutHtos.hOatexit.csrv.cnwrite.c[fprint.c|ActiveP.stringconvD2M.ctruerand.cnullstringerrstr.ssh$109NTerrs@.stringVvfprint.c9toupper.cfilelk/strcat.sX.string܈captab$13fmtquote.c fs.c__tolowerpޘ__tolowerr`__tolowers0__isspacercifs|abort.c$0.41b00000$0.43300000Enostat.strchr.sconvM2D.c'mp.h.stringrendezvous.sfmtvprint.c?strcmp.c+libc$doserrstr.cos.hh__istitleph__istitler__istitlesconvM2S.cQ_assert.c-strcpy.s\.string7portCachedesmodes.cstrdup.ccreate.sdirstat.cDebugchatty9pconvS2M.c,strlen.s=strncmp.c|.string.stringtypes$36keepaliveX.frame0fre(tot8i CD (7!istrecpy.framefromtoe+7? CD (:!strcmp .frames2s1+7@ CD (,+7A !isspacerune.framec"Cisdigitrune.framec"isalpharune.framec#isupperrune.framec$islowerrune.framec$istitlerune.framec%toupperrune.framec&tolowerrune.framec'totitlerune.framec+7B CD (<(_runebsearch .frame nentc+7C CD ()chartorune.framecstrrune*runetochar.framerunestr*runelen.framestrrunec+ runenlen.framenruner+jfullrune .framestrn+7D CD (<+readn.frame tfaavn+7E CD ()Fw,alarm.frame+`lQF_exits.frame+mn CD (.QNwrite.framenbuffd+mo CD (4Qwerrstr.frameargbuffmt+mp CD (Qyrsize.frame.safeyR(tm2sec .frame ydayiyearsecstmSreadtimezone.framepibufTrd_name .framepfU\rd_long.framefp+mq CD (3Utime(.frametpt.safe+mr CD (BV1_sysfatalimpl.frameargfmtbufVsysfatal.frameargfmt+ms CD (IVbrk .frameblpWsbrk .framenbl+mt CD (3Wfrerrstr.framenbufbuftmp+mu CD (.Wread.framenbuffd+mv CD (W_qlockinit.framerXgetqlp.framepopXbqlock.framempqXqunlock.framep.safeqYcanqlock.frameqYrlock.framempqZcanrlock.frameqZrunlock.framepq[owlock.framemppq\ canwlock.frameq\Vwunlock.framepq]Yrsleep.frametmer^Trwakeup .framer^rwakeupall .frameri+mw CD (F_postnote.framernotefgroupfilepid+mx CD (7`getpid(.framefb+my CD (J`ugetenv.frameans sf.safe|enamename+mz FG +Mb;dialimpl.framealterrerrrvdest cfdpdirdslocalcdial.frame cfdpdirlocaldestdconnsalloc.frameaddrsdpdfreedest .frameoalarmdpecloseopenfd.framefdpe(notedeath4.frame$conndpexitsts fieldsf'outstandingprocs.framedpf[reap .frameexitstsdpffillinds.frameconndsdpgDconnectwait.framebesterrconndph5parsecs.framedestpclonepdestpdphpickuperr .framebesterrerriBcatcher .framesildialmulti,.framerverrdsbesterr kidmedestclonedpjcsdial.frame$err$dest clone2besterrcbleftaddrpaddrs.safe rvclonefddsbufdpocall0.frame nfddestcalleralarm dpdata.safenamecfdconndscnameclonet_dial_string_parse.framestrds+m{" cd HVtctime .frame.safettlocaltime.framectdlflagtimugmtime.framed0d1day.safetimw/asctime.frametxldysize.frame.safeyxct_numb.frame.safencpyreadtimezone.framepibufzrd_name .framepfzrd_long.framefp+m| CD (.{fabort.frame+}?{p_mulv.frame bar{_mul64by32.frame bar{_div64by32.frameba r{_addv.frame bar{_subv.frame bar+~|_tas.framel+6|memccpy.framep1cp2 n+Y|Painc.frameaddr|badec.frameaddr|t_xinc.framel||_xdec.framel|cas.frame|casp.framenvovp|casv.frame nvovp+|getcallerpc.framev+7 CD (C|utfrune.framersc+7 CD (;}Nutfecpy.framefromtoe+7 CD (}qtoken.frametsepquotings~`etoken.framesepquotingt~gettokens.frameargs sepmaxargsnargssQtokenize.frameargsmaxargsnargss+7 CD (strtoul(.frameendptrmovfl$ndignegnptrbase+7* kl PQG checklist .frameqtchecktree.framebatnltreewalk.frametsizetreelookup .framesizet treeinsert.frametreenodeptreedelete.frameloctreenode>treelookupgt.frametsizevlistadd.framenodelistlistdelete .framelistnodepApooladd .frameolstparent nodepanodepooldel.frameolst parentnodepdsize2bsize.frameszp!bsize2asize.framepszHblockmerge.framepoolabblocksetsize .framebsizebZgetdsize.framebblocksetdsize.framebdsizepBtrim.frame fragextrabdsizep6freefromfront.framebbskipbparenasetsize.frameasizeapoolnewarena(.framebapasizeblockgrow.framedsizensizeapbarenamerge.framebbotbtoptopbotpdumpblock<.frame cppbprintblock.framebmsgppanicblock.framebmsgpQblockcheck0.frameeqbq dsizeaq intbp9arenacompact$.framebnxtwbcompacted ebapspoolcompactl.frameacompactedpoolB2D .frameapD2B.frameavphpoolallocl .frame ab.safebsizepdsizepoolreallocl8.framenewb$nvleft(.safe rightnbsize obsizeodsizeapvndsizealignptr .framevoffsetalign poolallocalignl0.frameb cv.safespanasizepdsizealign offsetypoolfreel .frameabpv`poolalloc.framevnpkpoolallocalign(.framevspan offsetalignnppoolcompact.framervpppoolrealloc .framenvnvppoolfree.framevppoolmsize .framebdsizevppoolcheckarena.framebpatailatpoolcheckl.frameappoolcheck.frameppoolblockcheck.frame.safevpLpooldumpl.frameappooldump.frameppooldumparena.framebap1memmark.framesigvsize+7 CD (`notifier.frameisvatnotify.frameinf ret+R CD (<vsnprint<.framefmt args0fbuflen+R CD ()+RT~1fmtvprint.framefmtargsvaf+R CD ()+RT~Ut_fmtinstall .framecffmtinstall.frameretfcfmtfmt.framepc_fmtdispatch,.frame$.saferuneflpwfmtfisrunes+R CD ()FG+RTxadd .framevanxsub .framenvaKxdtoat.frameDc2Lc4Hc3@c18is1,h4dd.safe$g0eXchrPucaseTsigns2f\precfmtP_floatfmtt.frame`.safefUsfmt_efgfmt.framedf+R CD ()+RT~errfmt.framef.safebuf+`erendezvous.frame+`mpwrite.frame+`upread.frame+`}errstr.frame+`brk_.frame+`await.frame+7 CD ()FKstrtod@.frame0.safeLdmd4blockp.framei`xdc bas endlenpмmd4.frame@xebufdigestiplen sencode .framelenoutputinputddecode.frameleninputoutput777 DE )*+WԮmd5.frame@xebufdigestiplen sKencode .framelenoutputinputؕhmac_md5$.framesdigest klenkeylenp777 DE )*+hmac_x\.frameEinnerdigestdigestlenpxkeyEpad klenxlens777 DE )*+setupDESstate.frameiveckeyshsetupDES3state.frameiveckeys777 DE )*+,block_cipher.frameikeystepdecryptingkeytexttriple_block_cipher$.frameiexpanded_keyendejtextkeycompperm.frameekrightleftdes_key_setup .frameekkey3des56to64 .framek64k56des64to56 .framek64k56key_setup.frameekk64key _sha1blockd.frameLtmp2Htmp1stateDwarray\w80aw80Xw60Taw60Tw40aw40Pw15aw15`edatalendata_md5block.framestateedatalendata CD () EF  setfcallerror.frameerrfchangemsize.framemsizesrvgetreq4.framerfbufnsfilewalk.frameifrewalkandclone.framewalk1i argrclonesversion.framerrversion .framererrorZsauth.frameersrv rauth.frame.safeerrorrUsattach .framersrvrattach.frame.safeerrorrsflush .framersrvOrflush.frameorrerror/oldwalk1(.frameqidnamefidargtoldclone.framenewfidfidargswalk.framersrv4rwalk.frame.safeerrorrsopen.framersrvropen.frame.safeerrbuferrorrscreate.framersrvrcreate.frameerrorrsread.framersrvrread.frameerrorrswrite.frameersrv )rwrite.frameerrorr Psclunk .framersrv rclunk.frame sremove.framersrv |rremove.frameerrbuferrorr sstat .framersrv Mrstat.framestatbufn tmprerror *swstat.framersrvrwstat.framesrv.framesrvrespond.framei.safe nerrbufsrvrerror/responderror.framererrbufhpostfdh.framepfdfdnameTbuf CD ()  ;<9V|rforker.frameflagfnarglistensrv .frameaddrspostmountsrv.frame flagmtptnames CD ()  ;<9: $_postmountsrv.frame flagmtptnamefdspostproc.framesv CD () EF 4increqref.framerv7allocreqpool .framedestroyfkfreereqpool .framepallocreq.framerpooltaglookupreq.framepooltagVclosereq.frameir0removereq.framepooltag CD () EF temalloc9p.frame.safevszerealloc9p.frame.safenvszvestrdup9p.frame.safets CD () EF *_listensrv.frameaddross~listenprocx.framedsXdata(ndirTctlPdir`osv! srvproc.framesdatav!Tgetremotesys.framefdsysndirbuf CD () EF h".hashid.frameid"6nop.frame"7allocmap .frameinc"cfreemap.framep nlinkmapidestroy"llookup .framemapid#lookupkey.framevidmap#uinsertkey.framefvovidmap$ caninsertkey.framevfrvidmap$deletekey.frame ovidmap CD () EF b$allocfile.framea f%freefile.frameflflnextf&cleanfilelist.framelf&closefile.framef'"nop.frame'#removefile.frameflfpf(createfile.framet permauxuidfname fllfp+walkfile1.frameflfpelemdir+walkfile.frames nextsosfpath,alloctree.frame destroymodemuidgiduid ft-_freefiles.frameflflnextf.Afreetree.framet.bopendirfile .framerdir.readdirfile.framembuf flrn/Sclosedirfile.framer CD () EF /incfidref .framev/allocfidpool .framedestroyf/freefidpool .framep0#allocfid.framefpoolfid0lookupfid .framefidpool0closefid.framef1>removefid .framefidpool CD () EF 1[dirread9p\.framervgenauxLdp epstartr CD () EF 2hasperm.frameuidmpf CD ()fgh3Bdorpc.framegetkey lenvalverbrpc3auth_respond4.frameuser nusersarespnrespnchalchalgetkey.safep argfmtrpcafd CD ()5dorpc.framegetkey lenvalverbrpc6-auth_getuserpasswd@.framepfgetkey(.safe argfmtfdparamsrpc$up CD ()8auth_getkey(.frame pidparamsname CD ()fghp9 auth_attr.framerpc CD ()c9R_attrfmt$.frame afmtbebufbuf:~_copyattr .frame .safealana;_delattr.framenamelaa;_findattr .framena;_freeattr .frameanexta<)_mkattr.frame.safe nextvalnametypeafdirconv`.frameebuf.safedtmpcdumpsome.framei peansbuf count+m CD () e[dirstat(.framebufnamedind+m CD () 7f'pstring.framenpsfpqid.framepqg5stringsz.framesgYsizeS2M.frameinficonvS2M.framepiapnap sizef+m CD () r[gstring.framesnpeprgqid.frameeppqsfconvM2S .frame iepsizenapapf+m CD () }zstatcheck .framebufnbuf}convM2D0.frame nspsviebufbuf strsdnbuf+m CD () sizeD2M .frameinssvdconvD2MD.frame4ss0nsvi nssvebufpbufnbufd+m CD ()FUGannounce(.framedir buf2n bufctl netdir naddraddrlisten$.framenewdirnctldir buf/accept.framectlbufdirreject .framenctlcausebufdiridenttrans.frame nanaddrnetdirnffilepaddrprotoZnettrans4.frame pn.safenf filenanaddrfdbufip2netdiraddr+`stat.frame CD () wincref.framerdecref.framer w AIGOK  \IHW.IDXDTB MFNINRPMI BD CHXQTXZBQB BD DT GCZ NQUb HFC;NIBAFUG G CCJ CFF CB (DPUoxm~A GD A# L WOCHm"AaBHE"TN K QD^C[DXCTT#ςEJC\C AAcDKCZCOW NG CB 9z/CvT g!n*MWCJDK H X IFI IFI IFI KFJQ AKIITLPK# NJOgg+CDC ACEaF Bg) BB _VbB&cB'!AG F G BHATF":x(AXQM I&#`_fD'xNMEp6 MDBFABSbbbAyACD GCBDAAG EB DCAA FNAGCCAVDAB NG FՂBPH F B^!RHI FCAES"G I "BBAUEGK BK $AJ GB A݆AD FE AABAABBBBcWZ]QCEK N!ABB]VY\PCDJ M BBDDA   PDY. E FEAJFDABLAI BB BKB BAAABWBY/M J D !CB[eBCBPQQ AKF`AASLBM`K_haXv KhBD^ROIC ACLaM*W IEDDLLBAv3}:o,BQh%L BXaDBGAAF HPAIADLPBK B2BADADDADD}ADDADDADDADDE ACG TC M XGFAF C GAGB`BG J GC-T7DAFDBB d[NK O\QCENCETCATAPKI TADA%dEABACCoJOiJBAHHIHHVIW lGC XCABBF ACACH UEDKH EHDKV+AODD BEBENAAH FEBHJCAHCKCAYHHZU RBMEpVUQPL K GEB_ IGEB\VSPYBK EJzBBBGBBGBBBB%BBADSX/VDDBE BEGKFAM]GKH IKENILEIDGS  CS PKB(C AH AA GBCBAF AVEP  CNDTOE*ACYHG\AELGD CO AAQAXRDDBE BEGމ؃{CYd %FLJBMBUH OTBOH OSDFA DFA   QPCETHQOWHFF H H JHEKN IQEFH K DJHVG ALCPH  I DGm5BOIK:|$wBF4`FCP [ NME%AFAB  CMi(CPYS L7  ABDYPK2BBCEFEBBCEFEBCEFEBBCEFEABCEFEBBCEHCHECAAAAAAACVFJDfK&MEDD7 I~M7g i+l%NDG&gx;U]A{Q>gG KG BB C$ VDDD QHGQHC|Ln J rDIz ~BBBBBxE"niABECAZArBVAVAXw}|rCdFc#_n0q+ }9yGDZV NBBRCAAAVEYDLDFC ELH"gfA I VV$CCCσMI F ABRIEc Te%SFI QIE ARIEm AUAO>[!w= [i0v[f`J BBNBGCFHAAANDNECJM M GLL GGLGFI T1 IGEDCGGMGFCBCE BNG K J I LGN MOCRQPSUTUAU[ M NCG K I CCGHECD]CD$ CEz}AK bQH TCAC B I IBzACCJ CBE Q A\BK+AGJ VCFBC k KLEHD G ID  aKI JMGLACAKEHCE BG AAGCG GE JKOS\B LCWL ROIFBA%AD %AZ  TMJNIAOC[.lv0MOI_NO; Q IEEPBUUBANDQAL6PBIDBBBB[Ga wpsvlBdh`BAEZ]BMEHABt5z:~>r0Bh*m-g'B\a!d$[WBCPL  KDOAB7P] ru4|i)Bc%kp0BATxa BY^WBTQJBEQBAGB};\>]s3Bm/oz:BzA]kA%_xnBYeZBTTBOIBFԈC-сTHCB4PCHBo݄}B4k(W`Cap{zCrYCkNC^ЊCMMFBEH oq  F E  CoKۄt